F433235

General Info

Members Datasets Scaffolds Average Seq Length
395 240 790 648

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10045275|Ga0207689_100452751
Length 758
Sequence MSAQLRSGAGRSAGRSALAFNPRVPGSIPGRPTQVKDLLATQIELGVVLFMVRTVSPCVHGPFDVCPTRPRSHRDCGLRGLLGFASHGNSNDSSFPSRQSHLAFLVLECLGMSGSPQTFPQLLLLHAKERPDAVAMREKQFGIWQALSWSALLSMVRALAAGLAAAGLSRGQHIVVIGANRPRLYASMLAAQSVGAIPVPLYQDAAAAELVFPISNAEVGFAIVEDQEQVDKLLEVRQRFPGLARIWYDDPRGLRSMREPGVESLDTLVKAGMARDASDPTQFDVDIGRGRGTDVAALFFTSGTTGTPKGVMHTYAALIDRSLAGARFDKITPADEVLAYLPPAWVGQNIFSYAMWLAVGYIVNCPESADTVTIDLKEIGPTYYFAPPRVFEAFLTSVTIRMEDAGRPKRWLYDRFMGLANRIGRRLIEDQPVGVVDRLLYALGDLAIYGPLRNTLGMSRVRVAYTAGEAIGPDLFSFYRSIGINLKQLYGSTETAVFVCLQPDHEVRADTVGVPIDGVELKFASTGELLLRSPGLLKGYYKNEAATAEVLDSDGWYHTGDAGFLDAGGHLKIIDRAKDVGRLANGALFAPKFIENKLKFFPYIKEAVAFGDGREKVCALVNIDYSAVGNWAEKRNLPYAGYADLASKAEVYELIRTCVNKVNADLAADERLAGSQICRYLVLHKELDADDDELTRTNKVRRGFINEKYAVLVDALYGGLEQQYVETAVKFEDGRSGVVSAHVRIADAQTFPLQKAAA

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
132 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
173 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
174 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
175 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
201 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
202 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
211 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
212 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
215 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
216 2547132374 Acidovorax radicis N35 Isolate Unclassified
217 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
218 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
219 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
220 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
221 2643221585 Pelomonas sp. Root662 Isolate Unclassified
222 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
223 2643221609 Acidovorax sp. Root217 Isolate Unclassified
224 2643221611 Acidovorax sp. Root219 Isolate Unclassified
225 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
226 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
227 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
228 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
229 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
230 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
231 2643221656 Pelomonas sp. Root405 Isolate Unclassified
232 2643221717 Acidovorax sp. Root267 Isolate Unclassified
233 2738541337 Pelomonas sp. BT06 Isolate Unclassified
234 2738543012 Acidovorax sp. CF301 Isolate Unclassified
235 2816332133 Acidovorax radicis 2721A Isolate Unclassified
236 2831864461 Roseateles noduli HZ7 Isolate Nodule
237 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
238 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
239 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
240 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.42
Metatranscriptomes 0
Isolates 6.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.73
Nodule 0.76
Rhizoplane 0.76
Rhizosphere 66.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10045275 3300025942 Bacteria 3639
2 JGI25155J39150_1000067 3300002704 Bacteria 68902
3 JGI25156J39149_1000013 3300002705 Bacteria 189553
4 JGI25154J39366_1000032 3300002738 Bacteria 189265
5 JGI25157J39369_1000017 3300002741 Bacteria 189553
6 JGI25150J39212_1004205 3300002774 Bacteria 3239
7 JGI25159J45721_1001195 3300002987 Bacteria 11063
8 JGI25159J45721_1001596 3300002987 Bacteria 9258
9 JGI25153J46596_10000543 3300003215 Bacteria 23510
10 JGI25160J50197_1000204 3300003354 Bacteria 49352
11 JGI25160J50197_1005548 3300003354 Bacteria 5235
12 JGI25161J50226_1000036 3300003374 Bacteria 133407
13 Ga0055526_1000414 3300003771 Bacteria 34422
14 Ga0055526_1001819 3300003771 Bacteria 14756
15 Ga0055526_1017354 3300003771 Bacteria 2752
16 Ga0055537_1000596 3300003773 Bacteria 20124
17 Ga0055524_1000145 3300003775 Bacteria 84202
18 Ga0055528_1000524 3300003790 Bacteria 29831
19 Ga0055540_1000237 3300003792 Bacteria 50309
20 Ga0055531_10000179 3300003794 Bacteria 72059
21 Ga0055531_10001626 3300003794 Bacteria 16291
22 Ga0055543_1001540 3300004625 Bacteria 8994
23 Ga0055543_1003568 3300004625 Bacteria 4508
24 Ga0065165_1000177 3300005262 Bacteria 113446
25 Ga0065165_1002331 3300005262 Bacteria 16569
26 Ga0065707_10084610 3300005295 Bacteria 6985
27 Ga0070676_10021699 3300005328 Bacteria 3596
28 Ga0070676_10025551 3300005328 Bacteria 3339
29 Ga0070690_100002408 3300005330 Bacteria 10049
30 Ga0070690_100009776 3300005330 Bacteria 5564
31 Ga0070670_100003550 3300005331 Bacteria 12975
32 Ga0070670_100098658 3300005331 Bacteria 2514
33 Ga0070677_10002402 3300005333 Bacteria 5970
34 Ga0068869_100009917 3300005334 Bacteria 6189
35 Ga0068869_100024281 3300005334 Bacteria 4198
36 Ga0068869_100038923 3300005334 Bacteria 3392
37 Ga0070680_100016779 3300005336 Bacteria 5763
38 Ga0068868_100003620 3300005338 Bacteria 10778
39 Ga0070660_100028021 3300005339 Bacteria 4210
40 Ga0070668_100019956 3300005347 Bacteria 5051
41 Ga0070668_100049208 3300005347 Bacteria 3243
42 Ga0070669_100013285 3300005353 Bacteria 5852
43 Ga0070675_100000649 3300005354 Bacteria 24051
44 Ga0070675_100007888 3300005354 Bacteria 8252
45 Ga0070675_100044864 3300005354 Bacteria 3616
46 Ga0070675_100060810 3300005354 Bacteria 3118
47 Ga0070671_100015689 3300005355 Bacteria 6123
48 Ga0070671_100038573 3300005355 Bacteria 3965
49 Ga0070674_100025969 3300005356 Bacteria 3820
50 Ga0070673_100005276 3300005364 Bacteria 8257
51 Ga0070667_100009044 3300005367 Bacteria 8245
52 Ga0070667_100028053 3300005367 Bacteria 4685
53 Ga0070667_100041504 3300005367 Bacteria 3860
54 Ga0070667_100077699 3300005367 Bacteria 2835
55 Ga0070700_100006774 3300005441 Bacteria 6141
56 Ga0070678_100061643 3300005456 Bacteria 2765
57 Ga0070662_100015636 3300005457 Bacteria 5087
58 Ga0070662_100022328 3300005457 Bacteria 4331
59 Ga0068867_100000120 3300005459 Bacteria 49908
60 Ga0068867_100002001 3300005459 Bacteria 14223
61 Ga0068867_100013118 3300005459 Bacteria 5867
62 Ga0068867_100018336 3300005459 Bacteria 4975
63 Ga0068867_100030748 3300005459 Bacteria 3873
64 Ga0070706_100015349 3300005467 Bacteria 7073
65 Ga0070679_100024274 3300005530 Bacteria 5941
66 Ga0070672_100000177 3300005543 Bacteria 35110
67 Ga0070672_100016727 3300005543 Bacteria 5258
68 Ga0070672_100054988 3300005543 Bacteria 3117
69 Ga0070672_100066164 3300005543 Bacteria 2861
70 Ga0070693_100009035 3300005547 Bacteria 4946
71 Ga0068855_100060620 3300005563 Bacteria 4424
72 Ga0070664_100032863 3300005564 Bacteria 4341
73 Ga0068856_100010428 3300005614 Bacteria 9019
74 Ga0068856_100038182 3300005614 Bacteria 4714
75 Ga0068852_100007509 3300005616 Bacteria 7959
76 Ga0068852_100012294 3300005616 Bacteria 6492
77 Ga0068859_100019319 3300005617 Bacteria 6846
78 Ga0068859_100112993 3300005617 Bacteria 2780
79 Ga0068864_100000826 3300005618 Bacteria 26103
80 Ga0068864_100043531 3300005618 Bacteria 3844
81 Ga0068866_10003793 3300005718 Bacteria 6196
82 Ga0068866_10027062 3300005718 Bacteria 2715
83 Ga0068861_100002005 3300005719 Bacteria 13174
84 Ga0068861_100015344 3300005719 Bacteria 5396
85 Ga0068861_100024005 3300005719 Bacteria 4404
86 Ga0068863_100010025 3300005841 Bacteria 9220
87 Ga0068863_100019027 3300005841 Bacteria 6572
88 Ga0068858_100005438 3300005842 Bacteria 12477
89 Ga0068858_100013940 3300005842 Bacteria 7582
90 Ga0068858_100054032 3300005842 Bacteria 3715
91 Ga0068860_100005287 3300005843 Bacteria 13101
92 Ga0068860_100033305 3300005843 Bacteria 4945
93 Ga0068860_100046327 3300005843 Bacteria 4146
94 Ga0068862_100017745 3300005844 Bacteria 5923
95 Ga0068862_100043230 3300005844 Bacteria 3841
96 Ga0075366_10000550 3300006195 Bacteria 17475
97 Ga0075366_10001062 3300006195 Bacteria 13471
98 Ga0075366_10015552 3300006195 Bacteria 4364
99 Ga0097621_100009425 3300006237 Bacteria 7083
100 Ga0097621_100077024 3300006237 Bacteria 2767
101 Ga0075370_10000148 3300006353 Bacteria 23924
102 Ga0075370_10003393 3300006353 Bacteria 7571
103 Ga0075370_10017090 3300006353 Bacteria 3915
104 Ga0075430_100053518 3300006846 Bacteria 3398
105 Ga0075431_100009272 3300006847 Bacteria 9877
106 Ga0068865_100020074 3300006881 Bacteria 4332
107 Ga0097620_100019319 3300006931 Bacteria 6846
108 Ga0097620_100112992 3300006931 Bacteria 2780
109 Ga0099823_1000139 3300006944 Bacteria 37935
110 Ga0105240_10005093 3300009093 Bacteria 19689
111 Ga0105243_10001635 3300009148 Bacteria 19469
112 Ga0105243_10010904 3300009148 Bacteria 6875
113 Ga0105243_10078331 3300009148 Bacteria 2690
114 Ga0105237_10000646 3300009545 Bacteria 48623
115 Ga0105238_10034206 3300009551 Bacteria 5172
116 Ga0105249_10011823 3300009553 Bacteria 7672
117 Ga0105249_10038368 3300009553 Bacteria 4347
118 Ga0157319_1000008 3300012497 Bacteria 315600
119 Ga0157374_10011812 3300013296 Bacteria 7574
120 Ga0163162_10002024 3300013306 Bacteria 19068
121 Ga0163162_10004836 3300013306 Bacteria 12999
122 Ga0157375_10007001 3300013308 Bacteria 9846
123 Ga0163163_10011263 3300014325 Bacteria 8105
124 Ga0157380_10052497 3300014326 Bacteria 3229
125 Ga0157377_10000044 3300014745 Bacteria 100420
126 Ga0157379_10026458 3300014968 Bacteria 5165
127 Ga0157379_10061988 3300014968 Bacteria 3345
128 Ga0157376_10039510 3300014969 Bacteria 3849
129 Ga0213872_10010926 3300021361 Bacteria 4308
130 Ga0209435_100003 3300025206 Bacteria 669534
131 Ga0207425_1000426 3300025245 Bacteria 28024
132 Ga0207425_1002116 3300025245 Bacteria 7308
133 Ga0209646_1000008 3300025246 Bacteria 669534
134 Ga0209026_1000007 3300025250 Bacteria 669534
135 Ga0209759_1000026 3300025256 Bacteria 311743
136 Ga0209129_1000269 3300025258 Bacteria 51170
137 Ga0209565_1000026 3300025263 Bacteria 365910
138 Ga0209673_1000009 3300025273 Bacteria 620735
139 Ga0209673_1002449 3300025273 Bacteria 12865
140 Ga0209130_1000109 3300025284 Bacteria 133520
141 Ga0209130_1000307 3300025284 Bacteria 58849
142 Ga0209675_1000545 3300025291 Bacteria 27501
143 Ga0209676_1000013 3300025292 Bacteria 816080
144 Ga0209025_1003154 3300025294 Bacteria 16080
145 Ga0209025_1006232 3300025294 Bacteria 9349
146 Ga0209025_1028382 3300025294 Bacteria 2744
147 Ga0209564_1000008 3300025295 Bacteria 953227
148 Ga0209564_1000243 3300025295 Bacteria 118066
149 Ga0209564_1000300 3300025295 Bacteria 98386
150 Ga0209758_1000453 3300025297 Bacteria 68482
151 Ga0209758_1000605 3300025297 Bacteria 55552
152 Ga0209050_1000008 3300025298 Bacteria 1144179
153 Ga0209050_1000770 3300025298 Bacteria 46024
154 Ga0209050_1003585 3300025298 Bacteria 11290
155 Ga0209050_1004843 3300025298 Bacteria 8836
156 Ga0209256_1000003 3300025299 Bacteria 1661127
157 Ga0209256_1000413 3300025299 Bacteria 67123
158 Ga0207426_1000062 3300025302 Bacteria 362040
159 Ga0207426_1004055 3300025302 Bacteria 7404
160 Ga0209051_1000005 3300025303 Bacteria 1142353
161 Ga0209051_1000172 3300025303 Bacteria 117180
162 Ga0209051_1000886 3300025303 Bacteria 30081
163 Ga0209051_1002126 3300025303 Bacteria 14767
164 Ga0209051_1005444 3300025303 Bacteria 7440
165 Ga0209257_1000015 3300025304 Bacteria 908141
166 Ga0209257_1000047 3300025304 Bacteria 460507
167 Ga0209257_1000048 3300025304 Bacteria 455536
168 Ga0209257_1000108 3300025304 Bacteria 240229
169 Ga0209257_1008757 3300025304 Bacteria 5630
170 Ga0209257_1009164 3300025304 Bacteria 5385
171 Ga0207682_10004449 3300025893 Bacteria 5860
172 Ga0207682_10005562 3300025893 Bacteria 5127
173 Ga0207688_10054114 3300025901 Bacteria 2251
174 Ga0207645_10019688 3300025907 Bacteria 4423
175 Ga0207684_10000714 3300025910 Bacteria 39062
176 Ga0207695_10053553 3300025913 Bacteria 4220
177 Ga0207671_10004759 3300025914 Bacteria 12812
178 Ga0207657_10035786 3300025919 Bacteria 4448
179 Ga0207652_10031247 3300025921 Bacteria 4471
180 Ga0207681_10000880 3300025923 Bacteria 19761
181 Ga0207681_10006701 3300025923 Bacteria 7067
182 Ga0207681_10008608 3300025923 Bacteria 6229
183 Ga0207681_10009640 3300025923 Bacteria 5906
184 Ga0207694_10068255 3300025924 Bacteria 2776
185 Ga0207694_10070827 3300025924 Bacteria 2724
186 Ga0207650_10001020 3300025925 Bacteria 21020
187 Ga0207650_10062358 3300025925 Bacteria 2785
188 Ga0207659_10000614 3300025926 Bacteria 21272
189 Ga0207659_10044116 3300025926 Bacteria 3136
190 Ga0207644_10008782 3300025931 Bacteria 6616
191 Ga0207706_10017792 3300025933 Bacteria 6402
192 Ga0207706_10053348 3300025933 Bacteria 3569
193 Ga0207709_10001132 3300025935 Bacteria 19467
194 Ga0207709_10012117 3300025935 Bacteria 4753
195 Ga0207709_10016227 3300025935 Bacteria 4139
196 Ga0207669_10003724 3300025937 Bacteria 6633
197 Ga0207669_10007853 3300025937 Bacteria 4968
198 Ga0207704_10023492 3300025938 Bacteria 3324
199 Ga0207691_10014392 3300025940 Bacteria 7543
200 Ga0207691_10033759 3300025940 Bacteria 4763
201 Ga0207691_10084722 3300025940 Bacteria 2845
202 Ga0207689_10032343 3300025942 Bacteria 4353
203 Ga0207679_10019045 3300025945 Bacteria 4607
204 Ga0207667_10023656 3300025949 Bacteria 6762
205 Ga0207651_10000476 3300025960 Bacteria 16840
206 Ga0207712_10006165 3300025961 Bacteria 7558
207 Ga0207712_10022538 3300025961 Bacteria 4148
208 Ga0207668_10007781 3300025972 Bacteria 6374
209 Ga0207668_10017753 3300025972 Bacteria 4464
210 Ga0207658_10003937 3300025986 Bacteria 10438
211 Ga0207658_10011293 3300025986 Bacteria 6082
212 Ga0207677_10040753 3300026023 Bacteria 3065
213 Ga0207703_10002711 3300026035 Bacteria 15166
214 Ga0207703_10027100 3300026035 Bacteria 4513
215 Ga0207703_10029516 3300026035 Bacteria 4328
216 Ga0207703_10039420 3300026035 Bacteria 3776
217 Ga0207678_10072134 3300026067 Bacteria 2959
218 Ga0207641_10018924 3300026088 Bacteria 5649
219 Ga0207648_10001584 3300026089 Bacteria 24952
220 Ga0207648_10006766 3300026089 Bacteria 11366
221 Ga0207648_10008899 3300026089 Bacteria 9664
222 Ga0207648_10012940 3300026089 Bacteria 7792
223 Ga0207648_10018624 3300026089 Bacteria 6281
224 Ga0207648_10020197 3300026089 Bacteria 6003
225 Ga0207648_10032076 3300026089 Bacteria 4642
226 Ga0207676_10000855 3300026095 Bacteria 23661
227 Ga0207676_10072399 3300026095 Bacteria 2770
228 Ga0207676_10073531 3300026095 Bacteria 2751
229 Ga0207675_100014229 3300026118 Bacteria 7417
230 Ga0207675_100059739 3300026118 Bacteria 3558
231 Ga0207683_10022060 3300026121 Bacteria 5464
232 Ga0207683_10027022 3300026121 Bacteria 4959
233 Ga0207683_10046373 3300026121 Bacteria 3803
234 Ga0207683_10134853 3300026121 Bacteria 2222
235 Ga0207698_10005200 3300026142 Bacteria 8002
236 Ga0209973_1000497 3300027252 Bacteria 2996
237 Ga0209389_1002532 3300027296 Bacteria 14118
238 Ga0209968_1000860 3300027526 Bacteria 4709
239 Ga0209999_1004770 3300027543 Bacteria 2437
240 Ga0209971_1004560 3300027682 Bacteria 3288
241 Ga0209966_1000017 3300027695 Bacteria 71183
242 Ga0268265_10034688 3300028380 Bacteria 3680
243 Ga0268265_10035205 3300028380 Bacteria 3656
244 Ga0268264_10016600 3300028381 Bacteria 6029
245 Ga0268264_10016771 3300028381 Bacteria 5994
246 Ga0307515_10000048 3300028794 Bacteria 288111
247 Ga0307515_10000281 3300028794 Bacteria 125306
248 Ga0307515_10000553 3300028794 Bacteria 88277
249 Ga0307515_10003339 3300028794 Bacteria 33908
250 Ga0307515_10028096 3300028794 Bacteria 9575
251 Ga0307515_10029571 3300028794 Bacteria 9251
252 Ga0307515_10054215 3300028794 Bacteria 5892
253 Ga0268256_1007512 3300030500 Bacteria 3869
254 Ga0265330_10000043 3300031235 Bacteria 116829
255 Ga0265332_10000018 3300031238 Bacteria 224913
256 Ga0265332_10000022 3300031238 Bacteria 213072
257 Ga0265325_10008692 3300031241 Bacteria 5975
258 Ga0265340_10021575 3300031247 Bacteria 3303
259 Ga0265340_10028838 3300031247 Bacteria 2789
260 Ga0265340_10041795 3300031247 Bacteria 2253
261 Ga0307513_10000034 3300031456 Bacteria 185012
262 Ga0307513_10000057 3300031456 Bacteria 146564
263 Ga0307509_10000249 3300031507 Bacteria 87094
264 Ga0307509_10004869 3300031507 Bacteria 19042
265 Ga0307509_10112969 3300031507 Bacteria 2715
266 Ga0307408_100000029 3300031548 Bacteria 227806
267 Ga0307408_100000107 3300031548 Bacteria 91378
268 Ga0307408_100010302 3300031548 Bacteria 6165
269 Ga0307408_100018676 3300031548 Bacteria 4659
270 Ga0307408_100043821 3300031548 Bacteria 3185
271 Ga0307508_10000143 3300031616 Bacteria 85046
272 Ga0307508_10001407 3300031616 Bacteria 27099
273 Ga0307514_10001712 3300031649 Bacteria 25190
274 Ga0307514_10002586 3300031649 Bacteria 18542
275 Ga0307514_10038392 3300031649 Bacteria 3787
276 Ga0265314_10000126 3300031711 Bacteria 116852
277 Ga0307516_10000236 3300031730 Bacteria 71013
278 Ga0307516_10005342 3300031730 Bacteria 15442
279 Ga0307516_10056503 3300031730 Bacteria 3827
280 Ga0307516_10092301 3300031730 Bacteria 2855
281 Ga0307410_10001858 3300031852 Bacteria 9850
282 Ga0307406_10000702 3300031901 Bacteria 18902
283 Ga0307407_10003615 3300031903 Bacteria 6394
284 Ga0307409_100010064 3300031995 Bacteria 5851
285 Ga0307416_100000552 3300032002 Bacteria 19089
286 Ga0307414_10017518 3300032004 Bacteria 4386
287 Ga0307411_10000631 3300032005 Bacteria 12755
288 Ga0307411_10002483 3300032005 Bacteria 8182
289 Ga0307415_100009374 3300032126 Bacteria 5482
290 Ga0307510_10116566 3300033180 Bacteria 2391
291 Ga0373940_0001422 3300035088 Bacteria 4322
292 Ga0373939_0000114 3300035114 Bacteria 24291
293 Ga0373960_0000259 3300035121 Bacteria 10016
294 Ga0373943_0013213 3300035170 Bacteria 3726
295 Ga0373931_0006842 3300035691 Bacteria 5362
296 Ga0373925_0003753 3300037068 Bacteria 11671
297 Ga0395899_0001161 3300037312 Bacteria 23282
298 Ga0395899_0059429 3300037312 Bacteria 2818
299 Ga0395900_0001471 3300037418 Bacteria 28105
300 Ga0395900_0008457 3300037418 Bacteria 10582
301 Ga0395900_0009117 3300037418 Bacteria 10161
302 Ga0395898_0007931 3300037466 Bacteria 11263
303 Ga0395898_0009390 3300037466 Bacteria 10273
304 Ga0395898_0022283 3300037466 Bacteria 6416
305 Ga0395905_0000090 3300037471 Bacteria 152117
306 Ga0395905_0000609 3300037471 Bacteria 47951
307 Ga0395905_0003315 3300037471 Bacteria 17279
308 Ga0395905_0006895 3300037471 Bacteria 11356
309 Ga0395905_0015893 3300037471 Bacteria 7150
310 Ga0395905_0049559 3300037471 Bacteria 3936
311 Ga0395901_0003849 3300038443 Bacteria 15110
312 Ga0395901_0064483 3300038443 Bacteria 3813
313 Ga0395901_0113811 3300038443 Bacteria 2841
314 Ga0436361_0367431 3300039447 Bacteria 49926
315 Ga0439450_003517 3300042008 Bacteria 2595
316 Ga0450891_000105 3300042129 Bacteria 7309
317 Ga0450892_000161 3300042130 Bacteria 7743
318 Ga0450918_000542 3300042531 Bacteria 8099
319 Ga0451577_0001888 3300042876 Bacteria 26618
320 Ga0451577_0010658 3300042876 Bacteria 8755
321 Ga0466969_0000046 3300044656 Bacteria 63999
322 Ga0466972_0024239 3300044658 Bacteria 3011
323 Ga0466972_0028576 3300044658 Bacteria 2750
324 Ga0453683_0000780 3300044673 Bacteria 31494
325 Ga0466965_0018832 3300044683 Bacteria 3312
326 Ga0453684_0000868 3300044712 Bacteria 101512
327 Ga0453684_0011876 3300044712 Bacteria 14501
328 Ga0453684_0020608 3300044712 Bacteria 9928
329 Ga0453684_0031663 3300044712 Bacteria 7425
330 Ga0466970_0063204 3300044765 Bacteria 1985
331 Ga0466957_0032677 3300044842 Bacteria 3117
332 Ga0451576_0003368 3300045051 Bacteria 22124
333 Ga0451576_0010795 3300045051 Bacteria 10454
334 Ga0451576_0029695 3300045051 Bacteria 5849
335 Ga0495592_0000266 3300046454 Bacteria 44803
336 Ga0495590_0018722 3300046457 Bacteria 2478
337 Ga0495632_0002610 3300046519 Bacteria 13576
338 Ga0495632_0020412 3300046519 Bacteria 3587
339 Ga0495597_0013961 3300046542 Bacteria 3837
340 Ga0495649_0000401 3300046694 Bacteria 37516
341 Ga0495687_000174 3300047443 Bacteria 95031
342 Ga0495687_017403 3300047443 Bacteria 3588
343 Ga0495686_0005097 3300047472 Bacteria 10506
344 Ga0496104_0055414 3300048907 Bacteria 3749
345 Ga0496110_0062629 3300048913 Bacteria 3286
346 Ga0496114_0113378 3300048917 Bacteria 2324
347 Ga0496124_0023272 3300048927 Bacteria 5659
348 Ga0501043_0000002 3300049579 Bacteria 351081
349 Ga0501046_0000008 3300049580 Bacteria 351167
350 Ga0501047_0000003 3300049581 Bacteria 508375
351 Ga0501047_0029371 3300049581 Bacteria 5302
352 Ga0501048_0001290 3300049582 Bacteria 19011
353 Ga0501211_000243 3300049658 Bacteria 4807
354 Ga0501221_000125 3300049704 Bacteria 9718
355 Ga0501229_000045 3300049706 Bacteria 12123
356 Ga0501044_0062626 3300049823 Bacteria 3802
357 nmdc:mga0k408_1384_c1 3300050493 Bacteria 13090
358 nmdc:mga07m45_2245_c1 3300050496 Bacteria 9018
359 nmdc:mga07m45_27312_c1 3300050496 Bacteria 3143
360 nmdc:mga0qj67_35197_c1 3300050509 Bacteria 3914
361 nmdc:mga06r32_23797_c1 3300050510 Bacteria 5674
362 Ga0500578_0000025 3300053086 Bacteria 151485
363 Ga0500641_0008913 3300053096 Bacteria 3595
364 Ga0500593_000858 3300053117 Bacteria 11326
365 Ga0500642_0006143 3300053130 Bacteria 3933
366 Ga0500652_000177 3300053131 Bacteria 24784
367 Ga0500622_0000890 3300053156 Bacteria 25460
368 Ga0500622_0007713 3300053156 Bacteria 6078
369 Ga0500645_001045 3300053730 Bacteria 15414
370 2511247311 2511231002 Bacteria 5042903
371 2548499489 2547132374 Bacteria 5530232
372 2587725519 2585428057 Bacteria 6737412
373 2587734989 2585428058 Bacteria 6853932
374 2588290521 2588253510 Bacteria 6901809
375 2643743717 2643221544 Bacteria 5886209
376 2643936532 2643221585 Bacteria 5812563
377 2643970035 2643221592 Bacteria 6608788
378 2644057432 2643221609 Bacteria 6756331
379 2644072479 2643221611 Bacteria 6820941
380 2644142991 2643221625 Bacteria 6512927
381 2644222372 2643221639 Bacteria 6649903
382 2644243901 2643221644 Bacteria 6865017
383 2644256386 2643221646 Bacteria 6433402
384 2644271949 2643221648 Bacteria 6521465
385 2644301187 2643221654 Bacteria 5273570
386 2644317888 2643221656 Bacteria 5809961
387 2644648152 2643221717 Bacteria 5676132
388 2739058367 2738541337 Bacteria 6183410
389 2739241703 2738543012 Bacteria 7115078
390 2816470992 2816332133 Bacteria 7249298
391 2831869090 2831864461 Bacteria 6502356
392 2842722209 2842718218 Bacteria 4560148
393 2881102886 2881101125 Bacteria 4590519
394 2919705667 2919704043 Bacteria 5560311
395 2974320872 2974320154 Bacteria 4571377
396 Ga0207689_10045275
397 JGI25155J39150_1000067
398 JGI25156J39149_1000013
399 JGI25154J39366_1000032
400 JGI25157J39369_1000017
401 JGI25150J39212_1004205
402 JGI25159J45721_1001195
403 JGI25159J45721_1001596
404 JGI25153J46596_10000543
405 JGI25160J50197_1000204
406 JGI25160J50197_1005548
407 JGI25161J50226_1000036
408 Ga0055526_1000414
409 Ga0055526_1001819
410 Ga0055526_1017354
411 Ga0055537_1000596
412 Ga0055524_1000145
413 Ga0055528_1000524
414 Ga0055540_1000237
415 Ga0055531_10000179
416 Ga0055531_10001626
417 Ga0055543_1001540
418 Ga0055543_1003568
419 Ga0065165_1000177
420 Ga0065165_1002331
421 Ga0065707_10084610
422 Ga0070676_10021699
423 Ga0070676_10025551
424 Ga0070690_100002408
425 Ga0070690_100009776
426 Ga0070670_100003550
427 Ga0070670_100098658
428 Ga0070677_10002402
429 Ga0068869_100009917
430 Ga0068869_100024281
431 Ga0068869_100038923
432 Ga0070680_100016779
433 Ga0068868_100003620
434 Ga0070660_100028021
435 Ga0070668_100019956
436 Ga0070668_100049208
437 Ga0070669_100013285
438 Ga0070675_100000649
439 Ga0070675_100007888
440 Ga0070675_100044864
441 Ga0070675_100060810
442 Ga0070671_100015689
443 Ga0070671_100038573
444 Ga0070674_100025969
445 Ga0070673_100005276
446 Ga0070667_100009044
447 Ga0070667_100028053
448 Ga0070667_100041504
449 Ga0070667_100077699
450 Ga0070700_100006774
451 Ga0070678_100061643
452 Ga0070662_100015636
453 Ga0070662_100022328
454 Ga0068867_100000120
455 Ga0068867_100002001
456 Ga0068867_100013118
457 Ga0068867_100018336
458 Ga0068867_100030748
459 Ga0070706_100015349
460 Ga0070679_100024274
461 Ga0070672_100000177
462 Ga0070672_100016727
463 Ga0070672_100054988
464 Ga0070672_100066164
465 Ga0070693_100009035
466 Ga0068855_100060620
467 Ga0070664_100032863
468 Ga0068856_100010428
469 Ga0068856_100038182
470 Ga0068852_100007509
471 Ga0068852_100012294
472 Ga0068859_100019319
473 Ga0068859_100112993
474 Ga0068864_100000826
475 Ga0068864_100043531
476 Ga0068866_10003793
477 Ga0068866_10027062
478 Ga0068861_100002005
479 Ga0068861_100015344
480 Ga0068861_100024005
481 Ga0068863_100010025
482 Ga0068863_100019027
483 Ga0068858_100005438
484 Ga0068858_100013940
485 Ga0068858_100054032
486 Ga0068860_100005287
487 Ga0068860_100033305
488 Ga0068860_100046327
489 Ga0068862_100017745
490 Ga0068862_100043230
491 Ga0075366_10000550
492 Ga0075366_10001062
493 Ga0075366_10015552
494 Ga0097621_100009425
495 Ga0097621_100077024
496 Ga0075370_10000148
497 Ga0075370_10003393
498 Ga0075370_10017090
499 Ga0075430_100053518
500 Ga0075431_100009272
501 Ga0068865_100020074
502 Ga0097620_100019319
503 Ga0097620_100112992
504 Ga0099823_1000139
505 Ga0105240_10005093
506 Ga0105243_10001635
507 Ga0105243_10010904
508 Ga0105243_10078331
509 Ga0105237_10000646
510 Ga0105238_10034206
511 Ga0105249_10011823
512 Ga0105249_10038368
513 Ga0157319_1000008
514 Ga0157374_10011812
515 Ga0163162_10002024
516 Ga0163162_10004836
517 Ga0157375_10007001
518 Ga0163163_10011263
519 Ga0157380_10052497
520 Ga0157377_10000044
521 Ga0157379_10026458
522 Ga0157379_10061988
523 Ga0157376_10039510
524 Ga0213872_10010926
525 Ga0209435_100003
526 Ga0207425_1000426
527 Ga0207425_1002116
528 Ga0209646_1000008
529 Ga0209026_1000007
530 Ga0209759_1000026
531 Ga0209129_1000269
532 Ga0209565_1000026
533 Ga0209673_1000009
534 Ga0209673_1002449
535 Ga0209130_1000109
536 Ga0209130_1000307
537 Ga0209675_1000545
538 Ga0209676_1000013
539 Ga0209025_1003154
540 Ga0209025_1006232
541 Ga0209025_1028382
542 Ga0209564_1000008
543 Ga0209564_1000243
544 Ga0209564_1000300
545 Ga0209758_1000453
546 Ga0209758_1000605
547 Ga0209050_1000008
548 Ga0209050_1000770
549 Ga0209050_1003585
550 Ga0209050_1004843
551 Ga0209256_1000003
552 Ga0209256_1000413
553 Ga0207426_1000062
554 Ga0207426_1004055
555 Ga0209051_1000005
556 Ga0209051_1000172
557 Ga0209051_1000886
558 Ga0209051_1002126
559 Ga0209051_1005444
560 Ga0209257_1000015
561 Ga0209257_1000047
562 Ga0209257_1000048
563 Ga0209257_1000108
564 Ga0209257_1008757
565 Ga0209257_1009164
566 Ga0207682_10004449
567 Ga0207682_10005562
568 Ga0207688_10054114
569 Ga0207645_10019688
570 Ga0207684_10000714
571 Ga0207695_10053553
572 Ga0207671_10004759
573 Ga0207657_10035786
574 Ga0207652_10031247
575 Ga0207681_10000880
576 Ga0207681_10006701
577 Ga0207681_10008608
578 Ga0207681_10009640
579 Ga0207694_10068255
580 Ga0207694_10070827
581 Ga0207650_10001020
582 Ga0207650_10062358
583 Ga0207659_10000614
584 Ga0207659_10044116
585 Ga0207644_10008782
586 Ga0207706_10017792
587 Ga0207706_10053348
588 Ga0207709_10001132
589 Ga0207709_10012117
590 Ga0207709_10016227
591 Ga0207669_10003724
592 Ga0207669_10007853
593 Ga0207704_10023492
594 Ga0207691_10014392
595 Ga0207691_10033759
596 Ga0207691_10084722
597 Ga0207689_10032343
598 Ga0207679_10019045
599 Ga0207667_10023656
600 Ga0207651_10000476
601 Ga0207712_10006165
602 Ga0207712_10022538
603 Ga0207668_10007781
604 Ga0207668_10017753
605 Ga0207658_10003937
606 Ga0207658_10011293
607 Ga0207677_10040753
608 Ga0207703_10002711
609 Ga0207703_10027100
610 Ga0207703_10029516
611 Ga0207703_10039420
612 Ga0207678_10072134
613 Ga0207641_10018924
614 Ga0207648_10001584
615 Ga0207648_10006766
616 Ga0207648_10008899
617 Ga0207648_10012940
618 Ga0207648_10018624
619 Ga0207648_10020197
620 Ga0207648_10032076
621 Ga0207676_10000855
622 Ga0207676_10072399
623 Ga0207676_10073531
624 Ga0207675_100014229
625 Ga0207675_100059739
626 Ga0207683_10022060
627 Ga0207683_10027022
628 Ga0207683_10046373
629 Ga0207683_10134853
630 Ga0207698_10005200
631 Ga0209973_1000497
632 Ga0209389_1002532
633 Ga0209968_1000860
634 Ga0209999_1004770
635 Ga0209971_1004560
636 Ga0209966_1000017
637 Ga0268265_10034688
638 Ga0268265_10035205
639 Ga0268264_10016600
640 Ga0268264_10016771
641 Ga0307515_10000048
642 Ga0307515_10000281
643 Ga0307515_10000553
644 Ga0307515_10003339
645 Ga0307515_10028096
646 Ga0307515_10029571
647 Ga0307515_10054215
648 Ga0268256_1007512
649 Ga0265330_10000043
650 Ga0265332_10000018
651 Ga0265332_10000022
652 Ga0265325_10008692
653 Ga0265340_10021575
654 Ga0265340_10028838
655 Ga0265340_10041795
656 Ga0307513_10000034
657 Ga0307513_10000057
658 Ga0307509_10000249
659 Ga0307509_10004869
660 Ga0307509_10112969
661 Ga0307408_100000029
662 Ga0307408_100000107
663 Ga0307408_100010302
664 Ga0307408_100018676
665 Ga0307408_100043821
666 Ga0307508_10000143
667 Ga0307508_10001407
668 Ga0307514_10001712
669 Ga0307514_10002586
670 Ga0307514_10038392
671 Ga0265314_10000126
672 Ga0307516_10000236
673 Ga0307516_10005342
674 Ga0307516_10056503
675 Ga0307516_10092301
676 Ga0307410_10001858
677 Ga0307406_10000702
678 Ga0307407_10003615
679 Ga0307409_100010064
680 Ga0307416_100000552
681 Ga0307414_10017518
682 Ga0307411_10000631
683 Ga0307411_10002483
684 Ga0307415_100009374
685 Ga0307510_10116566
686 Ga0373940_0001422
687 Ga0373939_0000114
688 Ga0373960_0000259
689 Ga0373943_0013213
690 Ga0373931_0006842
691 Ga0373925_0003753
692 Ga0395899_0001161
693 Ga0395899_0059429
694 Ga0395900_0001471
695 Ga0395900_0008457
696 Ga0395900_0009117
697 Ga0395898_0007931
698 Ga0395898_0009390
699 Ga0395898_0022283
700 Ga0395905_0000090
701 Ga0395905_0000609
702 Ga0395905_0003315
703 Ga0395905_0006895
704 Ga0395905_0015893
705 Ga0395905_0049559
706 Ga0395901_0003849
707 Ga0395901_0064483
708 Ga0395901_0113811
709 Ga0436361_0367431
710 Ga0439450_003517
711 Ga0450891_000105
712 Ga0450892_000161
713 Ga0450918_000542
714 Ga0451577_0001888
715 Ga0451577_0010658
716 Ga0466969_0000046
717 Ga0466972_0024239
718 Ga0466972_0028576
719 Ga0453683_0000780
720 Ga0466965_0018832
721 Ga0453684_0000868
722 Ga0453684_0011876
723 Ga0453684_0020608
724 Ga0453684_0031663
725 Ga0466970_0063204
726 Ga0466957_0032677
727 Ga0451576_0003368
728 Ga0451576_0010795
729 Ga0451576_0029695
730 Ga0495592_0000266
731 Ga0495590_0018722
732 Ga0495632_0002610
733 Ga0495632_0020412
734 Ga0495597_0013961
735 Ga0495649_0000401
736 Ga0495687_000174
737 Ga0495687_017403
738 Ga0495686_0005097
739 Ga0496104_0055414
740 Ga0496110_0062629
741 Ga0496114_0113378
742 Ga0496124_0023272
743 Ga0501043_0000002
744 Ga0501046_0000008
745 Ga0501047_0000003
746 Ga0501047_0029371
747 Ga0501048_0001290
748 Ga0501211_000243
749 Ga0501221_000125
750 Ga0501229_000045
751 Ga0501044_0062626
752 nmdc:mga0k408_1384_c1
753 nmdc:mga07m45_2245_c1
754 nmdc:mga07m45_27312_c1
755 nmdc:mga0qj67_35197_c1
756 nmdc:mga06r32_23797_c1
757 Ga0500578_0000025
758 Ga0500641_0008913
759 Ga0500593_000858
760 Ga0500642_0006143
761 Ga0500652_000177
762 Ga0500622_0000890
763 Ga0500622_0007713
764 Ga0500645_001045
765 2511247311
766 2548499489
767 2587725519
768 2587734989
769 2588290521
770 2643743717
771 2643936532
772 2643970035
773 2644057432
774 2644072479
775 2644142991
776 2644222372
777 2644243901
778 2644256386
779 2644271949
780 2644301187
781 2644317888
782 2644648152
783 2739058367
784 2739241703
785 2816470992
786 2831869090
787 2842722209
788 2881102886
789 2919705667
790 2974320872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00501

AMP-binding

AMP-binding enzyme

124

541

0.85

PF23562

578

721

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wv5-assembly2.cif.gz_B complex structure of vinn with 3-methylaspartate 0.8903 2 458
3wvn-assembly2.cif.gz_B complex structure of vinn with l-aspartate 0.8889 2 452
3wv5-assembly2.cif.gz_B complex structure of vinn with 3-methylaspartate 0.8761 2 458
3wvn-assembly2.cif.gz_B complex structure of vinn with l-aspartate 0.8674 2 452
3wv4-assembly2.cif.gz_B crystal structure of vinn 0.859 2 458
ID Description Score Start End Superfamily
2d1qA01 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9771 396 462 2.30.38.10
5u95D03 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9723 399 462 2.30.38.10
af_P9WQ53_285_415_2.30.38.10 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9651 333 462 2.30.38.10
af_Q4CT79_2_96_2.30.38.10 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9646 394 464 2.30.38.10
af_P9WQ53_285_415_2.30.38.10 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9509 333 462 2.30.38.10
ID Description Score Start End GO Terms
AF-A0A3D0EWR9-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9919 222 401 GO:0004467
GO:0005811
GO:0005886
GO:0035336
AF-A0A4Q3LL77-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9858 1 99 GO:0016874
AF-A0A800IIC7-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9819 4 320 GO:0004467
GO:0016020
AF-A0A4Q3LL77-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9761 1 99 GO:0016874
AF-A0A3D0EWR9-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9704 222 401 GO:0004467
GO:0005811
GO:0005886
GO:0035336

Map