F433250

General Info

Members Datasets Scaffolds Average Seq Length
395 254 392 159

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10009167|Ga0265314_100091676
Length 173
Sequence MSFSLKVNGKAVTVDVPPDMPLLWVLRDVLELKGTKFGCGIAQCGACTVHLKGAPVRSCSMPISALQGMEITTIEGLSADGTHPVQKAWQEIDVPQCGYCQAGQIMSAAALLANKKNPSDADIDAAMNGNICRCATYNRIRKAIHRAAAIGGASAXXGAGHAPADDAALEATR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2842694124 Methylopila sp. R-72369 Isolate Unclassified
3 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
180 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
181 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
211 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
212 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
213 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
231 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
252 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.72
Metatranscriptomes 1.52
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.3
Nodule 0
Rhizoplane 1.01
Rhizosphere 89.62
Stem 0
Stem Tuber 0
Unclassified 5.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2381925 2162886007 Bacteria 45817
2 JGI24752J21851_1027691 3300001976 Bacteria 745
3 Ga0058861_11352708 3300004800 Bacteria 683
4 Ga0065704_10070189 3300005289 Bacteria 114786
5 Ga0070676_10057815 3300005328 Bacteria 2296
6 Ga0070683_100022225 3300005329 Bacteria 5667
7 Ga0070690_100108782 3300005330 Bacteria 1847
8 Ga0070670_100721521 3300005331 Bacteria 897
9 Ga0070670_100721995 3300005331 Bacteria 897
10 Ga0068869_100091046 3300005334 Bacteria 2294
11 Ga0068869_100203392 3300005334 Bacteria 1562
12 Ga0070666_10664087 3300005335 Bacteria 763
13 Ga0070680_100046659 3300005336 Bacteria 3525
14 Ga0070682_100002639 3300005337 Bacteria 9906
15 Ga0068868_100199805 3300005338 Bacteria 1666
16 Ga0070660_100127690 3300005339 Bacteria 2033
17 Ga0070689_100047996 3300005340 Bacteria 3292
18 Ga0070687_100010172 3300005343 Bacteria 4056
19 Ga0070687_100207577 3300005343 Bacteria 1191
20 Ga0070661_100001798 3300005344 Bacteria 14878
21 Ga0070668_100527597 3300005347 Bacteria 1025
22 Ga0070668_100710342 3300005347 Bacteria 887
23 Ga0070669_100000983 3300005353 Bacteria 20780
24 Ga0070669_100048493 3300005353 Bacteria 3100
25 Ga0070669_100117367 3300005353 Bacteria 2026
26 Ga0070669_100569591 3300005353 Bacteria 946
27 Ga0070675_100034436 3300005354 Bacteria 4110
28 Ga0070675_100195546 3300005354 Bacteria 1754
29 Ga0070675_100206902 3300005354 Bacteria 1705
30 Ga0070675_100299033 3300005354 Bacteria 1418
31 Ga0070671_100105340 3300005355 Bacteria 2367
32 Ga0070671_100529025 3300005355 Bacteria 1016
33 Ga0070674_100012520 3300005356 Bacteria 5211
34 Ga0070674_100145745 3300005356 Bacteria 1782
35 Ga0070673_100085334 3300005364 Bacteria 2570
36 Ga0070673_100158387 3300005364 Bacteria 1923
37 Ga0070673_100724652 3300005364 Bacteria 914
38 Ga0070688_100029704 3300005365 Bacteria 3275
39 Ga0070688_100254015 3300005365 Bacteria 1253
40 Ga0070688_100806021 3300005365 Bacteria 735
41 Ga0070688_100958526 3300005365 Bacteria 677
42 Ga0070659_100009305 3300005366 Bacteria 7214
43 Ga0070667_100000737 3300005367 Bacteria 31316
44 Ga0070667_100071439 3300005367 Bacteria 2956
45 Ga0070667_100140222 3300005367 Bacteria 2117
46 Ga0070667_100463380 3300005367 Bacteria 1159
47 Ga0070713_100254426 3300005436 Bacteria 1603
48 Ga0070663_100111448 3300005455 Bacteria 2056
49 Ga0070678_100627902 3300005456 Bacteria 962
50 Ga0070662_100085244 3300005457 Bacteria 2361
51 Ga0070662_100620609 3300005457 Bacteria 910
52 Ga0070681_10026117 3300005458 Bacteria 5872
53 Ga0068867_100019425 3300005459 Bacteria 4842
54 Ga0068867_100149793 3300005459 Bacteria 1831
55 Ga0070699_100759455 3300005518 Bacteria 887
56 Ga0070679_100011050 3300005530 Bacteria 8588
57 Ga0070684_100078596 3300005535 Bacteria 2915
58 Ga0068853_100819612 3300005539 Bacteria 892
59 Ga0070672_101580423 3300005543 Bacteria 588
60 Ga0070686_100017715 3300005544 Bacteria 4168
61 Ga0070686_100387129 3300005544 Bacteria 1060
62 Ga0070695_100028656 3300005545 Bacteria 3456
63 Ga0070696_100059243 3300005546 Bacteria 2676
64 Ga0070693_100019656 3300005547 Bacteria 3546
65 Ga0070665_100000686 3300005548 Bacteria 45211
66 Ga0070665_100204310 3300005548 Bacteria 1976
67 Ga0070665_100661097 3300005548 Bacteria 1058
68 Ga0070704_100016649 3300005549 Bacteria 4651
69 Ga0068855_100060851 3300005563 Bacteria 4414
70 Ga0070664_100348584 3300005564 Bacteria 1346
71 Ga0068857_100622225 3300005577 Bacteria 1022
72 Ga0068856_100099661 3300005614 Bacteria 2896
73 Ga0068856_100412192 3300005614 Bacteria 1371
74 Ga0070702_100006190 3300005615 Bacteria 5643
75 Ga0070702_100013511 3300005615 Bacteria 4122
76 Ga0070702_100418995 3300005615 Bacteria 963
77 Ga0068852_101301766 3300005616 Bacteria 748
78 Ga0068859_100034630 3300005617 Bacteria 5068
79 Ga0068859_100044693 3300005617 Bacteria 4450
80 Ga0068859_100136426 3300005617 Bacteria 2526
81 Ga0068864_100005687 3300005618 Bacteria 10219
82 Ga0068864_100210367 3300005618 Bacteria 1791
83 Ga0068864_100608809 3300005618 Bacteria 1061
84 Ga0068866_10035923 3300005718 Bacteria 2424
85 Ga0068861_100019484 3300005719 Bacteria 4846
86 Ga0068870_10103533 3300005840 Bacteria 1613
87 Ga0068863_100000980 3300005841 Bacteria 28685
88 Ga0068863_100033428 3300005841 Bacteria 4899
89 Ga0068858_100208791 3300005842 Bacteria 1848
90 Ga0068860_100001156 3300005843 Bacteria 28867
91 Ga0068860_100006722 3300005843 Bacteria 11537
92 Ga0068860_100031597 3300005843 Bacteria 5089
93 Ga0068860_100364309 3300005843 Bacteria 1425
94 Ga0068862_100042073 3300005844 Bacteria 3890
95 Ga0081539_10259687 3300005985 Bacteria 767
96 Ga0075365_10025964 3300006038 Bacteria 3713
97 Ga0075368_10009188 3300006042 Bacteria 3552
98 Ga0075364_10013045 3300006051 Bacteria 5099
99 Ga0075362_10020129 3300006177 Bacteria 2785
100 Ga0075367_10000316 3300006178 Bacteria 17081
101 Ga0075366_10133140 3300006195 Bacteria 1501
102 Ga0097621_100018759 3300006237 Bacteria 5293
103 Ga0097621_100123385 3300006237 Bacteria 2199
104 Ga0068871_100505572 3300006358 Bacteria 1090
105 Ga0075428_100002558 3300006844 Bacteria 19750
106 Ga0075428_100025730 3300006844 Bacteria 6517
107 Ga0075428_100116776 3300006844 Bacteria 2906
108 Ga0075430_100003971 3300006846 Bacteria 12470
109 Ga0075430_100387901 3300006846 Bacteria 1153
110 Ga0075431_100002364 3300006847 Bacteria 18119
111 Ga0075431_100010176 3300006847 Bacteria 9456
112 Ga0075431_100211432 3300006847 Bacteria 1981
113 Ga0075434_100156481 3300006871 Bacteria 2298
114 Ga0075434_100195676 3300006871 Bacteria 2041
115 Ga0075429_100003953 3300006880 Bacteria 12672
116 Ga0075429_100036097 3300006880 Bacteria 4299
117 Ga0068865_100018079 3300006881 Bacteria 4543
118 Ga0097620_100034624 3300006931 Bacteria 5068
119 Ga0097620_100044696 3300006931 Bacteria 4450
120 Ga0097620_100136423 3300006931 Bacteria 2526
121 Ga0105251_10003303 3300009011 Bacteria 11797
122 Ga0105240_11860834 3300009093 Bacteria 627
123 Ga0111539_10001215 3300009094 Bacteria 34303
124 Ga0111539_10002323 3300009094 Bacteria 25318
125 Ga0111539_10112008 3300009094 Bacteria 3201
126 Ga0111539_10438664 3300009094 Bacteria 1521
127 Ga0111539_11167396 3300009094 Bacteria 895
128 Ga0105245_10029246 3300009098 Bacteria 4867
129 Ga0105245_10152799 3300009098 Bacteria 2184
130 Ga0105245_10187564 3300009098 Bacteria 1979
131 Ga0105245_11987140 3300009098 Bacteria 635
132 Ga0105247_10362171 3300009101 Bacteria 1023
133 Ga0114129_10000532 3300009147 Bacteria 46632
134 Ga0114129_10663863 3300009147 Bacteria 1344
135 Ga0114129_11388387 3300009147 Bacteria 867
136 Ga0105243_10049128 3300009148 Bacteria 3327
137 Ga0105243_10183265 3300009148 Bacteria 1823
138 Ga0105241_10039541 3300009174 Bacteria 3558
139 Ga0105248_10002933 3300009177 Bacteria 18934
140 Ga0105248_10027954 3300009177 Bacteria 6280
141 Ga0105248_10147069 3300009177 Bacteria 2659
142 Ga0105248_10857717 3300009177 Bacteria 1025
143 Ga0105248_11024758 3300009177 Bacteria 932
144 Ga0105237_11264339 3300009545 Bacteria 744
145 Ga0105249_10212945 3300009553 Bacteria 1897
146 Ga0105239_10020606 3300010375 Bacteria 7275
147 Ga0105246_10001421 3300011119 Bacteria 14186
148 Ga0157373_10036655 3300013100 Bacteria 3519
149 Ga0157373_10681800 3300013100 Bacteria 752
150 Ga0157371_10020880 3300013102 Bacteria 4816
151 Ga0157369_10420113 3300013105 Bacteria 1386
152 Ga0157374_10026371 3300013296 Bacteria 5228
153 Ga0157378_10212606 3300013297 Bacteria 1834
154 Ga0157378_10486654 3300013297 Bacteria 1230
155 Ga0157372_10051408 3300013307 Bacteria 4586
156 Ga0157372_10086047 3300013307 Bacteria 3566
157 Ga0157372_10102708 3300013307 Bacteria 3266
158 Ga0157372_10488694 3300013307 Bacteria 1435
159 Ga0157375_10086368 3300013308 Bacteria 3188
160 Ga0157375_10618757 3300013308 Bacteria 1241
161 Ga0157375_10872684 3300013308 Bacteria 1045
162 Ga0163163_10049280 3300014325 Bacteria 4144
163 Ga0163163_10081362 3300014325 Bacteria 3241
164 Ga0163163_10263969 3300014325 Bacteria 1773
165 Ga0163163_10669816 3300014325 Bacteria 1101
166 Ga0163163_11348686 3300014325 Bacteria 775
167 Ga0157380_10060778 3300014326 Bacteria 3021
168 Ga0157377_10042330 3300014745 Bacteria 2529
169 Ga0157377_10052702 3300014745 Bacteria 2298
170 Ga0157379_10166604 3300014968 Bacteria 1989
171 Ga0157379_10200692 3300014968 Bacteria 1804
172 Ga0157376_10009155 3300014969 Bacteria 7181
173 Ga0157376_10494365 3300014969 Bacteria 1201
174 Ga0163161_10652406 3300017792 Bacteria 872
175 Ga0207697_10142666 3300025315 Bacteria 1039
176 Ga0207713_1006239 3300025735 Bacteria 7296
177 Ga0207710_10217277 3300025900 Bacteria 948
178 Ga0207688_10365402 3300025901 Bacteria 891
179 Ga0207680_10124310 3300025903 Bacteria 1691
180 Ga0207647_10097998 3300025904 Bacteria 1743
181 Ga0207647_10219301 3300025904 Bacteria 1097
182 Ga0207647_10518884 3300025904 Bacteria 663
183 Ga0207645_10079181 3300025907 Bacteria 2106
184 Ga0207643_10067887 3300025908 Bacteria 2047
185 Ga0207654_10031002 3300025911 Bacteria 2941
186 Ga0207707_10045838 3300025912 Bacteria 3808
187 Ga0207671_10736711 3300025914 Bacteria 783
188 Ga0207660_10163501 3300025917 Bacteria 1719
189 Ga0207662_10000938 3300025918 Bacteria 13533
190 Ga0207657_10120293 3300025919 Bacteria 2161
191 Ga0207652_10073182 3300025921 Bacteria 2981
192 Ga0207681_10000635 3300025923 Bacteria 23457
193 Ga0207681_10077209 3300025923 Bacteria 2341
194 Ga0207681_10132021 3300025923 Bacteria 1848
195 Ga0207681_10664324 3300025923 Bacteria 865
196 Ga0207694_10401866 3300025924 Bacteria 1139
197 Ga0207650_10002341 3300025925 Bacteria 13193
198 Ga0207650_10007538 3300025925 Bacteria 7419
199 Ga0207659_10068121 3300025926 Bacteria 2588
200 Ga0207659_10121626 3300025926 Bacteria 2001
201 Ga0207687_10140168 3300025927 Bacteria 1834
202 Ga0207700_10688489 3300025928 Bacteria 912
203 Ga0207644_10090235 3300025931 Bacteria 2283
204 Ga0207706_10170683 3300025933 Bacteria 1911
205 Ga0207706_10244970 3300025933 Bacteria 1566
206 Ga0207686_10091394 3300025934 Bacteria 2010
207 Ga0207709_10120234 3300025935 Bacteria 1772
208 Ga0207670_10069819 3300025936 Bacteria 2424
209 Ga0207670_10772493 3300025936 Bacteria 799
210 Ga0207669_11028640 3300025937 Bacteria 693
211 Ga0207704_10020859 3300025938 Bacteria 3476
212 Ga0207691_10005948 3300025940 Bacteria 11784
213 Ga0207691_10130637 3300025940 Bacteria 2219
214 Ga0207711_10069093 3300025941 Bacteria 3061
215 Ga0207711_10473199 3300025941 Bacteria 1167
216 Ga0207689_10032495 3300025942 Bacteria 4341
217 Ga0207689_10055223 3300025942 Bacteria 3269
218 Ga0207689_10313357 3300025942 Bacteria 1301
219 Ga0207661_10003817 3300025944 Bacteria 10503
220 Ga0207679_10001825 3300025945 Bacteria 13268
221 Ga0207679_10617339 3300025945 Bacteria 978
222 Ga0207667_10292393 3300025949 Bacteria 1664
223 Ga0207651_10262895 3300025960 Bacteria 1418
224 Ga0207651_10293455 3300025960 Bacteria 1349
225 Ga0207651_10312503 3300025960 Bacteria 1311
226 Ga0207712_10466001 3300025961 Bacteria 1074
227 Ga0207668_10001649 3300025972 Bacteria 13042
228 Ga0207668_10019983 3300025972 Bacteria 4247
229 Ga0207668_10146253 3300025972 Bacteria 1824
230 Ga0207658_10000358 3300025986 Bacteria 45036
231 Ga0207658_10068047 3300025986 Bacteria 2685
232 Ga0207658_10151828 3300025986 Bacteria 1888
233 Ga0207658_10753449 3300025986 Bacteria 882
234 Ga0207677_10154643 3300026023 Bacteria 1774
235 Ga0207677_10685018 3300026023 Bacteria 908
236 Ga0207703_10119217 3300026035 Bacteria 2263
237 Ga0207703_10275345 3300026035 Bacteria 1526
238 Ga0207639_10448406 3300026041 Bacteria 1171
239 Ga0207639_10740780 3300026041 Bacteria 913
240 Ga0207678_10305641 3300026067 Bacteria 1367
241 Ga0207678_11368890 3300026067 Bacteria 626
242 Ga0207708_10432453 3300026075 Bacteria 1093
243 Ga0207702_10036046 3300026078 Bacteria 4136
244 Ga0207702_10175848 3300026078 Bacteria 1967
245 Ga0207702_10396399 3300026078 Bacteria 1330
246 Ga0207641_10000469 3300026088 Bacteria 45572
247 Ga0207641_10254142 3300026088 Bacteria 1642
248 Ga0207648_10010659 3300026089 Bacteria 8689
249 Ga0207648_10080124 3300026089 Bacteria 2849
250 Ga0207648_12081794 3300026089 Bacteria 528
251 Ga0207676_10252519 3300026095 Bacteria 1588
252 Ga0207676_10305170 3300026095 Bacteria 1455
253 Ga0207676_10832277 3300026095 Bacteria 902
254 Ga0207674_10002535 3300026116 Bacteria 23011
255 Ga0207675_100984616 3300026118 Bacteria 861
256 Ga0207683_10129680 3300026121 Bacteria 2267
257 Ga0207698_10848424 3300026142 Bacteria 918
258 Ga0209813_10008609 3300027866 Bacteria 2584
259 Ga0207428_10000079 3300027907 Bacteria 136472
260 Ga0207428_10004712 3300027907 Bacteria 12899
261 Ga0207428_10076629 3300027907 Bacteria 2618
262 Ga0268266_10000804 3300028379 Bacteria 41628
263 Ga0268266_10191118 3300028379 Bacteria 1869
264 Ga0268265_10054476 3300028380 Bacteria 3035
265 Ga0268265_10075503 3300028380 Bacteria 2640
266 Ga0268265_10914858 3300028380 Bacteria 862
267 Ga0268264_10001282 3300028381 Bacteria 23789
268 Ga0268264_10562219 3300028381 Bacteria 1120
269 Ga0307515_10000716 3300028794 Bacteria 76332
270 Ga0307513_10116315 3300031456 Bacteria 2654
271 Ga0307408_100010475 3300031548 Bacteria 6113
272 Ga0307408_100088160 3300031548 Bacteria 2336
273 Ga0307408_100250752 3300031548 Bacteria 1460
274 Ga0265314_10009167 3300031711 Bacteria 8395
275 Ga0307405_10054432 3300031731 Bacteria 2498
276 Ga0307405_10776881 3300031731 Bacteria 800
277 Ga0307405_11500949 3300031731 Bacteria 592
278 Ga0307410_10260168 3300031852 Bacteria 1353
279 Ga0307407_10940815 3300031903 Bacteria 665
280 Ga0307407_11133839 3300031903 Bacteria 609
281 Ga0307412_10773885 3300031911 Bacteria 831
282 Ga0307412_10869713 3300031911 Bacteria 788
283 Ga0307409_100146969 3300031995 Bacteria 2040
284 Ga0307416_100011084 3300032002 Bacteria 5992
285 Ga0307411_10740184 3300032005 Bacteria 860
286 Ga0307415_100776202 3300032126 Bacteria 872
287 Ga0307415_101220337 3300032126 Bacteria 709
288 Ga0307510_10084182 3300033180 Bacteria 3065
289 Ga0307510_10089539 3300033180 Bacteria 2929
290 Ga0316574_0428105 3300035398 Bacteria 831
291 Ga0316574_0448216 3300035398 Bacteria 809
292 Ga0373931_0008396 3300035691 Bacteria 4897
293 Ga0373937_0822976 3300036401 Bacteria 877
294 Ga0436365_1562404 3300039437 Bacteria 1126
295 Ga0436360_0801113 3300039438 Bacteria 575
296 Ga0451847_0688388 3300041503 Bacteria 1174
297 Ga0451853_0838294 3300041512 Bacteria 1216
298 Ga0439450_030805 3300042008 Bacteria 1205
299 Ga0450889_050766 3300042144 Bacteria 510
300 Ga0439444_0104750 3300042437 Bacteria 645
301 Ga0439464_0000836 3300042439 Bacteria 6807
302 Ga0439460_0043377 3300042461 Bacteria 1329
303 Ga0451577_1558060 3300042876 Bacteria 583
304 Ga0439440_0120221 3300042993 Bacteria 731
305 Ga0466965_0377282 3300044683 Bacteria 780
306 Ga0466970_0001100 3300044765 Bacteria 13106
307 Ga0451576_0147476 3300045051 Bacteria 2453
308 Ga0451576_1858484 3300045051 Bacteria 622
309 Ga0495650_0008000 3300046471 Bacteria 6254
310 Ga0495594_0466845 3300046499 Bacteria 717
311 Ga0495606_0320534 3300046507 Bacteria 833
312 Ga0495643_0067092 3300046522 Bacteria 1891
313 Ga0495588_0152814 3300046674 Bacteria 1220
314 Ga0495670_0235761 3300046691 Bacteria 974
315 Ga0495649_0094605 3300046694 Bacteria 1590
316 Ga0495672_0009508 3300047320 Bacteria 7038
317 Ga0496102_1449267 3300048905 Bacteria 605
318 Ga0496103_0024970 3300048906 Bacteria 3608
319 Ga0496110_0439905 3300048913 Bacteria 1188
320 Ga0496112_0004649 3300048915 Bacteria 11669
321 Ga0496116_0091452 3300048919 Bacteria 1849
322 Ga0496117_0036479 3300048920 Bacteria 3678
323 Ga0496120_0138237 3300048923 Bacteria 1239
324 Ga0496123_0147498 3300048926 Bacteria 1275
325 Ga0496124_0001047 3300048927 Bacteria 43685
326 Ga0496124_0008258 3300048927 Bacteria 10917
327 Ga0496124_0204768 3300048927 Bacteria 1497
328 Ga0496125_0006637 3300048928 Bacteria 12452
329 Ga0496125_0076568 3300048928 Bacteria 2582
330 Ga0496125_0128552 3300048928 Bacteria 1789
331 Ga0496126_0009686 3300048929 Bacteria 10206
332 Ga0496126_0137397 3300048929 Bacteria 2107
333 Ga0501306_078259 3300049127 Bacteria 567
334 Ga0501308_046825 3300049128 Bacteria 624
335 Ga0501308_059219 3300049128 Bacteria 575
336 Ga0495678_142838 3300049459 Bacteria 781
337 Ga0501290_012701 3300049513 Bacteria 1094
338 Ga0501291_001760 3300049514 Bacteria 2535
339 Ga0501312_041022 3300049528 Bacteria 757
340 Ga0501031_0001198 3300049568 Bacteria 15821
341 Ga0501032_0673536 3300049569 Bacteria 656
342 Ga0501033_0770246 3300049570 Bacteria 652
343 Ga0501034_0001099 3300049571 Bacteria 38041
344 Ga0501034_0131869 3300049571 Bacteria 2482
345 Ga0501036_0000924 3300049572 Bacteria 22042
346 Ga0501037_0004936 3300049573 Bacteria 9703
347 Ga0501038_0001262 3300049574 Bacteria 22998
348 Ga0501039_0955438 3300049575 Bacteria 666
349 Ga0501040_0453049 3300049576 Bacteria 924
350 Ga0501043_0002612 3300049579 Bacteria 15193
351 Ga0501046_0000741 3300049580 Bacteria 31610
352 Ga0501047_0004374 3300049581 Bacteria 13295
353 Ga0501047_0176175 3300049581 Bacteria 2006
354 Ga0501048_0040717 3300049582 Bacteria 3328
355 Ga0501070_0105907 3300049586 Bacteria 2325
356 Ga0501073_0000176 3300049589 Bacteria 41996
357 Ga0501074_0128824 3300049590 Bacteria 1811
358 Ga0501207_038160 3300049654 Bacteria 828
359 Ga0501228_001155 3300049666 Bacteria 1866
360 Ga0501080_0006938 3300049742 Bacteria 10219
361 Ga0501035_0002773 3300049822 Bacteria 16962
362 Ga0501044_0007761 3300049823 Bacteria 11796
363 Ga0501045_0343086 3300049824 Bacteria 1112
364 nmdc:mga03683_22538_c1 3300050489 Bacteria 2443
365 nmdc:mga03n38_110865_c1 3300050490 Bacteria 1336
366 nmdc:mga00v17_316749_c1 3300050491 Bacteria 1014
367 nmdc:mga0yw44_25341_c1 3300050492 Bacteria 3371
368 nmdc:mga0k408_117513_c1 3300050493 Bacteria 1574
369 nmdc:mga0k408_1223_c1 3300050493 Bacteria 14078
370 nmdc:mga06z11_1087_c1 3300050494 Bacteria 9902
371 nmdc:mga04h51_25667_c1 3300050495 Bacteria 1816
372 nmdc:mga05p37_1165_c1 3300050507 Bacteria 30287
373 nmdc:mga05p37_203550_c1 3300050507 Bacteria 2396
374 nmdc:mga09592_144122_c1 3300050508 Bacteria 2054
375 nmdc:mga09592_294238_c1 3300050508 Bacteria 1408
376 nmdc:mga0qj67_267289_c1 3300050509 Bacteria 1387
377 nmdc:mga0qj67_558163_c1 3300050509 Bacteria 918
378 nmdc:mga0qj67_6253_c1 3300050509 Bacteria 8738
379 nmdc:mga06r32_511788_c1 3300050510 Bacteria 1177
380 nmdc:mga08y16_2617_c1 3300050511 Bacteria 18486
381 nmdc:mga08y16_327880_c1 3300050511 Bacteria 1575
382 nmdc:mga08y16_346244_c1 3300050511 Bacteria 1527
383 nmdc:mga08y16_488511_c1 3300050511 Bacteria 1252
384 nmdc:mga08y16_717_c1 3300050511 Bacteria 31525
385 nmdc:mga0n895_152766_c1 3300050512 Bacteria 2339
386 nmdc:mga0n895_2091816_c1 3300050512 Bacteria 523
387 nmdc:mga0a205_404256_c1 3300050515 Bacteria 1229
388 nmdc:mga0a205_695518_c1 3300050515 Bacteria 867
389 Ga0500643_000757 3300053087 Bacteria 21048
390 Ga0500608_277274 3300053122 Bacteria 637
391 Ga0587111_0168279 3300060346 Bacteria 601
392 Ga0530510_0528750 3300061734 Bacteria 895

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053122 Ga0500608_277274 Ga0500608_277274_17_415 123
2 3300049459 Ga0495678_142838 Ga0495678_142838_346_762 129
3 3300039437 Ga0436365_1562404 Ga0436365_1562404_10_429 130
4 3300041503 Ga0451847_0688388 Ga0451847_0688388_550_972 131
5 3300026089 Ga0207648_12081794 Ga0207648_120817941 139
6 3300035398 Ga0316574_0448216 Ga0316574_0448216_12_494 139
7 iso_pu_bacteria 2842694124 2842694842 142
8 3300009094 Ga0111539_10112008 Ga0111539_101120081 143
9 3300031903 Ga0307407_10940815 Ga0307407_109408151 143
10 3300032005 Ga0307411_10740184 Ga0307411_107401842 143
11 3300032126 Ga0307415_101220337 Ga0307415_1012203372 143
12 3300046471 Ga0495650_0008000 Ga0495650_0008000_1551_2009 143
13 iso_pu_bacteria 2954011201 2954012579 143
14 3300006844 Ga0075428_100002558 Ga0075428_1000025588 144
15 3300006844 Ga0075428_100025730 Ga0075428_1000257302 144
16 3300006846 Ga0075430_100003971 Ga0075430_1000039717 144
17 3300006846 Ga0075430_100387901 Ga0075430_1003879012 144
18 3300006847 Ga0075431_100002364 Ga0075431_1000023648 144
19 3300006847 Ga0075431_100010176 Ga0075431_1000101766 144
20 3300006880 Ga0075429_100003953 Ga0075429_1000039532 144
21 3300009093 Ga0105240_11860834 Ga0105240_118608342 144
22 3300009094 Ga0111539_10001215 Ga0111539_100012159 144
23 3300009147 Ga0114129_10000532 Ga0114129_1000053219 144
24 3300009147 Ga0114129_10663863 Ga0114129_106638632 144
25 3300025901 Ga0207688_10365402 Ga0207688_103654022 144
26 3300025904 Ga0207647_10518884 Ga0207647_105188841 144
27 3300025937 Ga0207669_11028640 Ga0207669_110286401 144
28 3300026075 Ga0207708_10432453 Ga0207708_104324531 144
29 3300027907 Ga0207428_10004712 Ga0207428_100047125 144
30 3300028380 Ga0268265_10914858 Ga0268265_109148581 144
31 3300031548 Ga0307408_100010475 Ga0307408_1000104752 144
32 3300031548 Ga0307408_100088160 Ga0307408_1000881602 144
33 3300031548 Ga0307408_100250752 Ga0307408_1002507522 144
34 3300031731 Ga0307405_10054432 Ga0307405_100544322 144
35 3300031852 Ga0307410_10260168 Ga0307410_102601682 144
36 3300031903 Ga0307407_11133839 Ga0307407_111338392 144
37 3300031911 Ga0307412_10773885 Ga0307412_107738851 144
38 3300031911 Ga0307412_10869713 Ga0307412_108697131 144
39 3300032002 Ga0307416_100011084 Ga0307416_1000110842 144
40 3300032126 Ga0307415_100776202 Ga0307415_1007762022 144
41 3300042008 Ga0439450_030805 Ga0439450_030805_392_850 144
42 3300042144 Ga0450889_050766 Ga0450889_050766_20_478 144
43 3300042437 Ga0439444_0104750 Ga0439444_0104750_64_522 144
44 3300042439 Ga0439464_0000836 Ga0439464_0000836_1807_2265 144
45 3300042461 Ga0439460_0043377 Ga0439460_0043377_555_1013 144
46 3300048905 Ga0496102_1449267 Ga0496102_1449267_81_539 144
47 3300049513 Ga0501290_012701 Ga0501290_012701_263_721 144
48 3300049514 Ga0501291_001760 Ga0501291_001760_1490_1948 144
49 3300049576 Ga0501040_0453049 Ga0501040_0453049_96_554 144
50 3300049654 Ga0501207_038160 Ga0501207_038160_170_628 144
51 3300049666 Ga0501228_001155 Ga0501228_001155_1193_1651 144
52 3300049824 Ga0501045_0343086 Ga0501045_0343086_89_547 144
53 3300050507 nmdc:mga05p37_1165_c1 nmdc:mga05p37_1165_c1_11021_11479 144
54 3300050507 nmdc:mga05p37_203550_c1 nmdc:mga05p37_203550_c1_203_661 144
55 3300050508 nmdc:mga09592_144122_c1 nmdc:mga09592_144122_c1_1564_2022 144
56 3300050508 nmdc:mga09592_294238_c1 nmdc:mga09592_294238_c1_230_688 144
57 3300050509 nmdc:mga0qj67_267289_c1 nmdc:mga0qj67_267289_c1_165_623 144
58 3300050509 nmdc:mga0qj67_6253_c1 nmdc:mga0qj67_6253_c1_7638_8096 144
59 3300050510 nmdc:mga06r32_511788_c1 nmdc:mga06r32_511788_c1_369_827 144
60 3300050511 nmdc:mga08y16_346244_c1 nmdc:mga08y16_346244_c1_504_968 144
61 3300050511 nmdc:mga08y16_488511_c1 nmdc:mga08y16_488511_c1_679_1137 144
62 3300050511 nmdc:mga08y16_717_c1 nmdc:mga08y16_717_c1_22926_23384 144
63 3300050515 nmdc:mga0a205_695518_c1 nmdc:mga0a205_695518_c1_108_566 144
64 3300061734 Ga0530510_0528750 Ga0530510_0528750_372_830 144
65 iso_pu_bacteria 8054302542 8054303332 144
66 3300005354 Ga0070675_100206902 Ga0070675_1002069022 145
67 3300009177 Ga0105248_10002933 Ga0105248_1000293312 145
68 3300025926 Ga0207659_10068121 Ga0207659_100681212 145
69 3300025940 Ga0207691_10005948 Ga0207691_1000594813 145
70 3300026142 Ga0207698_10848424 Ga0207698_108484242 145
71 3300028794 Ga0307515_10000716 Ga0307515_1000071630 145
72 3300031456 Ga0307513_10116315 Ga0307513_101163152 145
73 3300031731 Ga0307405_11500949 Ga0307405_115009492 145
74 3300042993 Ga0439440_0120221 Ga0439440_0120221_62_541 145
75 3300001976 JGI24752J21851_1027691 JGI24752J21851_10276911 146
76 3300005329 Ga0070683_100022225 Ga0070683_1000222252 146
77 3300005330 Ga0070690_100108782 Ga0070690_1001087822 146
78 3300005334 Ga0068869_100091046 Ga0068869_1000910462 146
79 3300005335 Ga0070666_10664087 Ga0070666_106640871 146
80 3300005336 Ga0070680_100046659 Ga0070680_1000466593 146
81 3300005337 Ga0070682_100002639 Ga0070682_1000026398 146
82 3300005338 Ga0068868_100199805 Ga0068868_1001998052 146
83 3300005339 Ga0070660_100127690 Ga0070660_1001276902 146
84 3300005344 Ga0070661_100001798 Ga0070661_10000179812 146
85 3300005353 Ga0070669_100117367 Ga0070669_1001173672 146
86 3300005354 Ga0070675_100034436 Ga0070675_1000344364 146
87 3300005355 Ga0070671_100529025 Ga0070671_1005290252 146
88 3300005364 Ga0070673_100158387 Ga0070673_1001583872 146
89 3300005365 Ga0070688_100254015 Ga0070688_1002540152 146
90 3300005366 Ga0070659_100009305 Ga0070659_1000093054 146
91 3300005367 Ga0070667_100463380 Ga0070667_1004633802 146
92 3300005436 Ga0070713_100254426 Ga0070713_1002544262 146
93 3300005457 Ga0070662_100085244 Ga0070662_1000852442 146
94 3300005458 Ga0070681_10026117 Ga0070681_100261173 146
95 3300005530 Ga0070679_100011050 Ga0070679_1000110504 146
96 3300005535 Ga0070684_100078596 Ga0070684_1000785962 146
97 3300005539 Ga0068853_100819612 Ga0068853_1008196122 146
98 3300005544 Ga0070686_100387129 Ga0070686_1003871292 146
99 3300005545 Ga0070695_100028656 Ga0070695_1000286563 146
100 3300005547 Ga0070693_100019656 Ga0070693_1000196562 146
101 3300005563 Ga0068855_100060851 Ga0068855_1000608513 146
102 3300005564 Ga0070664_100348584 Ga0070664_1003485842 146
103 3300005614 Ga0068856_100099661 Ga0068856_1000996612 146
104 3300005615 Ga0070702_100013511 Ga0070702_1000135112 146
105 3300005616 Ga0068852_101301766 Ga0068852_1013017662 146
106 3300005617 Ga0068859_100034630 Ga0068859_1000346304 146
107 3300005618 Ga0068864_100005687 Ga0068864_1000056874 146
108 3300005618 Ga0068864_100608809 Ga0068864_1006088092 146
109 3300005840 Ga0068870_10103533 Ga0068870_101035332 146
110 3300005841 Ga0068863_100033428 Ga0068863_1000334283 146
111 3300005843 Ga0068860_100031597 Ga0068860_1000315974 146
112 3300005985 Ga0081539_10259687 Ga0081539_102596872 146
113 3300006237 Ga0097621_100018759 Ga0097621_1000187592 146
114 3300006931 Ga0097620_100034624 Ga0097620_1000346244 146
115 3300009094 Ga0111539_10438664 Ga0111539_104386642 146
116 3300009098 Ga0105245_10029246 Ga0105245_100292464 146
117 3300009098 Ga0105245_11987140 Ga0105245_119871401 146
118 3300009174 Ga0105241_10039541 Ga0105241_100395413 146
119 3300009177 Ga0105248_10027954 Ga0105248_100279544 146
120 3300009545 Ga0105237_11264339 Ga0105237_112643392 146
121 3300010375 Ga0105239_10020606 Ga0105239_100206062 146
122 3300011119 Ga0105246_10001421 Ga0105246_100014212 146
123 3300013100 Ga0157373_10036655 Ga0157373_100366553 146
124 3300013100 Ga0157373_10681800 Ga0157373_106818002 146
125 3300013102 Ga0157371_10020880 Ga0157371_100208804 146
126 3300013105 Ga0157369_10420113 Ga0157369_104201132 146
127 3300013296 Ga0157374_10026371 Ga0157374_100263712 146
128 3300013307 Ga0157372_10051408 Ga0157372_100514084 146
129 3300013307 Ga0157372_10086047 Ga0157372_100860472 146
130 3300013307 Ga0157372_10102708 Ga0157372_101027082 146
131 3300013307 Ga0157372_10488694 Ga0157372_104886942 146
132 3300014325 Ga0163163_10081362 Ga0163163_100813622 146
133 3300014325 Ga0163163_10263969 Ga0163163_102639692 146
134 3300014745 Ga0157377_10052702 Ga0157377_100527022 146
135 3300014968 Ga0157379_10200692 Ga0157379_102006922 146
136 3300014969 Ga0157376_10009155 Ga0157376_100091555 146
137 3300025315 Ga0207697_10142666 Ga0207697_101426662 146
138 3300025903 Ga0207680_10124310 Ga0207680_101243102 146
139 3300025904 Ga0207647_10219301 Ga0207647_102193012 146
140 3300025908 Ga0207643_10067887 Ga0207643_100678872 146
141 3300025911 Ga0207654_10031002 Ga0207654_100310022 146
142 3300025912 Ga0207707_10045838 Ga0207707_100458382 146
143 3300025914 Ga0207671_10736711 Ga0207671_107367111 146
144 3300025917 Ga0207660_10163501 Ga0207660_101635012 146
145 3300025919 Ga0207657_10120293 Ga0207657_101202932 146
146 3300025921 Ga0207652_10073182 Ga0207652_100731822 146
147 3300025923 Ga0207681_10132021 Ga0207681_101320212 146
148 3300025924 Ga0207694_10401866 Ga0207694_104018661 146
149 3300025925 Ga0207650_10002341 Ga0207650_100023412 146
150 3300025926 Ga0207659_10121626 Ga0207659_101216262 146
151 3300025927 Ga0207687_10140168 Ga0207687_101401682 146
152 3300025928 Ga0207700_10688489 Ga0207700_106884892 146
153 3300025933 Ga0207706_10244970 Ga0207706_102449702 146
154 3300025942 Ga0207689_10032495 Ga0207689_100324952 146
155 3300025944 Ga0207661_10003817 Ga0207661_100038178 146
156 3300025945 Ga0207679_10001825 Ga0207679_100018252 146
157 3300025949 Ga0207667_10292393 Ga0207667_102923932 146
158 3300025960 Ga0207651_10293455 Ga0207651_102934552 146
159 3300025986 Ga0207658_10753449 Ga0207658_107534492 146
160 3300026023 Ga0207677_10154643 Ga0207677_101546432 146
161 3300026041 Ga0207639_10740780 Ga0207639_107407802 146
162 3300026067 Ga0207678_10305641 Ga0207678_103056412 146
163 3300026078 Ga0207702_10036046 Ga0207702_100360462 146
164 3300026078 Ga0207702_10175848 Ga0207702_101758482 146
165 3300026088 Ga0207641_10254142 Ga0207641_102541422 146
166 3300026095 Ga0207676_10832277 Ga0207676_108322772 146
167 3300026116 Ga0207674_10002535 Ga0207674_1000253519 146
168 3300027907 Ga0207428_10076629 Ga0207428_100766292 146
169 3300035398 Ga0316574_0428105 Ga0316574_0428105_272_739 146
170 3300035691 Ga0373931_0008396 Ga0373931_0008396_1915_2403 146
171 3300039438 Ga0436360_0801113 Ga0436360_0801113_89_553 146
172 3300045051 Ga0451576_0147476 Ga0451576_0147476_1825_2310 146
173 3300048915 Ga0496112_0004649 Ga0496112_0004649_4498_4983 146
174 3300050511 nmdc:mga08y16_327880_c1 nmdc:mga08y16_327880_c1_236_721 146
175 3300004800 Ga0058861_11352708 Ga0058861_113527081 147
176 3300005331 Ga0070670_100721995 Ga0070670_1007219952 147
177 3300005618 Ga0068864_100210367 Ga0068864_1002103672 147
178 3300009177 Ga0105248_10857717 Ga0105248_108577172 147
179 3300014325 Ga0163163_10049280 Ga0163163_100492803 147
180 3300025941 Ga0207711_10473199 Ga0207711_104731992 147
181 3300026095 Ga0207676_10252519 Ga0207676_102525192 147
182 3300044683 Ga0466965_0377282 Ga0466965_0377282_205_672 147
183 3300044765 Ga0466970_0001100 Ga0466970_0001100_4599_5066 147
184 3300047320 Ga0495672_0009508 Ga0495672_0009508_1064_1567 147
185 3300048906 Ga0496103_0024970 Ga0496103_0024970_259_729 147
186 3300005614 Ga0068856_100412192 Ga0068856_1004121922 148
187 3300013308 Ga0157375_10618757 Ga0157375_106187572 148
188 3300026078 Ga0207702_10396399 Ga0207702_103963992 148
189 3300049568 Ga0501031_0001198 Ga0501031_0001198_5427_5900 148
190 3300049569 Ga0501032_0673536 Ga0501032_0673536_149_622 148
191 3300049571 Ga0501034_0001099 Ga0501034_0001099_1391_1864 148
192 3300049571 Ga0501034_0131869 Ga0501034_0131869_1863_2336 148
193 3300049572 Ga0501036_0000924 Ga0501036_0000924_8149_8622 148
194 3300049573 Ga0501037_0004936 Ga0501037_0004936_1196_1669 148
195 3300049574 Ga0501038_0001262 Ga0501038_0001262_13203_13676 148
196 3300049575 Ga0501039_0955438 Ga0501039_0955438_131_604 148
197 3300049579 Ga0501043_0002612 Ga0501043_0002612_9900_10373 148
198 3300049580 Ga0501046_0000741 Ga0501046_0000741_18319_18792 148
199 3300049581 Ga0501047_0004374 Ga0501047_0004374_11077_11550 148
200 3300049581 Ga0501047_0176175 Ga0501047_0176175_172_645 148
201 3300049582 Ga0501048_0040717 Ga0501048_0040717_597_1070 148
202 3300049586 Ga0501070_0105907 Ga0501070_0105907_659_1132 148
203 3300049589 Ga0501073_0000176 Ga0501073_0000176_12819_13292 148
204 3300049590 Ga0501074_0128824 Ga0501074_0128824_427_900 148
205 3300049742 Ga0501080_0006938 Ga0501080_0006938_5978_6451 148
206 3300049822 Ga0501035_0002773 Ga0501035_0002773_2699_3172 148
207 3300049823 Ga0501044_0007761 Ga0501044_0007761_1196_1669 148
208 3300053087 Ga0500643_000757 Ga0500643_000757_11711_12184 148
209 3300060346 Ga0587111_0168279 Ga0587111_0168279_86_559 148
210 3300005347 Ga0070668_100527597 Ga0070668_1005275971 149
211 3300005365 Ga0070688_100806021 Ga0070688_1008060211 149
212 3300005543 Ga0070672_101580423 Ga0070672_1015804231 149
213 3300005548 Ga0070665_100204310 Ga0070665_1002043102 149
214 3300014325 Ga0163163_10669816 Ga0163163_106698162 149
215 3300025904 Ga0207647_10097998 Ga0207647_100979982 149
216 3300028379 Ga0268266_10191118 Ga0268266_101911182 149
217 3300033180 Ga0307510_10084182 Ga0307510_100841821 149
218 3300033180 Ga0307510_10089539 Ga0307510_100895392 149
219 3300041512 Ga0451853_0838294 Ga0451853_0838294_270_746 149
220 3300042876 Ga0451577_1558060 Ga0451577_1558060_43_549 149
221 3300046507 Ga0495606_0320534 Ga0495606_0320534_217_705 149
222 3300046522 Ga0495643_0067092 Ga0495643_0067092_407_892 149
223 3300046694 Ga0495649_0094605 Ga0495649_0094605_1065_1553 149
224 3300048929 Ga0496126_0137397 Ga0496126_0137397_623_1111 149
225 3300049570 Ga0501033_0770246 Ga0501033_0770246_38_514 149
226 2162886007 SwRhRL2b_contig_2381925 SwRhRL2b_0194.00002030 150
227 3300005289 Ga0065704_10070189 Ga0065704_1007018941 150
228 3300005328 Ga0070676_10057815 Ga0070676_100578152 150
229 3300005331 Ga0070670_100721521 Ga0070670_1007215212 150
230 3300005334 Ga0068869_100203392 Ga0068869_1002033922 150
231 3300005340 Ga0070689_100047996 Ga0070689_1000479962 150
232 3300005343 Ga0070687_100010172 Ga0070687_1000101722 150
233 3300005343 Ga0070687_100207577 Ga0070687_1002075772 150
234 3300005347 Ga0070668_100710342 Ga0070668_1007103422 150
235 3300005353 Ga0070669_100000983 Ga0070669_1000009833 150
236 3300005353 Ga0070669_100048493 Ga0070669_1000484932 150
237 3300005353 Ga0070669_100569591 Ga0070669_1005695912 150
238 3300005354 Ga0070675_100195546 Ga0070675_1001955463 150
239 3300005354 Ga0070675_100299033 Ga0070675_1002990332 150
240 3300005355 Ga0070671_100105340 Ga0070671_1001053403 150
241 3300005356 Ga0070674_100012520 Ga0070674_1000125204 150
242 3300005356 Ga0070674_100145745 Ga0070674_1001457452 150
243 3300005364 Ga0070673_100085334 Ga0070673_1000853342 150
244 3300005364 Ga0070673_100724652 Ga0070673_1007246523 150
245 3300005365 Ga0070688_100029704 Ga0070688_1000297043 150
246 3300005365 Ga0070688_100958526 Ga0070688_1009585261 150
247 3300005367 Ga0070667_100000737 Ga0070667_10000073738 150
248 3300005367 Ga0070667_100071439 Ga0070667_1000714392 150
249 3300005367 Ga0070667_100140222 Ga0070667_1001402222 150
250 3300005455 Ga0070663_100111448 Ga0070663_1001114481 150
251 3300005456 Ga0070678_100627902 Ga0070678_1006279022 150
252 3300005457 Ga0070662_100620609 Ga0070662_1006206092 150
253 3300005459 Ga0068867_100019425 Ga0068867_1000194253 150
254 3300005459 Ga0068867_100149793 Ga0068867_1001497931 150
255 3300005518 Ga0070699_100759455 Ga0070699_1007594552 150
256 3300005544 Ga0070686_100017715 Ga0070686_1000177152 150
257 3300005546 Ga0070696_100059243 Ga0070696_1000592432 150
258 3300005548 Ga0070665_100000686 Ga0070665_10000068617 150
259 3300005548 Ga0070665_100661097 Ga0070665_1006610971 150
260 3300005549 Ga0070704_100016649 Ga0070704_1000166492 150
261 3300005577 Ga0068857_100622225 Ga0068857_1006222251 150
262 3300005615 Ga0070702_100006190 Ga0070702_1000061904 150
263 3300005615 Ga0070702_100418995 Ga0070702_1004189952 150
264 3300005617 Ga0068859_100044693 Ga0068859_1000446932 150
265 3300005617 Ga0068859_100136426 Ga0068859_1001364262 150
266 3300005718 Ga0068866_10035923 Ga0068866_100359231 150
267 3300005719 Ga0068861_100019484 Ga0068861_1000194842 150
268 3300005841 Ga0068863_100000980 Ga0068863_10000098025 150
269 3300005842 Ga0068858_100208791 Ga0068858_1002087912 150
270 3300005843 Ga0068860_100001156 Ga0068860_1000011568 150
271 3300005843 Ga0068860_100006722 Ga0068860_1000067223 150
272 3300005843 Ga0068860_100364309 Ga0068860_1003643092 150
273 3300005844 Ga0068862_100042073 Ga0068862_1000420732 150
274 3300006038 Ga0075365_10025964 Ga0075365_100259643 150
275 3300006042 Ga0075368_10009188 Ga0075368_100091882 150
276 3300006051 Ga0075364_10013045 Ga0075364_100130452 150
277 3300006177 Ga0075362_10020129 Ga0075362_100201292 150
278 3300006178 Ga0075367_10000316 Ga0075367_100003169 150
279 3300006195 Ga0075366_10133140 Ga0075366_101331402 150
280 3300006237 Ga0097621_100123385 Ga0097621_1001233852 150
281 3300006358 Ga0068871_100505572 Ga0068871_1005055722 150
282 3300006844 Ga0075428_100116776 Ga0075428_1001167762 150
283 3300006847 Ga0075431_100211432 Ga0075431_1002114322 150
284 3300006871 Ga0075434_100156481 Ga0075434_1001564812 150
285 3300006871 Ga0075434_100195676 Ga0075434_1001956762 150
286 3300006880 Ga0075429_100036097 Ga0075429_1000360973 150
287 3300006881 Ga0068865_100018079 Ga0068865_1000180792 150
288 3300006931 Ga0097620_100044696 Ga0097620_1000446962 150
289 3300006931 Ga0097620_100136423 Ga0097620_1001364232 150
290 3300009011 Ga0105251_10003303 Ga0105251_100033037 150
291 3300009094 Ga0111539_10002323 Ga0111539_1000232315 150
292 3300009094 Ga0111539_11167396 Ga0111539_111673962 150
293 3300009098 Ga0105245_10152799 Ga0105245_101527992 150
294 3300009098 Ga0105245_10187564 Ga0105245_101875642 150
295 3300009101 Ga0105247_10362171 Ga0105247_103621712 150
296 3300009147 Ga0114129_11388387 Ga0114129_113883871 150
297 3300009148 Ga0105243_10049128 Ga0105243_100491281 150
298 3300009148 Ga0105243_10183265 Ga0105243_101832652 150
299 3300009177 Ga0105248_10147069 Ga0105248_101470692 150
300 3300009177 Ga0105248_11024758 Ga0105248_110247581 150
301 3300009553 Ga0105249_10212945 Ga0105249_102129452 150
302 3300013297 Ga0157378_10212606 Ga0157378_102126061 150
303 3300013297 Ga0157378_10486654 Ga0157378_104866542 150
304 3300013308 Ga0157375_10086368 Ga0157375_100863681 150
305 3300013308 Ga0157375_10872684 Ga0157375_108726842 150
306 3300014325 Ga0163163_11348686 Ga0163163_113486862 150
307 3300014326 Ga0157380_10060778 Ga0157380_100607784 150
308 3300014745 Ga0157377_10042330 Ga0157377_100423302 150
309 3300014968 Ga0157379_10166604 Ga0157379_101666042 150
310 3300014969 Ga0157376_10494365 Ga0157376_104943652 150
311 3300017792 Ga0163161_10652406 Ga0163161_106524061 150
312 3300025735 Ga0207713_1006239 Ga0207713_10062395 150
313 3300025900 Ga0207710_10217277 Ga0207710_102172771 150
314 3300025907 Ga0207645_10079181 Ga0207645_100791812 150
315 3300025918 Ga0207662_10000938 Ga0207662_100009386 150
316 3300025923 Ga0207681_10000635 Ga0207681_100006357 150
317 3300025923 Ga0207681_10077209 Ga0207681_100772092 150
318 3300025923 Ga0207681_10664324 Ga0207681_106643242 150
319 3300025925 Ga0207650_10007538 Ga0207650_100075386 150
320 3300025931 Ga0207644_10090235 Ga0207644_100902352 150
321 3300025933 Ga0207706_10170683 Ga0207706_101706832 150
322 3300025934 Ga0207686_10091394 Ga0207686_100913942 150
323 3300025935 Ga0207709_10120234 Ga0207709_101202342 150
324 3300025936 Ga0207670_10069819 Ga0207670_100698192 150
325 3300025936 Ga0207670_10772493 Ga0207670_107724932 150
326 3300025938 Ga0207704_10020859 Ga0207704_100208592 150
327 3300025940 Ga0207691_10130637 Ga0207691_101306372 150
328 3300025941 Ga0207711_10069093 Ga0207711_100690932 150
329 3300025942 Ga0207689_10055223 Ga0207689_100552232 150
330 3300025942 Ga0207689_10313357 Ga0207689_103133572 150
331 3300025945 Ga0207679_10617339 Ga0207679_106173392 150
332 3300025960 Ga0207651_10262895 Ga0207651_102628952 150
333 3300025960 Ga0207651_10312503 Ga0207651_103125032 150
334 3300025961 Ga0207712_10466001 Ga0207712_104660012 150
335 3300025972 Ga0207668_10001649 Ga0207668_1000164911 150
336 3300025972 Ga0207668_10019983 Ga0207668_100199833 150
337 3300025972 Ga0207668_10146253 Ga0207668_101462531 150
338 3300025986 Ga0207658_10000358 Ga0207658_1000035815 150
339 3300025986 Ga0207658_10068047 Ga0207658_100680472 150
340 3300025986 Ga0207658_10151828 Ga0207658_101518282 150
341 3300026023 Ga0207677_10685018 Ga0207677_106850181 150
342 3300026035 Ga0207703_10119217 Ga0207703_101192173 150
343 3300026035 Ga0207703_10275345 Ga0207703_102753452 150
344 3300026041 Ga0207639_10448406 Ga0207639_104484061 150
345 3300026067 Ga0207678_11368890 Ga0207678_113688902 150
346 3300026088 Ga0207641_10000469 Ga0207641_1000046927 150
347 3300026089 Ga0207648_10010659 Ga0207648_100106593 150
348 3300026089 Ga0207648_10080124 Ga0207648_100801242 150
349 3300026095 Ga0207676_10305170 Ga0207676_103051701 150
350 3300026118 Ga0207675_100984616 Ga0207675_1009846161 150
351 3300026121 Ga0207683_10129680 Ga0207683_101296802 150
352 3300027866 Ga0209813_10008609 Ga0209813_100086092 150
353 3300027907 Ga0207428_10000079 Ga0207428_1000007937 150
354 3300028379 Ga0268266_10000804 Ga0268266_1000080417 150
355 3300028380 Ga0268265_10054476 Ga0268265_100544763 150
356 3300028380 Ga0268265_10075503 Ga0268265_100755033 150
357 3300028381 Ga0268264_10001282 Ga0268264_1000128219 150
358 3300028381 Ga0268264_10562219 Ga0268264_105622192 150
359 3300031711 Ga0265314_10009167 Ga0265314_100091676 150
360 3300031731 Ga0307405_10776881 Ga0307405_107768812 150
361 3300031995 Ga0307409_100146969 Ga0307409_1001469692 150
362 3300036401 Ga0373937_0822976 Ga0373937_0822976_236_736 150
363 3300045051 Ga0451576_1858484 Ga0451576_1858484_66_572 150
364 3300046499 Ga0495594_0466845 Ga0495594_0466845_41_550 150
365 3300046674 Ga0495588_0152814 Ga0495588_0152814_304_813 150
366 3300046691 Ga0495670_0235761 Ga0495670_0235761_41_523 150
367 3300048913 Ga0496110_0439905 Ga0496110_0439905_48_524 150
368 3300048919 Ga0496116_0091452 Ga0496116_0091452_1113_1589 150
369 3300048920 Ga0496117_0036479 Ga0496117_0036479_2926_3402 150
370 3300048923 Ga0496120_0138237 Ga0496120_0138237_475_951 150
371 3300048926 Ga0496123_0147498 Ga0496123_0147498_67_543 150
372 3300048927 Ga0496124_0001047 Ga0496124_0001047_35562_36038 150
373 3300048927 Ga0496124_0008258 Ga0496124_0008258_889_1365 150
374 3300048927 Ga0496124_0204768 Ga0496124_0204768_954_1430 150
375 3300048928 Ga0496125_0006637 Ga0496125_0006637_4531_5007 150
376 3300048928 Ga0496125_0076568 Ga0496125_0076568_1874_2350 150
377 3300048928 Ga0496125_0128552 Ga0496125_0128552_357_842 150
378 3300048929 Ga0496126_0009686 Ga0496126_0009686_3591_4067 150
379 3300049127 Ga0501306_078259 Ga0501306_078259_26_529 150
380 3300049128 Ga0501308_046825 Ga0501308_046825_34_537 150
381 3300049128 Ga0501308_059219 Ga0501308_059219_34_525 150
382 3300049528 Ga0501312_041022 Ga0501312_041022_220_723 150
383 3300050489 nmdc:mga03683_22538_c1 nmdc:mga03683_22538_c1_246_728 150
384 3300050490 nmdc:mga03n38_110865_c1 nmdc:mga03n38_110865_c1_91_573 150
385 3300050491 nmdc:mga00v17_316749_c1 nmdc:mga00v17_316749_c1_343_825 150
386 3300050492 nmdc:mga0yw44_25341_c1 nmdc:mga0yw44_25341_c1_2553_3035 150
387 3300050493 nmdc:mga0k408_117513_c1 nmdc:mga0k408_117513_c1_184_666 150
388 3300050493 nmdc:mga0k408_1223_c1 nmdc:mga0k408_1223_c1_744_1226 150
389 3300050494 nmdc:mga06z11_1087_c1 nmdc:mga06z11_1087_c1_8288_8770 150
390 3300050495 nmdc:mga04h51_25667_c1 nmdc:mga04h51_25667_c1_652_1134 150
391 3300050509 nmdc:mga0qj67_558163_c1 nmdc:mga0qj67_558163_c1_116_598 150
392 3300050511 nmdc:mga08y16_2617_c1 nmdc:mga08y16_2617_c1_2575_3057 150
393 3300050512 nmdc:mga0n895_152766_c1 nmdc:mga0n895_152766_c1_512_1018 150
394 3300050512 nmdc:mga0n895_2091816_c1 nmdc:mga0n895_2091816_c1_30_512 150
395 3300050515 nmdc:mga0a205_404256_c1 nmdc:mga0a205_404256_c1_474_980 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

73

145

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

5

73

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.7243 2 140
1t3q-assembly1.cif.gz_D crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.7211 1 140
1uwm-assembly1.cif.gz_A reduced ferredoxin 6 from rhodobacter capsulatus 0.7182 1 72
7dqx-assembly1.cif.gz_F crystal structure of xanthine dehydrogenase family protein 0.7165 1 139
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.7154 1 140
ID Description Score Start End Superfamily
1alo001 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9128 1 71 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9068 1 75 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8943 1 75 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8929 1 75 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8795 1 73 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A800BKA9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9359 1 75 GO:0051537
AF-A0A6L9J6X1-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9342 1 73 GO:0051537
AF-A0A3S2KEJ2-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9136 1 75 GO:0016903
GO:0051537
AF-A0A7V5NVP3-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.913 1 75 GO:0051537
AF-A0A2P6FP46-F1-model_v4 (2Fe-2S)-binding protein 0.8859 1 79 GO:0051537

Feature Viewer

pLDDT pTM Quality
80.9 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map