F433250
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 395 | 254 | 392 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300031711|Ga0265314_10009167|Ga0265314_100091676 |
| Length | 173 |
| Sequence | MSFSLKVNGKAVTVDVPPDMPLLWVLRDVLELKGTKFGCGIAQCGACTVHLKGAPVRSCSMPISALQGMEITTIEGLSADGTHPVQKAWQEIDVPQCGYCQAGQIMSAAALLANKKNPSDADIDAAMNGNICRCATYNRIRKAIHRAAAIGGASAXXGAGHAPADDAALEATR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 3 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 172 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 173 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 177 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 178 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 179 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 180 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 181 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 182 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 183 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 184 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 185 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 186 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 187 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 202 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 203 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 204 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 205 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 206 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 207 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 208 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 212 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 213 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 231 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 232 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 237 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 238 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 239 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 240 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 241 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 242 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 243 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 251 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 252 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 254 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.72 |
| Metatranscriptomes | 1.52 |
| Isolates | 0.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.3 |
| Nodule | 0 |
| Rhizoplane | 1.01 |
| Rhizosphere | 89.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2381925 | 2162886007 | Bacteria | 45817 |
| 2 | JGI24752J21851_1027691 | 3300001976 | Bacteria | 745 |
| 3 | Ga0058861_11352708 | 3300004800 | Bacteria | 683 |
| 4 | Ga0065704_10070189 | 3300005289 | Bacteria | 114786 |
| 5 | Ga0070676_10057815 | 3300005328 | Bacteria | 2296 |
| 6 | Ga0070683_100022225 | 3300005329 | Bacteria | 5667 |
| 7 | Ga0070690_100108782 | 3300005330 | Bacteria | 1847 |
| 8 | Ga0070670_100721521 | 3300005331 | Bacteria | 897 |
| 9 | Ga0070670_100721995 | 3300005331 | Bacteria | 897 |
| 10 | Ga0068869_100091046 | 3300005334 | Bacteria | 2294 |
| 11 | Ga0068869_100203392 | 3300005334 | Bacteria | 1562 |
| 12 | Ga0070666_10664087 | 3300005335 | Bacteria | 763 |
| 13 | Ga0070680_100046659 | 3300005336 | Bacteria | 3525 |
| 14 | Ga0070682_100002639 | 3300005337 | Bacteria | 9906 |
| 15 | Ga0068868_100199805 | 3300005338 | Bacteria | 1666 |
| 16 | Ga0070660_100127690 | 3300005339 | Bacteria | 2033 |
| 17 | Ga0070689_100047996 | 3300005340 | Bacteria | 3292 |
| 18 | Ga0070687_100010172 | 3300005343 | Bacteria | 4056 |
| 19 | Ga0070687_100207577 | 3300005343 | Bacteria | 1191 |
| 20 | Ga0070661_100001798 | 3300005344 | Bacteria | 14878 |
| 21 | Ga0070668_100527597 | 3300005347 | Bacteria | 1025 |
| 22 | Ga0070668_100710342 | 3300005347 | Bacteria | 887 |
| 23 | Ga0070669_100000983 | 3300005353 | Bacteria | 20780 |
| 24 | Ga0070669_100048493 | 3300005353 | Bacteria | 3100 |
| 25 | Ga0070669_100117367 | 3300005353 | Bacteria | 2026 |
| 26 | Ga0070669_100569591 | 3300005353 | Bacteria | 946 |
| 27 | Ga0070675_100034436 | 3300005354 | Bacteria | 4110 |
| 28 | Ga0070675_100195546 | 3300005354 | Bacteria | 1754 |
| 29 | Ga0070675_100206902 | 3300005354 | Bacteria | 1705 |
| 30 | Ga0070675_100299033 | 3300005354 | Bacteria | 1418 |
| 31 | Ga0070671_100105340 | 3300005355 | Bacteria | 2367 |
| 32 | Ga0070671_100529025 | 3300005355 | Bacteria | 1016 |
| 33 | Ga0070674_100012520 | 3300005356 | Bacteria | 5211 |
| 34 | Ga0070674_100145745 | 3300005356 | Bacteria | 1782 |
| 35 | Ga0070673_100085334 | 3300005364 | Bacteria | 2570 |
| 36 | Ga0070673_100158387 | 3300005364 | Bacteria | 1923 |
| 37 | Ga0070673_100724652 | 3300005364 | Bacteria | 914 |
| 38 | Ga0070688_100029704 | 3300005365 | Bacteria | 3275 |
| 39 | Ga0070688_100254015 | 3300005365 | Bacteria | 1253 |
| 40 | Ga0070688_100806021 | 3300005365 | Bacteria | 735 |
| 41 | Ga0070688_100958526 | 3300005365 | Bacteria | 677 |
| 42 | Ga0070659_100009305 | 3300005366 | Bacteria | 7214 |
| 43 | Ga0070667_100000737 | 3300005367 | Bacteria | 31316 |
| 44 | Ga0070667_100071439 | 3300005367 | Bacteria | 2956 |
| 45 | Ga0070667_100140222 | 3300005367 | Bacteria | 2117 |
| 46 | Ga0070667_100463380 | 3300005367 | Bacteria | 1159 |
| 47 | Ga0070713_100254426 | 3300005436 | Bacteria | 1603 |
| 48 | Ga0070663_100111448 | 3300005455 | Bacteria | 2056 |
| 49 | Ga0070678_100627902 | 3300005456 | Bacteria | 962 |
| 50 | Ga0070662_100085244 | 3300005457 | Bacteria | 2361 |
| 51 | Ga0070662_100620609 | 3300005457 | Bacteria | 910 |
| 52 | Ga0070681_10026117 | 3300005458 | Bacteria | 5872 |
| 53 | Ga0068867_100019425 | 3300005459 | Bacteria | 4842 |
| 54 | Ga0068867_100149793 | 3300005459 | Bacteria | 1831 |
| 55 | Ga0070699_100759455 | 3300005518 | Bacteria | 887 |
| 56 | Ga0070679_100011050 | 3300005530 | Bacteria | 8588 |
| 57 | Ga0070684_100078596 | 3300005535 | Bacteria | 2915 |
| 58 | Ga0068853_100819612 | 3300005539 | Bacteria | 892 |
| 59 | Ga0070672_101580423 | 3300005543 | Bacteria | 588 |
| 60 | Ga0070686_100017715 | 3300005544 | Bacteria | 4168 |
| 61 | Ga0070686_100387129 | 3300005544 | Bacteria | 1060 |
| 62 | Ga0070695_100028656 | 3300005545 | Bacteria | 3456 |
| 63 | Ga0070696_100059243 | 3300005546 | Bacteria | 2676 |
| 64 | Ga0070693_100019656 | 3300005547 | Bacteria | 3546 |
| 65 | Ga0070665_100000686 | 3300005548 | Bacteria | 45211 |
| 66 | Ga0070665_100204310 | 3300005548 | Bacteria | 1976 |
| 67 | Ga0070665_100661097 | 3300005548 | Bacteria | 1058 |
| 68 | Ga0070704_100016649 | 3300005549 | Bacteria | 4651 |
| 69 | Ga0068855_100060851 | 3300005563 | Bacteria | 4414 |
| 70 | Ga0070664_100348584 | 3300005564 | Bacteria | 1346 |
| 71 | Ga0068857_100622225 | 3300005577 | Bacteria | 1022 |
| 72 | Ga0068856_100099661 | 3300005614 | Bacteria | 2896 |
| 73 | Ga0068856_100412192 | 3300005614 | Bacteria | 1371 |
| 74 | Ga0070702_100006190 | 3300005615 | Bacteria | 5643 |
| 75 | Ga0070702_100013511 | 3300005615 | Bacteria | 4122 |
| 76 | Ga0070702_100418995 | 3300005615 | Bacteria | 963 |
| 77 | Ga0068852_101301766 | 3300005616 | Bacteria | 748 |
| 78 | Ga0068859_100034630 | 3300005617 | Bacteria | 5068 |
| 79 | Ga0068859_100044693 | 3300005617 | Bacteria | 4450 |
| 80 | Ga0068859_100136426 | 3300005617 | Bacteria | 2526 |
| 81 | Ga0068864_100005687 | 3300005618 | Bacteria | 10219 |
| 82 | Ga0068864_100210367 | 3300005618 | Bacteria | 1791 |
| 83 | Ga0068864_100608809 | 3300005618 | Bacteria | 1061 |
| 84 | Ga0068866_10035923 | 3300005718 | Bacteria | 2424 |
| 85 | Ga0068861_100019484 | 3300005719 | Bacteria | 4846 |
| 86 | Ga0068870_10103533 | 3300005840 | Bacteria | 1613 |
| 87 | Ga0068863_100000980 | 3300005841 | Bacteria | 28685 |
| 88 | Ga0068863_100033428 | 3300005841 | Bacteria | 4899 |
| 89 | Ga0068858_100208791 | 3300005842 | Bacteria | 1848 |
| 90 | Ga0068860_100001156 | 3300005843 | Bacteria | 28867 |
| 91 | Ga0068860_100006722 | 3300005843 | Bacteria | 11537 |
| 92 | Ga0068860_100031597 | 3300005843 | Bacteria | 5089 |
| 93 | Ga0068860_100364309 | 3300005843 | Bacteria | 1425 |
| 94 | Ga0068862_100042073 | 3300005844 | Bacteria | 3890 |
| 95 | Ga0081539_10259687 | 3300005985 | Bacteria | 767 |
| 96 | Ga0075365_10025964 | 3300006038 | Bacteria | 3713 |
| 97 | Ga0075368_10009188 | 3300006042 | Bacteria | 3552 |
| 98 | Ga0075364_10013045 | 3300006051 | Bacteria | 5099 |
| 99 | Ga0075362_10020129 | 3300006177 | Bacteria | 2785 |
| 100 | Ga0075367_10000316 | 3300006178 | Bacteria | 17081 |
| 101 | Ga0075366_10133140 | 3300006195 | Bacteria | 1501 |
| 102 | Ga0097621_100018759 | 3300006237 | Bacteria | 5293 |
| 103 | Ga0097621_100123385 | 3300006237 | Bacteria | 2199 |
| 104 | Ga0068871_100505572 | 3300006358 | Bacteria | 1090 |
| 105 | Ga0075428_100002558 | 3300006844 | Bacteria | 19750 |
| 106 | Ga0075428_100025730 | 3300006844 | Bacteria | 6517 |
| 107 | Ga0075428_100116776 | 3300006844 | Bacteria | 2906 |
| 108 | Ga0075430_100003971 | 3300006846 | Bacteria | 12470 |
| 109 | Ga0075430_100387901 | 3300006846 | Bacteria | 1153 |
| 110 | Ga0075431_100002364 | 3300006847 | Bacteria | 18119 |
| 111 | Ga0075431_100010176 | 3300006847 | Bacteria | 9456 |
| 112 | Ga0075431_100211432 | 3300006847 | Bacteria | 1981 |
| 113 | Ga0075434_100156481 | 3300006871 | Bacteria | 2298 |
| 114 | Ga0075434_100195676 | 3300006871 | Bacteria | 2041 |
| 115 | Ga0075429_100003953 | 3300006880 | Bacteria | 12672 |
| 116 | Ga0075429_100036097 | 3300006880 | Bacteria | 4299 |
| 117 | Ga0068865_100018079 | 3300006881 | Bacteria | 4543 |
| 118 | Ga0097620_100034624 | 3300006931 | Bacteria | 5068 |
| 119 | Ga0097620_100044696 | 3300006931 | Bacteria | 4450 |
| 120 | Ga0097620_100136423 | 3300006931 | Bacteria | 2526 |
| 121 | Ga0105251_10003303 | 3300009011 | Bacteria | 11797 |
| 122 | Ga0105240_11860834 | 3300009093 | Bacteria | 627 |
| 123 | Ga0111539_10001215 | 3300009094 | Bacteria | 34303 |
| 124 | Ga0111539_10002323 | 3300009094 | Bacteria | 25318 |
| 125 | Ga0111539_10112008 | 3300009094 | Bacteria | 3201 |
| 126 | Ga0111539_10438664 | 3300009094 | Bacteria | 1521 |
| 127 | Ga0111539_11167396 | 3300009094 | Bacteria | 895 |
| 128 | Ga0105245_10029246 | 3300009098 | Bacteria | 4867 |
| 129 | Ga0105245_10152799 | 3300009098 | Bacteria | 2184 |
| 130 | Ga0105245_10187564 | 3300009098 | Bacteria | 1979 |
| 131 | Ga0105245_11987140 | 3300009098 | Bacteria | 635 |
| 132 | Ga0105247_10362171 | 3300009101 | Bacteria | 1023 |
| 133 | Ga0114129_10000532 | 3300009147 | Bacteria | 46632 |
| 134 | Ga0114129_10663863 | 3300009147 | Bacteria | 1344 |
| 135 | Ga0114129_11388387 | 3300009147 | Bacteria | 867 |
| 136 | Ga0105243_10049128 | 3300009148 | Bacteria | 3327 |
| 137 | Ga0105243_10183265 | 3300009148 | Bacteria | 1823 |
| 138 | Ga0105241_10039541 | 3300009174 | Bacteria | 3558 |
| 139 | Ga0105248_10002933 | 3300009177 | Bacteria | 18934 |
| 140 | Ga0105248_10027954 | 3300009177 | Bacteria | 6280 |
| 141 | Ga0105248_10147069 | 3300009177 | Bacteria | 2659 |
| 142 | Ga0105248_10857717 | 3300009177 | Bacteria | 1025 |
| 143 | Ga0105248_11024758 | 3300009177 | Bacteria | 932 |
| 144 | Ga0105237_11264339 | 3300009545 | Bacteria | 744 |
| 145 | Ga0105249_10212945 | 3300009553 | Bacteria | 1897 |
| 146 | Ga0105239_10020606 | 3300010375 | Bacteria | 7275 |
| 147 | Ga0105246_10001421 | 3300011119 | Bacteria | 14186 |
| 148 | Ga0157373_10036655 | 3300013100 | Bacteria | 3519 |
| 149 | Ga0157373_10681800 | 3300013100 | Bacteria | 752 |
| 150 | Ga0157371_10020880 | 3300013102 | Bacteria | 4816 |
| 151 | Ga0157369_10420113 | 3300013105 | Bacteria | 1386 |
| 152 | Ga0157374_10026371 | 3300013296 | Bacteria | 5228 |
| 153 | Ga0157378_10212606 | 3300013297 | Bacteria | 1834 |
| 154 | Ga0157378_10486654 | 3300013297 | Bacteria | 1230 |
| 155 | Ga0157372_10051408 | 3300013307 | Bacteria | 4586 |
| 156 | Ga0157372_10086047 | 3300013307 | Bacteria | 3566 |
| 157 | Ga0157372_10102708 | 3300013307 | Bacteria | 3266 |
| 158 | Ga0157372_10488694 | 3300013307 | Bacteria | 1435 |
| 159 | Ga0157375_10086368 | 3300013308 | Bacteria | 3188 |
| 160 | Ga0157375_10618757 | 3300013308 | Bacteria | 1241 |
| 161 | Ga0157375_10872684 | 3300013308 | Bacteria | 1045 |
| 162 | Ga0163163_10049280 | 3300014325 | Bacteria | 4144 |
| 163 | Ga0163163_10081362 | 3300014325 | Bacteria | 3241 |
| 164 | Ga0163163_10263969 | 3300014325 | Bacteria | 1773 |
| 165 | Ga0163163_10669816 | 3300014325 | Bacteria | 1101 |
| 166 | Ga0163163_11348686 | 3300014325 | Bacteria | 775 |
| 167 | Ga0157380_10060778 | 3300014326 | Bacteria | 3021 |
| 168 | Ga0157377_10042330 | 3300014745 | Bacteria | 2529 |
| 169 | Ga0157377_10052702 | 3300014745 | Bacteria | 2298 |
| 170 | Ga0157379_10166604 | 3300014968 | Bacteria | 1989 |
| 171 | Ga0157379_10200692 | 3300014968 | Bacteria | 1804 |
| 172 | Ga0157376_10009155 | 3300014969 | Bacteria | 7181 |
| 173 | Ga0157376_10494365 | 3300014969 | Bacteria | 1201 |
| 174 | Ga0163161_10652406 | 3300017792 | Bacteria | 872 |
| 175 | Ga0207697_10142666 | 3300025315 | Bacteria | 1039 |
| 176 | Ga0207713_1006239 | 3300025735 | Bacteria | 7296 |
| 177 | Ga0207710_10217277 | 3300025900 | Bacteria | 948 |
| 178 | Ga0207688_10365402 | 3300025901 | Bacteria | 891 |
| 179 | Ga0207680_10124310 | 3300025903 | Bacteria | 1691 |
| 180 | Ga0207647_10097998 | 3300025904 | Bacteria | 1743 |
| 181 | Ga0207647_10219301 | 3300025904 | Bacteria | 1097 |
| 182 | Ga0207647_10518884 | 3300025904 | Bacteria | 663 |
| 183 | Ga0207645_10079181 | 3300025907 | Bacteria | 2106 |
| 184 | Ga0207643_10067887 | 3300025908 | Bacteria | 2047 |
| 185 | Ga0207654_10031002 | 3300025911 | Bacteria | 2941 |
| 186 | Ga0207707_10045838 | 3300025912 | Bacteria | 3808 |
| 187 | Ga0207671_10736711 | 3300025914 | Bacteria | 783 |
| 188 | Ga0207660_10163501 | 3300025917 | Bacteria | 1719 |
| 189 | Ga0207662_10000938 | 3300025918 | Bacteria | 13533 |
| 190 | Ga0207657_10120293 | 3300025919 | Bacteria | 2161 |
| 191 | Ga0207652_10073182 | 3300025921 | Bacteria | 2981 |
| 192 | Ga0207681_10000635 | 3300025923 | Bacteria | 23457 |
| 193 | Ga0207681_10077209 | 3300025923 | Bacteria | 2341 |
| 194 | Ga0207681_10132021 | 3300025923 | Bacteria | 1848 |
| 195 | Ga0207681_10664324 | 3300025923 | Bacteria | 865 |
| 196 | Ga0207694_10401866 | 3300025924 | Bacteria | 1139 |
| 197 | Ga0207650_10002341 | 3300025925 | Bacteria | 13193 |
| 198 | Ga0207650_10007538 | 3300025925 | Bacteria | 7419 |
| 199 | Ga0207659_10068121 | 3300025926 | Bacteria | 2588 |
| 200 | Ga0207659_10121626 | 3300025926 | Bacteria | 2001 |
| 201 | Ga0207687_10140168 | 3300025927 | Bacteria | 1834 |
| 202 | Ga0207700_10688489 | 3300025928 | Bacteria | 912 |
| 203 | Ga0207644_10090235 | 3300025931 | Bacteria | 2283 |
| 204 | Ga0207706_10170683 | 3300025933 | Bacteria | 1911 |
| 205 | Ga0207706_10244970 | 3300025933 | Bacteria | 1566 |
| 206 | Ga0207686_10091394 | 3300025934 | Bacteria | 2010 |
| 207 | Ga0207709_10120234 | 3300025935 | Bacteria | 1772 |
| 208 | Ga0207670_10069819 | 3300025936 | Bacteria | 2424 |
| 209 | Ga0207670_10772493 | 3300025936 | Bacteria | 799 |
| 210 | Ga0207669_11028640 | 3300025937 | Bacteria | 693 |
| 211 | Ga0207704_10020859 | 3300025938 | Bacteria | 3476 |
| 212 | Ga0207691_10005948 | 3300025940 | Bacteria | 11784 |
| 213 | Ga0207691_10130637 | 3300025940 | Bacteria | 2219 |
| 214 | Ga0207711_10069093 | 3300025941 | Bacteria | 3061 |
| 215 | Ga0207711_10473199 | 3300025941 | Bacteria | 1167 |
| 216 | Ga0207689_10032495 | 3300025942 | Bacteria | 4341 |
| 217 | Ga0207689_10055223 | 3300025942 | Bacteria | 3269 |
| 218 | Ga0207689_10313357 | 3300025942 | Bacteria | 1301 |
| 219 | Ga0207661_10003817 | 3300025944 | Bacteria | 10503 |
| 220 | Ga0207679_10001825 | 3300025945 | Bacteria | 13268 |
| 221 | Ga0207679_10617339 | 3300025945 | Bacteria | 978 |
| 222 | Ga0207667_10292393 | 3300025949 | Bacteria | 1664 |
| 223 | Ga0207651_10262895 | 3300025960 | Bacteria | 1418 |
| 224 | Ga0207651_10293455 | 3300025960 | Bacteria | 1349 |
| 225 | Ga0207651_10312503 | 3300025960 | Bacteria | 1311 |
| 226 | Ga0207712_10466001 | 3300025961 | Bacteria | 1074 |
| 227 | Ga0207668_10001649 | 3300025972 | Bacteria | 13042 |
| 228 | Ga0207668_10019983 | 3300025972 | Bacteria | 4247 |
| 229 | Ga0207668_10146253 | 3300025972 | Bacteria | 1824 |
| 230 | Ga0207658_10000358 | 3300025986 | Bacteria | 45036 |
| 231 | Ga0207658_10068047 | 3300025986 | Bacteria | 2685 |
| 232 | Ga0207658_10151828 | 3300025986 | Bacteria | 1888 |
| 233 | Ga0207658_10753449 | 3300025986 | Bacteria | 882 |
| 234 | Ga0207677_10154643 | 3300026023 | Bacteria | 1774 |
| 235 | Ga0207677_10685018 | 3300026023 | Bacteria | 908 |
| 236 | Ga0207703_10119217 | 3300026035 | Bacteria | 2263 |
| 237 | Ga0207703_10275345 | 3300026035 | Bacteria | 1526 |
| 238 | Ga0207639_10448406 | 3300026041 | Bacteria | 1171 |
| 239 | Ga0207639_10740780 | 3300026041 | Bacteria | 913 |
| 240 | Ga0207678_10305641 | 3300026067 | Bacteria | 1367 |
| 241 | Ga0207678_11368890 | 3300026067 | Bacteria | 626 |
| 242 | Ga0207708_10432453 | 3300026075 | Bacteria | 1093 |
| 243 | Ga0207702_10036046 | 3300026078 | Bacteria | 4136 |
| 244 | Ga0207702_10175848 | 3300026078 | Bacteria | 1967 |
| 245 | Ga0207702_10396399 | 3300026078 | Bacteria | 1330 |
| 246 | Ga0207641_10000469 | 3300026088 | Bacteria | 45572 |
| 247 | Ga0207641_10254142 | 3300026088 | Bacteria | 1642 |
| 248 | Ga0207648_10010659 | 3300026089 | Bacteria | 8689 |
| 249 | Ga0207648_10080124 | 3300026089 | Bacteria | 2849 |
| 250 | Ga0207648_12081794 | 3300026089 | Bacteria | 528 |
| 251 | Ga0207676_10252519 | 3300026095 | Bacteria | 1588 |
| 252 | Ga0207676_10305170 | 3300026095 | Bacteria | 1455 |
| 253 | Ga0207676_10832277 | 3300026095 | Bacteria | 902 |
| 254 | Ga0207674_10002535 | 3300026116 | Bacteria | 23011 |
| 255 | Ga0207675_100984616 | 3300026118 | Bacteria | 861 |
| 256 | Ga0207683_10129680 | 3300026121 | Bacteria | 2267 |
| 257 | Ga0207698_10848424 | 3300026142 | Bacteria | 918 |
| 258 | Ga0209813_10008609 | 3300027866 | Bacteria | 2584 |
| 259 | Ga0207428_10000079 | 3300027907 | Bacteria | 136472 |
| 260 | Ga0207428_10004712 | 3300027907 | Bacteria | 12899 |
| 261 | Ga0207428_10076629 | 3300027907 | Bacteria | 2618 |
| 262 | Ga0268266_10000804 | 3300028379 | Bacteria | 41628 |
| 263 | Ga0268266_10191118 | 3300028379 | Bacteria | 1869 |
| 264 | Ga0268265_10054476 | 3300028380 | Bacteria | 3035 |
| 265 | Ga0268265_10075503 | 3300028380 | Bacteria | 2640 |
| 266 | Ga0268265_10914858 | 3300028380 | Bacteria | 862 |
| 267 | Ga0268264_10001282 | 3300028381 | Bacteria | 23789 |
| 268 | Ga0268264_10562219 | 3300028381 | Bacteria | 1120 |
| 269 | Ga0307515_10000716 | 3300028794 | Bacteria | 76332 |
| 270 | Ga0307513_10116315 | 3300031456 | Bacteria | 2654 |
| 271 | Ga0307408_100010475 | 3300031548 | Bacteria | 6113 |
| 272 | Ga0307408_100088160 | 3300031548 | Bacteria | 2336 |
| 273 | Ga0307408_100250752 | 3300031548 | Bacteria | 1460 |
| 274 | Ga0265314_10009167 | 3300031711 | Bacteria | 8395 |
| 275 | Ga0307405_10054432 | 3300031731 | Bacteria | 2498 |
| 276 | Ga0307405_10776881 | 3300031731 | Bacteria | 800 |
| 277 | Ga0307405_11500949 | 3300031731 | Bacteria | 592 |
| 278 | Ga0307410_10260168 | 3300031852 | Bacteria | 1353 |
| 279 | Ga0307407_10940815 | 3300031903 | Bacteria | 665 |
| 280 | Ga0307407_11133839 | 3300031903 | Bacteria | 609 |
| 281 | Ga0307412_10773885 | 3300031911 | Bacteria | 831 |
| 282 | Ga0307412_10869713 | 3300031911 | Bacteria | 788 |
| 283 | Ga0307409_100146969 | 3300031995 | Bacteria | 2040 |
| 284 | Ga0307416_100011084 | 3300032002 | Bacteria | 5992 |
| 285 | Ga0307411_10740184 | 3300032005 | Bacteria | 860 |
| 286 | Ga0307415_100776202 | 3300032126 | Bacteria | 872 |
| 287 | Ga0307415_101220337 | 3300032126 | Bacteria | 709 |
| 288 | Ga0307510_10084182 | 3300033180 | Bacteria | 3065 |
| 289 | Ga0307510_10089539 | 3300033180 | Bacteria | 2929 |
| 290 | Ga0316574_0428105 | 3300035398 | Bacteria | 831 |
| 291 | Ga0316574_0448216 | 3300035398 | Bacteria | 809 |
| 292 | Ga0373931_0008396 | 3300035691 | Bacteria | 4897 |
| 293 | Ga0373937_0822976 | 3300036401 | Bacteria | 877 |
| 294 | Ga0436365_1562404 | 3300039437 | Bacteria | 1126 |
| 295 | Ga0436360_0801113 | 3300039438 | Bacteria | 575 |
| 296 | Ga0451847_0688388 | 3300041503 | Bacteria | 1174 |
| 297 | Ga0451853_0838294 | 3300041512 | Bacteria | 1216 |
| 298 | Ga0439450_030805 | 3300042008 | Bacteria | 1205 |
| 299 | Ga0450889_050766 | 3300042144 | Bacteria | 510 |
| 300 | Ga0439444_0104750 | 3300042437 | Bacteria | 645 |
| 301 | Ga0439464_0000836 | 3300042439 | Bacteria | 6807 |
| 302 | Ga0439460_0043377 | 3300042461 | Bacteria | 1329 |
| 303 | Ga0451577_1558060 | 3300042876 | Bacteria | 583 |
| 304 | Ga0439440_0120221 | 3300042993 | Bacteria | 731 |
| 305 | Ga0466965_0377282 | 3300044683 | Bacteria | 780 |
| 306 | Ga0466970_0001100 | 3300044765 | Bacteria | 13106 |
| 307 | Ga0451576_0147476 | 3300045051 | Bacteria | 2453 |
| 308 | Ga0451576_1858484 | 3300045051 | Bacteria | 622 |
| 309 | Ga0495650_0008000 | 3300046471 | Bacteria | 6254 |
| 310 | Ga0495594_0466845 | 3300046499 | Bacteria | 717 |
| 311 | Ga0495606_0320534 | 3300046507 | Bacteria | 833 |
| 312 | Ga0495643_0067092 | 3300046522 | Bacteria | 1891 |
| 313 | Ga0495588_0152814 | 3300046674 | Bacteria | 1220 |
| 314 | Ga0495670_0235761 | 3300046691 | Bacteria | 974 |
| 315 | Ga0495649_0094605 | 3300046694 | Bacteria | 1590 |
| 316 | Ga0495672_0009508 | 3300047320 | Bacteria | 7038 |
| 317 | Ga0496102_1449267 | 3300048905 | Bacteria | 605 |
| 318 | Ga0496103_0024970 | 3300048906 | Bacteria | 3608 |
| 319 | Ga0496110_0439905 | 3300048913 | Bacteria | 1188 |
| 320 | Ga0496112_0004649 | 3300048915 | Bacteria | 11669 |
| 321 | Ga0496116_0091452 | 3300048919 | Bacteria | 1849 |
| 322 | Ga0496117_0036479 | 3300048920 | Bacteria | 3678 |
| 323 | Ga0496120_0138237 | 3300048923 | Bacteria | 1239 |
| 324 | Ga0496123_0147498 | 3300048926 | Bacteria | 1275 |
| 325 | Ga0496124_0001047 | 3300048927 | Bacteria | 43685 |
| 326 | Ga0496124_0008258 | 3300048927 | Bacteria | 10917 |
| 327 | Ga0496124_0204768 | 3300048927 | Bacteria | 1497 |
| 328 | Ga0496125_0006637 | 3300048928 | Bacteria | 12452 |
| 329 | Ga0496125_0076568 | 3300048928 | Bacteria | 2582 |
| 330 | Ga0496125_0128552 | 3300048928 | Bacteria | 1789 |
| 331 | Ga0496126_0009686 | 3300048929 | Bacteria | 10206 |
| 332 | Ga0496126_0137397 | 3300048929 | Bacteria | 2107 |
| 333 | Ga0501306_078259 | 3300049127 | Bacteria | 567 |
| 334 | Ga0501308_046825 | 3300049128 | Bacteria | 624 |
| 335 | Ga0501308_059219 | 3300049128 | Bacteria | 575 |
| 336 | Ga0495678_142838 | 3300049459 | Bacteria | 781 |
| 337 | Ga0501290_012701 | 3300049513 | Bacteria | 1094 |
| 338 | Ga0501291_001760 | 3300049514 | Bacteria | 2535 |
| 339 | Ga0501312_041022 | 3300049528 | Bacteria | 757 |
| 340 | Ga0501031_0001198 | 3300049568 | Bacteria | 15821 |
| 341 | Ga0501032_0673536 | 3300049569 | Bacteria | 656 |
| 342 | Ga0501033_0770246 | 3300049570 | Bacteria | 652 |
| 343 | Ga0501034_0001099 | 3300049571 | Bacteria | 38041 |
| 344 | Ga0501034_0131869 | 3300049571 | Bacteria | 2482 |
| 345 | Ga0501036_0000924 | 3300049572 | Bacteria | 22042 |
| 346 | Ga0501037_0004936 | 3300049573 | Bacteria | 9703 |
| 347 | Ga0501038_0001262 | 3300049574 | Bacteria | 22998 |
| 348 | Ga0501039_0955438 | 3300049575 | Bacteria | 666 |
| 349 | Ga0501040_0453049 | 3300049576 | Bacteria | 924 |
| 350 | Ga0501043_0002612 | 3300049579 | Bacteria | 15193 |
| 351 | Ga0501046_0000741 | 3300049580 | Bacteria | 31610 |
| 352 | Ga0501047_0004374 | 3300049581 | Bacteria | 13295 |
| 353 | Ga0501047_0176175 | 3300049581 | Bacteria | 2006 |
| 354 | Ga0501048_0040717 | 3300049582 | Bacteria | 3328 |
| 355 | Ga0501070_0105907 | 3300049586 | Bacteria | 2325 |
| 356 | Ga0501073_0000176 | 3300049589 | Bacteria | 41996 |
| 357 | Ga0501074_0128824 | 3300049590 | Bacteria | 1811 |
| 358 | Ga0501207_038160 | 3300049654 | Bacteria | 828 |
| 359 | Ga0501228_001155 | 3300049666 | Bacteria | 1866 |
| 360 | Ga0501080_0006938 | 3300049742 | Bacteria | 10219 |
| 361 | Ga0501035_0002773 | 3300049822 | Bacteria | 16962 |
| 362 | Ga0501044_0007761 | 3300049823 | Bacteria | 11796 |
| 363 | Ga0501045_0343086 | 3300049824 | Bacteria | 1112 |
| 364 | nmdc:mga03683_22538_c1 | 3300050489 | Bacteria | 2443 |
| 365 | nmdc:mga03n38_110865_c1 | 3300050490 | Bacteria | 1336 |
| 366 | nmdc:mga00v17_316749_c1 | 3300050491 | Bacteria | 1014 |
| 367 | nmdc:mga0yw44_25341_c1 | 3300050492 | Bacteria | 3371 |
| 368 | nmdc:mga0k408_117513_c1 | 3300050493 | Bacteria | 1574 |
| 369 | nmdc:mga0k408_1223_c1 | 3300050493 | Bacteria | 14078 |
| 370 | nmdc:mga06z11_1087_c1 | 3300050494 | Bacteria | 9902 |
| 371 | nmdc:mga04h51_25667_c1 | 3300050495 | Bacteria | 1816 |
| 372 | nmdc:mga05p37_1165_c1 | 3300050507 | Bacteria | 30287 |
| 373 | nmdc:mga05p37_203550_c1 | 3300050507 | Bacteria | 2396 |
| 374 | nmdc:mga09592_144122_c1 | 3300050508 | Bacteria | 2054 |
| 375 | nmdc:mga09592_294238_c1 | 3300050508 | Bacteria | 1408 |
| 376 | nmdc:mga0qj67_267289_c1 | 3300050509 | Bacteria | 1387 |
| 377 | nmdc:mga0qj67_558163_c1 | 3300050509 | Bacteria | 918 |
| 378 | nmdc:mga0qj67_6253_c1 | 3300050509 | Bacteria | 8738 |
| 379 | nmdc:mga06r32_511788_c1 | 3300050510 | Bacteria | 1177 |
| 380 | nmdc:mga08y16_2617_c1 | 3300050511 | Bacteria | 18486 |
| 381 | nmdc:mga08y16_327880_c1 | 3300050511 | Bacteria | 1575 |
| 382 | nmdc:mga08y16_346244_c1 | 3300050511 | Bacteria | 1527 |
| 383 | nmdc:mga08y16_488511_c1 | 3300050511 | Bacteria | 1252 |
| 384 | nmdc:mga08y16_717_c1 | 3300050511 | Bacteria | 31525 |
| 385 | nmdc:mga0n895_152766_c1 | 3300050512 | Bacteria | 2339 |
| 386 | nmdc:mga0n895_2091816_c1 | 3300050512 | Bacteria | 523 |
| 387 | nmdc:mga0a205_404256_c1 | 3300050515 | Bacteria | 1229 |
| 388 | nmdc:mga0a205_695518_c1 | 3300050515 | Bacteria | 867 |
| 389 | Ga0500643_000757 | 3300053087 | Bacteria | 21048 |
| 390 | Ga0500608_277274 | 3300053122 | Bacteria | 637 |
| 391 | Ga0587111_0168279 | 3300060346 | Bacteria | 601 |
| 392 | Ga0530510_0528750 | 3300061734 | Bacteria | 895 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053122 | Ga0500608_277274 | Ga0500608_277274_17_415 | 123 |
| 2 | 3300049459 | Ga0495678_142838 | Ga0495678_142838_346_762 | 129 |
| 3 | 3300039437 | Ga0436365_1562404 | Ga0436365_1562404_10_429 | 130 |
| 4 | 3300041503 | Ga0451847_0688388 | Ga0451847_0688388_550_972 | 131 |
| 5 | 3300026089 | Ga0207648_12081794 | Ga0207648_120817941 | 139 |
| 6 | 3300035398 | Ga0316574_0448216 | Ga0316574_0448216_12_494 | 139 |
| 7 | iso_pu_bacteria | 2842694124 | 2842694842 | 142 |
| 8 | 3300009094 | Ga0111539_10112008 | Ga0111539_101120081 | 143 |
| 9 | 3300031903 | Ga0307407_10940815 | Ga0307407_109408151 | 143 |
| 10 | 3300032005 | Ga0307411_10740184 | Ga0307411_107401842 | 143 |
| 11 | 3300032126 | Ga0307415_101220337 | Ga0307415_1012203372 | 143 |
| 12 | 3300046471 | Ga0495650_0008000 | Ga0495650_0008000_1551_2009 | 143 |
| 13 | iso_pu_bacteria | 2954011201 | 2954012579 | 143 |
| 14 | 3300006844 | Ga0075428_100002558 | Ga0075428_1000025588 | 144 |
| 15 | 3300006844 | Ga0075428_100025730 | Ga0075428_1000257302 | 144 |
| 16 | 3300006846 | Ga0075430_100003971 | Ga0075430_1000039717 | 144 |
| 17 | 3300006846 | Ga0075430_100387901 | Ga0075430_1003879012 | 144 |
| 18 | 3300006847 | Ga0075431_100002364 | Ga0075431_1000023648 | 144 |
| 19 | 3300006847 | Ga0075431_100010176 | Ga0075431_1000101766 | 144 |
| 20 | 3300006880 | Ga0075429_100003953 | Ga0075429_1000039532 | 144 |
| 21 | 3300009093 | Ga0105240_11860834 | Ga0105240_118608342 | 144 |
| 22 | 3300009094 | Ga0111539_10001215 | Ga0111539_100012159 | 144 |
| 23 | 3300009147 | Ga0114129_10000532 | Ga0114129_1000053219 | 144 |
| 24 | 3300009147 | Ga0114129_10663863 | Ga0114129_106638632 | 144 |
| 25 | 3300025901 | Ga0207688_10365402 | Ga0207688_103654022 | 144 |
| 26 | 3300025904 | Ga0207647_10518884 | Ga0207647_105188841 | 144 |
| 27 | 3300025937 | Ga0207669_11028640 | Ga0207669_110286401 | 144 |
| 28 | 3300026075 | Ga0207708_10432453 | Ga0207708_104324531 | 144 |
| 29 | 3300027907 | Ga0207428_10004712 | Ga0207428_100047125 | 144 |
| 30 | 3300028380 | Ga0268265_10914858 | Ga0268265_109148581 | 144 |
| 31 | 3300031548 | Ga0307408_100010475 | Ga0307408_1000104752 | 144 |
| 32 | 3300031548 | Ga0307408_100088160 | Ga0307408_1000881602 | 144 |
| 33 | 3300031548 | Ga0307408_100250752 | Ga0307408_1002507522 | 144 |
| 34 | 3300031731 | Ga0307405_10054432 | Ga0307405_100544322 | 144 |
| 35 | 3300031852 | Ga0307410_10260168 | Ga0307410_102601682 | 144 |
| 36 | 3300031903 | Ga0307407_11133839 | Ga0307407_111338392 | 144 |
| 37 | 3300031911 | Ga0307412_10773885 | Ga0307412_107738851 | 144 |
| 38 | 3300031911 | Ga0307412_10869713 | Ga0307412_108697131 | 144 |
| 39 | 3300032002 | Ga0307416_100011084 | Ga0307416_1000110842 | 144 |
| 40 | 3300032126 | Ga0307415_100776202 | Ga0307415_1007762022 | 144 |
| 41 | 3300042008 | Ga0439450_030805 | Ga0439450_030805_392_850 | 144 |
| 42 | 3300042144 | Ga0450889_050766 | Ga0450889_050766_20_478 | 144 |
| 43 | 3300042437 | Ga0439444_0104750 | Ga0439444_0104750_64_522 | 144 |
| 44 | 3300042439 | Ga0439464_0000836 | Ga0439464_0000836_1807_2265 | 144 |
| 45 | 3300042461 | Ga0439460_0043377 | Ga0439460_0043377_555_1013 | 144 |
| 46 | 3300048905 | Ga0496102_1449267 | Ga0496102_1449267_81_539 | 144 |
| 47 | 3300049513 | Ga0501290_012701 | Ga0501290_012701_263_721 | 144 |
| 48 | 3300049514 | Ga0501291_001760 | Ga0501291_001760_1490_1948 | 144 |
| 49 | 3300049576 | Ga0501040_0453049 | Ga0501040_0453049_96_554 | 144 |
| 50 | 3300049654 | Ga0501207_038160 | Ga0501207_038160_170_628 | 144 |
| 51 | 3300049666 | Ga0501228_001155 | Ga0501228_001155_1193_1651 | 144 |
| 52 | 3300049824 | Ga0501045_0343086 | Ga0501045_0343086_89_547 | 144 |
| 53 | 3300050507 | nmdc:mga05p37_1165_c1 | nmdc:mga05p37_1165_c1_11021_11479 | 144 |
| 54 | 3300050507 | nmdc:mga05p37_203550_c1 | nmdc:mga05p37_203550_c1_203_661 | 144 |
| 55 | 3300050508 | nmdc:mga09592_144122_c1 | nmdc:mga09592_144122_c1_1564_2022 | 144 |
| 56 | 3300050508 | nmdc:mga09592_294238_c1 | nmdc:mga09592_294238_c1_230_688 | 144 |
| 57 | 3300050509 | nmdc:mga0qj67_267289_c1 | nmdc:mga0qj67_267289_c1_165_623 | 144 |
| 58 | 3300050509 | nmdc:mga0qj67_6253_c1 | nmdc:mga0qj67_6253_c1_7638_8096 | 144 |
| 59 | 3300050510 | nmdc:mga06r32_511788_c1 | nmdc:mga06r32_511788_c1_369_827 | 144 |
| 60 | 3300050511 | nmdc:mga08y16_346244_c1 | nmdc:mga08y16_346244_c1_504_968 | 144 |
| 61 | 3300050511 | nmdc:mga08y16_488511_c1 | nmdc:mga08y16_488511_c1_679_1137 | 144 |
| 62 | 3300050511 | nmdc:mga08y16_717_c1 | nmdc:mga08y16_717_c1_22926_23384 | 144 |
| 63 | 3300050515 | nmdc:mga0a205_695518_c1 | nmdc:mga0a205_695518_c1_108_566 | 144 |
| 64 | 3300061734 | Ga0530510_0528750 | Ga0530510_0528750_372_830 | 144 |
| 65 | iso_pu_bacteria | 8054302542 | 8054303332 | 144 |
| 66 | 3300005354 | Ga0070675_100206902 | Ga0070675_1002069022 | 145 |
| 67 | 3300009177 | Ga0105248_10002933 | Ga0105248_1000293312 | 145 |
| 68 | 3300025926 | Ga0207659_10068121 | Ga0207659_100681212 | 145 |
| 69 | 3300025940 | Ga0207691_10005948 | Ga0207691_1000594813 | 145 |
| 70 | 3300026142 | Ga0207698_10848424 | Ga0207698_108484242 | 145 |
| 71 | 3300028794 | Ga0307515_10000716 | Ga0307515_1000071630 | 145 |
| 72 | 3300031456 | Ga0307513_10116315 | Ga0307513_101163152 | 145 |
| 73 | 3300031731 | Ga0307405_11500949 | Ga0307405_115009492 | 145 |
| 74 | 3300042993 | Ga0439440_0120221 | Ga0439440_0120221_62_541 | 145 |
| 75 | 3300001976 | JGI24752J21851_1027691 | JGI24752J21851_10276911 | 146 |
| 76 | 3300005329 | Ga0070683_100022225 | Ga0070683_1000222252 | 146 |
| 77 | 3300005330 | Ga0070690_100108782 | Ga0070690_1001087822 | 146 |
| 78 | 3300005334 | Ga0068869_100091046 | Ga0068869_1000910462 | 146 |
| 79 | 3300005335 | Ga0070666_10664087 | Ga0070666_106640871 | 146 |
| 80 | 3300005336 | Ga0070680_100046659 | Ga0070680_1000466593 | 146 |
| 81 | 3300005337 | Ga0070682_100002639 | Ga0070682_1000026398 | 146 |
| 82 | 3300005338 | Ga0068868_100199805 | Ga0068868_1001998052 | 146 |
| 83 | 3300005339 | Ga0070660_100127690 | Ga0070660_1001276902 | 146 |
| 84 | 3300005344 | Ga0070661_100001798 | Ga0070661_10000179812 | 146 |
| 85 | 3300005353 | Ga0070669_100117367 | Ga0070669_1001173672 | 146 |
| 86 | 3300005354 | Ga0070675_100034436 | Ga0070675_1000344364 | 146 |
| 87 | 3300005355 | Ga0070671_100529025 | Ga0070671_1005290252 | 146 |
| 88 | 3300005364 | Ga0070673_100158387 | Ga0070673_1001583872 | 146 |
| 89 | 3300005365 | Ga0070688_100254015 | Ga0070688_1002540152 | 146 |
| 90 | 3300005366 | Ga0070659_100009305 | Ga0070659_1000093054 | 146 |
| 91 | 3300005367 | Ga0070667_100463380 | Ga0070667_1004633802 | 146 |
| 92 | 3300005436 | Ga0070713_100254426 | Ga0070713_1002544262 | 146 |
| 93 | 3300005457 | Ga0070662_100085244 | Ga0070662_1000852442 | 146 |
| 94 | 3300005458 | Ga0070681_10026117 | Ga0070681_100261173 | 146 |
| 95 | 3300005530 | Ga0070679_100011050 | Ga0070679_1000110504 | 146 |
| 96 | 3300005535 | Ga0070684_100078596 | Ga0070684_1000785962 | 146 |
| 97 | 3300005539 | Ga0068853_100819612 | Ga0068853_1008196122 | 146 |
| 98 | 3300005544 | Ga0070686_100387129 | Ga0070686_1003871292 | 146 |
| 99 | 3300005545 | Ga0070695_100028656 | Ga0070695_1000286563 | 146 |
| 100 | 3300005547 | Ga0070693_100019656 | Ga0070693_1000196562 | 146 |
| 101 | 3300005563 | Ga0068855_100060851 | Ga0068855_1000608513 | 146 |
| 102 | 3300005564 | Ga0070664_100348584 | Ga0070664_1003485842 | 146 |
| 103 | 3300005614 | Ga0068856_100099661 | Ga0068856_1000996612 | 146 |
| 104 | 3300005615 | Ga0070702_100013511 | Ga0070702_1000135112 | 146 |
| 105 | 3300005616 | Ga0068852_101301766 | Ga0068852_1013017662 | 146 |
| 106 | 3300005617 | Ga0068859_100034630 | Ga0068859_1000346304 | 146 |
| 107 | 3300005618 | Ga0068864_100005687 | Ga0068864_1000056874 | 146 |
| 108 | 3300005618 | Ga0068864_100608809 | Ga0068864_1006088092 | 146 |
| 109 | 3300005840 | Ga0068870_10103533 | Ga0068870_101035332 | 146 |
| 110 | 3300005841 | Ga0068863_100033428 | Ga0068863_1000334283 | 146 |
| 111 | 3300005843 | Ga0068860_100031597 | Ga0068860_1000315974 | 146 |
| 112 | 3300005985 | Ga0081539_10259687 | Ga0081539_102596872 | 146 |
| 113 | 3300006237 | Ga0097621_100018759 | Ga0097621_1000187592 | 146 |
| 114 | 3300006931 | Ga0097620_100034624 | Ga0097620_1000346244 | 146 |
| 115 | 3300009094 | Ga0111539_10438664 | Ga0111539_104386642 | 146 |
| 116 | 3300009098 | Ga0105245_10029246 | Ga0105245_100292464 | 146 |
| 117 | 3300009098 | Ga0105245_11987140 | Ga0105245_119871401 | 146 |
| 118 | 3300009174 | Ga0105241_10039541 | Ga0105241_100395413 | 146 |
| 119 | 3300009177 | Ga0105248_10027954 | Ga0105248_100279544 | 146 |
| 120 | 3300009545 | Ga0105237_11264339 | Ga0105237_112643392 | 146 |
| 121 | 3300010375 | Ga0105239_10020606 | Ga0105239_100206062 | 146 |
| 122 | 3300011119 | Ga0105246_10001421 | Ga0105246_100014212 | 146 |
| 123 | 3300013100 | Ga0157373_10036655 | Ga0157373_100366553 | 146 |
| 124 | 3300013100 | Ga0157373_10681800 | Ga0157373_106818002 | 146 |
| 125 | 3300013102 | Ga0157371_10020880 | Ga0157371_100208804 | 146 |
| 126 | 3300013105 | Ga0157369_10420113 | Ga0157369_104201132 | 146 |
| 127 | 3300013296 | Ga0157374_10026371 | Ga0157374_100263712 | 146 |
| 128 | 3300013307 | Ga0157372_10051408 | Ga0157372_100514084 | 146 |
| 129 | 3300013307 | Ga0157372_10086047 | Ga0157372_100860472 | 146 |
| 130 | 3300013307 | Ga0157372_10102708 | Ga0157372_101027082 | 146 |
| 131 | 3300013307 | Ga0157372_10488694 | Ga0157372_104886942 | 146 |
| 132 | 3300014325 | Ga0163163_10081362 | Ga0163163_100813622 | 146 |
| 133 | 3300014325 | Ga0163163_10263969 | Ga0163163_102639692 | 146 |
| 134 | 3300014745 | Ga0157377_10052702 | Ga0157377_100527022 | 146 |
| 135 | 3300014968 | Ga0157379_10200692 | Ga0157379_102006922 | 146 |
| 136 | 3300014969 | Ga0157376_10009155 | Ga0157376_100091555 | 146 |
| 137 | 3300025315 | Ga0207697_10142666 | Ga0207697_101426662 | 146 |
| 138 | 3300025903 | Ga0207680_10124310 | Ga0207680_101243102 | 146 |
| 139 | 3300025904 | Ga0207647_10219301 | Ga0207647_102193012 | 146 |
| 140 | 3300025908 | Ga0207643_10067887 | Ga0207643_100678872 | 146 |
| 141 | 3300025911 | Ga0207654_10031002 | Ga0207654_100310022 | 146 |
| 142 | 3300025912 | Ga0207707_10045838 | Ga0207707_100458382 | 146 |
| 143 | 3300025914 | Ga0207671_10736711 | Ga0207671_107367111 | 146 |
| 144 | 3300025917 | Ga0207660_10163501 | Ga0207660_101635012 | 146 |
| 145 | 3300025919 | Ga0207657_10120293 | Ga0207657_101202932 | 146 |
| 146 | 3300025921 | Ga0207652_10073182 | Ga0207652_100731822 | 146 |
| 147 | 3300025923 | Ga0207681_10132021 | Ga0207681_101320212 | 146 |
| 148 | 3300025924 | Ga0207694_10401866 | Ga0207694_104018661 | 146 |
| 149 | 3300025925 | Ga0207650_10002341 | Ga0207650_100023412 | 146 |
| 150 | 3300025926 | Ga0207659_10121626 | Ga0207659_101216262 | 146 |
| 151 | 3300025927 | Ga0207687_10140168 | Ga0207687_101401682 | 146 |
| 152 | 3300025928 | Ga0207700_10688489 | Ga0207700_106884892 | 146 |
| 153 | 3300025933 | Ga0207706_10244970 | Ga0207706_102449702 | 146 |
| 154 | 3300025942 | Ga0207689_10032495 | Ga0207689_100324952 | 146 |
| 155 | 3300025944 | Ga0207661_10003817 | Ga0207661_100038178 | 146 |
| 156 | 3300025945 | Ga0207679_10001825 | Ga0207679_100018252 | 146 |
| 157 | 3300025949 | Ga0207667_10292393 | Ga0207667_102923932 | 146 |
| 158 | 3300025960 | Ga0207651_10293455 | Ga0207651_102934552 | 146 |
| 159 | 3300025986 | Ga0207658_10753449 | Ga0207658_107534492 | 146 |
| 160 | 3300026023 | Ga0207677_10154643 | Ga0207677_101546432 | 146 |
| 161 | 3300026041 | Ga0207639_10740780 | Ga0207639_107407802 | 146 |
| 162 | 3300026067 | Ga0207678_10305641 | Ga0207678_103056412 | 146 |
| 163 | 3300026078 | Ga0207702_10036046 | Ga0207702_100360462 | 146 |
| 164 | 3300026078 | Ga0207702_10175848 | Ga0207702_101758482 | 146 |
| 165 | 3300026088 | Ga0207641_10254142 | Ga0207641_102541422 | 146 |
| 166 | 3300026095 | Ga0207676_10832277 | Ga0207676_108322772 | 146 |
| 167 | 3300026116 | Ga0207674_10002535 | Ga0207674_1000253519 | 146 |
| 168 | 3300027907 | Ga0207428_10076629 | Ga0207428_100766292 | 146 |
| 169 | 3300035398 | Ga0316574_0428105 | Ga0316574_0428105_272_739 | 146 |
| 170 | 3300035691 | Ga0373931_0008396 | Ga0373931_0008396_1915_2403 | 146 |
| 171 | 3300039438 | Ga0436360_0801113 | Ga0436360_0801113_89_553 | 146 |
| 172 | 3300045051 | Ga0451576_0147476 | Ga0451576_0147476_1825_2310 | 146 |
| 173 | 3300048915 | Ga0496112_0004649 | Ga0496112_0004649_4498_4983 | 146 |
| 174 | 3300050511 | nmdc:mga08y16_327880_c1 | nmdc:mga08y16_327880_c1_236_721 | 146 |
| 175 | 3300004800 | Ga0058861_11352708 | Ga0058861_113527081 | 147 |
| 176 | 3300005331 | Ga0070670_100721995 | Ga0070670_1007219952 | 147 |
| 177 | 3300005618 | Ga0068864_100210367 | Ga0068864_1002103672 | 147 |
| 178 | 3300009177 | Ga0105248_10857717 | Ga0105248_108577172 | 147 |
| 179 | 3300014325 | Ga0163163_10049280 | Ga0163163_100492803 | 147 |
| 180 | 3300025941 | Ga0207711_10473199 | Ga0207711_104731992 | 147 |
| 181 | 3300026095 | Ga0207676_10252519 | Ga0207676_102525192 | 147 |
| 182 | 3300044683 | Ga0466965_0377282 | Ga0466965_0377282_205_672 | 147 |
| 183 | 3300044765 | Ga0466970_0001100 | Ga0466970_0001100_4599_5066 | 147 |
| 184 | 3300047320 | Ga0495672_0009508 | Ga0495672_0009508_1064_1567 | 147 |
| 185 | 3300048906 | Ga0496103_0024970 | Ga0496103_0024970_259_729 | 147 |
| 186 | 3300005614 | Ga0068856_100412192 | Ga0068856_1004121922 | 148 |
| 187 | 3300013308 | Ga0157375_10618757 | Ga0157375_106187572 | 148 |
| 188 | 3300026078 | Ga0207702_10396399 | Ga0207702_103963992 | 148 |
| 189 | 3300049568 | Ga0501031_0001198 | Ga0501031_0001198_5427_5900 | 148 |
| 190 | 3300049569 | Ga0501032_0673536 | Ga0501032_0673536_149_622 | 148 |
| 191 | 3300049571 | Ga0501034_0001099 | Ga0501034_0001099_1391_1864 | 148 |
| 192 | 3300049571 | Ga0501034_0131869 | Ga0501034_0131869_1863_2336 | 148 |
| 193 | 3300049572 | Ga0501036_0000924 | Ga0501036_0000924_8149_8622 | 148 |
| 194 | 3300049573 | Ga0501037_0004936 | Ga0501037_0004936_1196_1669 | 148 |
| 195 | 3300049574 | Ga0501038_0001262 | Ga0501038_0001262_13203_13676 | 148 |
| 196 | 3300049575 | Ga0501039_0955438 | Ga0501039_0955438_131_604 | 148 |
| 197 | 3300049579 | Ga0501043_0002612 | Ga0501043_0002612_9900_10373 | 148 |
| 198 | 3300049580 | Ga0501046_0000741 | Ga0501046_0000741_18319_18792 | 148 |
| 199 | 3300049581 | Ga0501047_0004374 | Ga0501047_0004374_11077_11550 | 148 |
| 200 | 3300049581 | Ga0501047_0176175 | Ga0501047_0176175_172_645 | 148 |
| 201 | 3300049582 | Ga0501048_0040717 | Ga0501048_0040717_597_1070 | 148 |
| 202 | 3300049586 | Ga0501070_0105907 | Ga0501070_0105907_659_1132 | 148 |
| 203 | 3300049589 | Ga0501073_0000176 | Ga0501073_0000176_12819_13292 | 148 |
| 204 | 3300049590 | Ga0501074_0128824 | Ga0501074_0128824_427_900 | 148 |
| 205 | 3300049742 | Ga0501080_0006938 | Ga0501080_0006938_5978_6451 | 148 |
| 206 | 3300049822 | Ga0501035_0002773 | Ga0501035_0002773_2699_3172 | 148 |
| 207 | 3300049823 | Ga0501044_0007761 | Ga0501044_0007761_1196_1669 | 148 |
| 208 | 3300053087 | Ga0500643_000757 | Ga0500643_000757_11711_12184 | 148 |
| 209 | 3300060346 | Ga0587111_0168279 | Ga0587111_0168279_86_559 | 148 |
| 210 | 3300005347 | Ga0070668_100527597 | Ga0070668_1005275971 | 149 |
| 211 | 3300005365 | Ga0070688_100806021 | Ga0070688_1008060211 | 149 |
| 212 | 3300005543 | Ga0070672_101580423 | Ga0070672_1015804231 | 149 |
| 213 | 3300005548 | Ga0070665_100204310 | Ga0070665_1002043102 | 149 |
| 214 | 3300014325 | Ga0163163_10669816 | Ga0163163_106698162 | 149 |
| 215 | 3300025904 | Ga0207647_10097998 | Ga0207647_100979982 | 149 |
| 216 | 3300028379 | Ga0268266_10191118 | Ga0268266_101911182 | 149 |
| 217 | 3300033180 | Ga0307510_10084182 | Ga0307510_100841821 | 149 |
| 218 | 3300033180 | Ga0307510_10089539 | Ga0307510_100895392 | 149 |
| 219 | 3300041512 | Ga0451853_0838294 | Ga0451853_0838294_270_746 | 149 |
| 220 | 3300042876 | Ga0451577_1558060 | Ga0451577_1558060_43_549 | 149 |
| 221 | 3300046507 | Ga0495606_0320534 | Ga0495606_0320534_217_705 | 149 |
| 222 | 3300046522 | Ga0495643_0067092 | Ga0495643_0067092_407_892 | 149 |
| 223 | 3300046694 | Ga0495649_0094605 | Ga0495649_0094605_1065_1553 | 149 |
| 224 | 3300048929 | Ga0496126_0137397 | Ga0496126_0137397_623_1111 | 149 |
| 225 | 3300049570 | Ga0501033_0770246 | Ga0501033_0770246_38_514 | 149 |
| 226 | 2162886007 | SwRhRL2b_contig_2381925 | SwRhRL2b_0194.00002030 | 150 |
| 227 | 3300005289 | Ga0065704_10070189 | Ga0065704_1007018941 | 150 |
| 228 | 3300005328 | Ga0070676_10057815 | Ga0070676_100578152 | 150 |
| 229 | 3300005331 | Ga0070670_100721521 | Ga0070670_1007215212 | 150 |
| 230 | 3300005334 | Ga0068869_100203392 | Ga0068869_1002033922 | 150 |
| 231 | 3300005340 | Ga0070689_100047996 | Ga0070689_1000479962 | 150 |
| 232 | 3300005343 | Ga0070687_100010172 | Ga0070687_1000101722 | 150 |
| 233 | 3300005343 | Ga0070687_100207577 | Ga0070687_1002075772 | 150 |
| 234 | 3300005347 | Ga0070668_100710342 | Ga0070668_1007103422 | 150 |
| 235 | 3300005353 | Ga0070669_100000983 | Ga0070669_1000009833 | 150 |
| 236 | 3300005353 | Ga0070669_100048493 | Ga0070669_1000484932 | 150 |
| 237 | 3300005353 | Ga0070669_100569591 | Ga0070669_1005695912 | 150 |
| 238 | 3300005354 | Ga0070675_100195546 | Ga0070675_1001955463 | 150 |
| 239 | 3300005354 | Ga0070675_100299033 | Ga0070675_1002990332 | 150 |
| 240 | 3300005355 | Ga0070671_100105340 | Ga0070671_1001053403 | 150 |
| 241 | 3300005356 | Ga0070674_100012520 | Ga0070674_1000125204 | 150 |
| 242 | 3300005356 | Ga0070674_100145745 | Ga0070674_1001457452 | 150 |
| 243 | 3300005364 | Ga0070673_100085334 | Ga0070673_1000853342 | 150 |
| 244 | 3300005364 | Ga0070673_100724652 | Ga0070673_1007246523 | 150 |
| 245 | 3300005365 | Ga0070688_100029704 | Ga0070688_1000297043 | 150 |
| 246 | 3300005365 | Ga0070688_100958526 | Ga0070688_1009585261 | 150 |
| 247 | 3300005367 | Ga0070667_100000737 | Ga0070667_10000073738 | 150 |
| 248 | 3300005367 | Ga0070667_100071439 | Ga0070667_1000714392 | 150 |
| 249 | 3300005367 | Ga0070667_100140222 | Ga0070667_1001402222 | 150 |
| 250 | 3300005455 | Ga0070663_100111448 | Ga0070663_1001114481 | 150 |
| 251 | 3300005456 | Ga0070678_100627902 | Ga0070678_1006279022 | 150 |
| 252 | 3300005457 | Ga0070662_100620609 | Ga0070662_1006206092 | 150 |
| 253 | 3300005459 | Ga0068867_100019425 | Ga0068867_1000194253 | 150 |
| 254 | 3300005459 | Ga0068867_100149793 | Ga0068867_1001497931 | 150 |
| 255 | 3300005518 | Ga0070699_100759455 | Ga0070699_1007594552 | 150 |
| 256 | 3300005544 | Ga0070686_100017715 | Ga0070686_1000177152 | 150 |
| 257 | 3300005546 | Ga0070696_100059243 | Ga0070696_1000592432 | 150 |
| 258 | 3300005548 | Ga0070665_100000686 | Ga0070665_10000068617 | 150 |
| 259 | 3300005548 | Ga0070665_100661097 | Ga0070665_1006610971 | 150 |
| 260 | 3300005549 | Ga0070704_100016649 | Ga0070704_1000166492 | 150 |
| 261 | 3300005577 | Ga0068857_100622225 | Ga0068857_1006222251 | 150 |
| 262 | 3300005615 | Ga0070702_100006190 | Ga0070702_1000061904 | 150 |
| 263 | 3300005615 | Ga0070702_100418995 | Ga0070702_1004189952 | 150 |
| 264 | 3300005617 | Ga0068859_100044693 | Ga0068859_1000446932 | 150 |
| 265 | 3300005617 | Ga0068859_100136426 | Ga0068859_1001364262 | 150 |
| 266 | 3300005718 | Ga0068866_10035923 | Ga0068866_100359231 | 150 |
| 267 | 3300005719 | Ga0068861_100019484 | Ga0068861_1000194842 | 150 |
| 268 | 3300005841 | Ga0068863_100000980 | Ga0068863_10000098025 | 150 |
| 269 | 3300005842 | Ga0068858_100208791 | Ga0068858_1002087912 | 150 |
| 270 | 3300005843 | Ga0068860_100001156 | Ga0068860_1000011568 | 150 |
| 271 | 3300005843 | Ga0068860_100006722 | Ga0068860_1000067223 | 150 |
| 272 | 3300005843 | Ga0068860_100364309 | Ga0068860_1003643092 | 150 |
| 273 | 3300005844 | Ga0068862_100042073 | Ga0068862_1000420732 | 150 |
| 274 | 3300006038 | Ga0075365_10025964 | Ga0075365_100259643 | 150 |
| 275 | 3300006042 | Ga0075368_10009188 | Ga0075368_100091882 | 150 |
| 276 | 3300006051 | Ga0075364_10013045 | Ga0075364_100130452 | 150 |
| 277 | 3300006177 | Ga0075362_10020129 | Ga0075362_100201292 | 150 |
| 278 | 3300006178 | Ga0075367_10000316 | Ga0075367_100003169 | 150 |
| 279 | 3300006195 | Ga0075366_10133140 | Ga0075366_101331402 | 150 |
| 280 | 3300006237 | Ga0097621_100123385 | Ga0097621_1001233852 | 150 |
| 281 | 3300006358 | Ga0068871_100505572 | Ga0068871_1005055722 | 150 |
| 282 | 3300006844 | Ga0075428_100116776 | Ga0075428_1001167762 | 150 |
| 283 | 3300006847 | Ga0075431_100211432 | Ga0075431_1002114322 | 150 |
| 284 | 3300006871 | Ga0075434_100156481 | Ga0075434_1001564812 | 150 |
| 285 | 3300006871 | Ga0075434_100195676 | Ga0075434_1001956762 | 150 |
| 286 | 3300006880 | Ga0075429_100036097 | Ga0075429_1000360973 | 150 |
| 287 | 3300006881 | Ga0068865_100018079 | Ga0068865_1000180792 | 150 |
| 288 | 3300006931 | Ga0097620_100044696 | Ga0097620_1000446962 | 150 |
| 289 | 3300006931 | Ga0097620_100136423 | Ga0097620_1001364232 | 150 |
| 290 | 3300009011 | Ga0105251_10003303 | Ga0105251_100033037 | 150 |
| 291 | 3300009094 | Ga0111539_10002323 | Ga0111539_1000232315 | 150 |
| 292 | 3300009094 | Ga0111539_11167396 | Ga0111539_111673962 | 150 |
| 293 | 3300009098 | Ga0105245_10152799 | Ga0105245_101527992 | 150 |
| 294 | 3300009098 | Ga0105245_10187564 | Ga0105245_101875642 | 150 |
| 295 | 3300009101 | Ga0105247_10362171 | Ga0105247_103621712 | 150 |
| 296 | 3300009147 | Ga0114129_11388387 | Ga0114129_113883871 | 150 |
| 297 | 3300009148 | Ga0105243_10049128 | Ga0105243_100491281 | 150 |
| 298 | 3300009148 | Ga0105243_10183265 | Ga0105243_101832652 | 150 |
| 299 | 3300009177 | Ga0105248_10147069 | Ga0105248_101470692 | 150 |
| 300 | 3300009177 | Ga0105248_11024758 | Ga0105248_110247581 | 150 |
| 301 | 3300009553 | Ga0105249_10212945 | Ga0105249_102129452 | 150 |
| 302 | 3300013297 | Ga0157378_10212606 | Ga0157378_102126061 | 150 |
| 303 | 3300013297 | Ga0157378_10486654 | Ga0157378_104866542 | 150 |
| 304 | 3300013308 | Ga0157375_10086368 | Ga0157375_100863681 | 150 |
| 305 | 3300013308 | Ga0157375_10872684 | Ga0157375_108726842 | 150 |
| 306 | 3300014325 | Ga0163163_11348686 | Ga0163163_113486862 | 150 |
| 307 | 3300014326 | Ga0157380_10060778 | Ga0157380_100607784 | 150 |
| 308 | 3300014745 | Ga0157377_10042330 | Ga0157377_100423302 | 150 |
| 309 | 3300014968 | Ga0157379_10166604 | Ga0157379_101666042 | 150 |
| 310 | 3300014969 | Ga0157376_10494365 | Ga0157376_104943652 | 150 |
| 311 | 3300017792 | Ga0163161_10652406 | Ga0163161_106524061 | 150 |
| 312 | 3300025735 | Ga0207713_1006239 | Ga0207713_10062395 | 150 |
| 313 | 3300025900 | Ga0207710_10217277 | Ga0207710_102172771 | 150 |
| 314 | 3300025907 | Ga0207645_10079181 | Ga0207645_100791812 | 150 |
| 315 | 3300025918 | Ga0207662_10000938 | Ga0207662_100009386 | 150 |
| 316 | 3300025923 | Ga0207681_10000635 | Ga0207681_100006357 | 150 |
| 317 | 3300025923 | Ga0207681_10077209 | Ga0207681_100772092 | 150 |
| 318 | 3300025923 | Ga0207681_10664324 | Ga0207681_106643242 | 150 |
| 319 | 3300025925 | Ga0207650_10007538 | Ga0207650_100075386 | 150 |
| 320 | 3300025931 | Ga0207644_10090235 | Ga0207644_100902352 | 150 |
| 321 | 3300025933 | Ga0207706_10170683 | Ga0207706_101706832 | 150 |
| 322 | 3300025934 | Ga0207686_10091394 | Ga0207686_100913942 | 150 |
| 323 | 3300025935 | Ga0207709_10120234 | Ga0207709_101202342 | 150 |
| 324 | 3300025936 | Ga0207670_10069819 | Ga0207670_100698192 | 150 |
| 325 | 3300025936 | Ga0207670_10772493 | Ga0207670_107724932 | 150 |
| 326 | 3300025938 | Ga0207704_10020859 | Ga0207704_100208592 | 150 |
| 327 | 3300025940 | Ga0207691_10130637 | Ga0207691_101306372 | 150 |
| 328 | 3300025941 | Ga0207711_10069093 | Ga0207711_100690932 | 150 |
| 329 | 3300025942 | Ga0207689_10055223 | Ga0207689_100552232 | 150 |
| 330 | 3300025942 | Ga0207689_10313357 | Ga0207689_103133572 | 150 |
| 331 | 3300025945 | Ga0207679_10617339 | Ga0207679_106173392 | 150 |
| 332 | 3300025960 | Ga0207651_10262895 | Ga0207651_102628952 | 150 |
| 333 | 3300025960 | Ga0207651_10312503 | Ga0207651_103125032 | 150 |
| 334 | 3300025961 | Ga0207712_10466001 | Ga0207712_104660012 | 150 |
| 335 | 3300025972 | Ga0207668_10001649 | Ga0207668_1000164911 | 150 |
| 336 | 3300025972 | Ga0207668_10019983 | Ga0207668_100199833 | 150 |
| 337 | 3300025972 | Ga0207668_10146253 | Ga0207668_101462531 | 150 |
| 338 | 3300025986 | Ga0207658_10000358 | Ga0207658_1000035815 | 150 |
| 339 | 3300025986 | Ga0207658_10068047 | Ga0207658_100680472 | 150 |
| 340 | 3300025986 | Ga0207658_10151828 | Ga0207658_101518282 | 150 |
| 341 | 3300026023 | Ga0207677_10685018 | Ga0207677_106850181 | 150 |
| 342 | 3300026035 | Ga0207703_10119217 | Ga0207703_101192173 | 150 |
| 343 | 3300026035 | Ga0207703_10275345 | Ga0207703_102753452 | 150 |
| 344 | 3300026041 | Ga0207639_10448406 | Ga0207639_104484061 | 150 |
| 345 | 3300026067 | Ga0207678_11368890 | Ga0207678_113688902 | 150 |
| 346 | 3300026088 | Ga0207641_10000469 | Ga0207641_1000046927 | 150 |
| 347 | 3300026089 | Ga0207648_10010659 | Ga0207648_100106593 | 150 |
| 348 | 3300026089 | Ga0207648_10080124 | Ga0207648_100801242 | 150 |
| 349 | 3300026095 | Ga0207676_10305170 | Ga0207676_103051701 | 150 |
| 350 | 3300026118 | Ga0207675_100984616 | Ga0207675_1009846161 | 150 |
| 351 | 3300026121 | Ga0207683_10129680 | Ga0207683_101296802 | 150 |
| 352 | 3300027866 | Ga0209813_10008609 | Ga0209813_100086092 | 150 |
| 353 | 3300027907 | Ga0207428_10000079 | Ga0207428_1000007937 | 150 |
| 354 | 3300028379 | Ga0268266_10000804 | Ga0268266_1000080417 | 150 |
| 355 | 3300028380 | Ga0268265_10054476 | Ga0268265_100544763 | 150 |
| 356 | 3300028380 | Ga0268265_10075503 | Ga0268265_100755033 | 150 |
| 357 | 3300028381 | Ga0268264_10001282 | Ga0268264_1000128219 | 150 |
| 358 | 3300028381 | Ga0268264_10562219 | Ga0268264_105622192 | 150 |
| 359 | 3300031711 | Ga0265314_10009167 | Ga0265314_100091676 | 150 |
| 360 | 3300031731 | Ga0307405_10776881 | Ga0307405_107768812 | 150 |
| 361 | 3300031995 | Ga0307409_100146969 | Ga0307409_1001469692 | 150 |
| 362 | 3300036401 | Ga0373937_0822976 | Ga0373937_0822976_236_736 | 150 |
| 363 | 3300045051 | Ga0451576_1858484 | Ga0451576_1858484_66_572 | 150 |
| 364 | 3300046499 | Ga0495594_0466845 | Ga0495594_0466845_41_550 | 150 |
| 365 | 3300046674 | Ga0495588_0152814 | Ga0495588_0152814_304_813 | 150 |
| 366 | 3300046691 | Ga0495670_0235761 | Ga0495670_0235761_41_523 | 150 |
| 367 | 3300048913 | Ga0496110_0439905 | Ga0496110_0439905_48_524 | 150 |
| 368 | 3300048919 | Ga0496116_0091452 | Ga0496116_0091452_1113_1589 | 150 |
| 369 | 3300048920 | Ga0496117_0036479 | Ga0496117_0036479_2926_3402 | 150 |
| 370 | 3300048923 | Ga0496120_0138237 | Ga0496120_0138237_475_951 | 150 |
| 371 | 3300048926 | Ga0496123_0147498 | Ga0496123_0147498_67_543 | 150 |
| 372 | 3300048927 | Ga0496124_0001047 | Ga0496124_0001047_35562_36038 | 150 |
| 373 | 3300048927 | Ga0496124_0008258 | Ga0496124_0008258_889_1365 | 150 |
| 374 | 3300048927 | Ga0496124_0204768 | Ga0496124_0204768_954_1430 | 150 |
| 375 | 3300048928 | Ga0496125_0006637 | Ga0496125_0006637_4531_5007 | 150 |
| 376 | 3300048928 | Ga0496125_0076568 | Ga0496125_0076568_1874_2350 | 150 |
| 377 | 3300048928 | Ga0496125_0128552 | Ga0496125_0128552_357_842 | 150 |
| 378 | 3300048929 | Ga0496126_0009686 | Ga0496126_0009686_3591_4067 | 150 |
| 379 | 3300049127 | Ga0501306_078259 | Ga0501306_078259_26_529 | 150 |
| 380 | 3300049128 | Ga0501308_046825 | Ga0501308_046825_34_537 | 150 |
| 381 | 3300049128 | Ga0501308_059219 | Ga0501308_059219_34_525 | 150 |
| 382 | 3300049528 | Ga0501312_041022 | Ga0501312_041022_220_723 | 150 |
| 383 | 3300050489 | nmdc:mga03683_22538_c1 | nmdc:mga03683_22538_c1_246_728 | 150 |
| 384 | 3300050490 | nmdc:mga03n38_110865_c1 | nmdc:mga03n38_110865_c1_91_573 | 150 |
| 385 | 3300050491 | nmdc:mga00v17_316749_c1 | nmdc:mga00v17_316749_c1_343_825 | 150 |
| 386 | 3300050492 | nmdc:mga0yw44_25341_c1 | nmdc:mga0yw44_25341_c1_2553_3035 | 150 |
| 387 | 3300050493 | nmdc:mga0k408_117513_c1 | nmdc:mga0k408_117513_c1_184_666 | 150 |
| 388 | 3300050493 | nmdc:mga0k408_1223_c1 | nmdc:mga0k408_1223_c1_744_1226 | 150 |
| 389 | 3300050494 | nmdc:mga06z11_1087_c1 | nmdc:mga06z11_1087_c1_8288_8770 | 150 |
| 390 | 3300050495 | nmdc:mga04h51_25667_c1 | nmdc:mga04h51_25667_c1_652_1134 | 150 |
| 391 | 3300050509 | nmdc:mga0qj67_558163_c1 | nmdc:mga0qj67_558163_c1_116_598 | 150 |
| 392 | 3300050511 | nmdc:mga08y16_2617_c1 | nmdc:mga08y16_2617_c1_2575_3057 | 150 |
| 393 | 3300050512 | nmdc:mga0n895_152766_c1 | nmdc:mga0n895_152766_c1_512_1018 | 150 |
| 394 | 3300050512 | nmdc:mga0n895_2091816_c1 | nmdc:mga0n895_2091816_c1_30_512 | 150 |
| 395 | 3300050515 | nmdc:mga0a205_404256_c1 | nmdc:mga0a205_404256_c1_474_980 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dgj-assembly1.cif.gz_A | crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 | 0.7243 | 2 | 140 |
| 1t3q-assembly1.cif.gz_D | crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 | 0.7211 | 1 | 140 |
| 1uwm-assembly1.cif.gz_A | reduced ferredoxin 6 from rhodobacter capsulatus | 0.7182 | 1 | 72 |
| 7dqx-assembly1.cif.gz_F | crystal structure of xanthine dehydrogenase family protein | 0.7165 | 1 | 139 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.7154 | 1 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1alo001 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9128 | 1 | 71 | 3.10.20.30 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9068 | 1 | 75 | 3.10.20.30 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8943 | 1 | 75 | 3.10.20.30 |
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8929 | 1 | 75 | 3.10.20.30 |
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8795 | 1 | 73 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A800BKA9-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9359 | 1 | 75 |
GO:0051537
|
| AF-A0A6L9J6X1-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9342 | 1 | 73 |
GO:0051537
|
| AF-A0A3S2KEJ2-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9136 | 1 | 75 |
GO:0016903
GO:0051537 |
| AF-A0A7V5NVP3-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.913 | 1 | 75 |
GO:0051537
|
| AF-A0A2P6FP46-F1-model_v4 | (2Fe-2S)-binding protein | 0.8859 | 1 | 79 |
GO:0051537
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar