F433253

General Info

Members Datasets Scaffolds Average Seq Length
395 211 377 162

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10108598|Ga0307410_101085983
Length 181
Sequence MSSPSAAPDTPPLPTLSPAGERAITLAAVTGAHGVTGEVRLKLFGDGLEAFSAHRRFNDGALSLRKLRDDGKGGAIARFAEVTDRKAAEALRGTTLTVPRSALPALAEGEYYHADLIGLAAVSDAGDPLGTVTGVENYGAGDILEIERPDGKRFMVPMRPEAVPEWDAARVVIGADFAEAS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
3 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
4 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
5 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
6 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
7 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
8 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
9 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
10 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
11 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
12 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
13 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
14 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
15 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
16 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
17 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
18 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
19 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
133 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
134 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
142 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
145 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
192 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
202 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
205 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
206 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
207 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
210 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
211 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.44
Metatranscriptomes 0
Isolates 4.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.35
Nodule 0
Rhizoplane 8.35
Rhizosphere 75.44
Stem 0
Stem Tuber 0
Unclassified 7.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_57490 2162886007 Bacteria 3254
2 JGI24736J21556_1010009 3300001904 Bacteria 1555
3 JGI24737J22298_10062236 3300001990 Bacteria 1122
4 JGI24738J21930_10041054 3300002075 Bacteria 940
5 Ga0065704_10071553 3300005289 Bacteria 10732
6 Ga0065704_10284504 3300005289 Bacteria 916
7 Ga0070658_10000124 3300005327 Bacteria 68224
8 Ga0070658_10716863 3300005327 Bacteria 868
9 Ga0070683_100670576 3300005329 Bacteria 993
10 Ga0070670_100086111 3300005331 Bacteria 2700
11 Ga0070666_10112726 3300005335 Bacteria 1881
12 Ga0070666_10534371 3300005335 Bacteria 852
13 Ga0070682_100201976 3300005337 Bacteria 1403
14 Ga0070660_101240902 3300005339 Bacteria 632
15 Ga0070689_100254042 3300005340 Bacteria 1451
16 Ga0070668_100000646 3300005347 Bacteria 23522
17 Ga0070668_100025040 3300005347 Bacteria 4522
18 Ga0070668_100096685 3300005347 Bacteria 2334
19 Ga0070668_100365424 3300005347 Bacteria 1225
20 Ga0070668_100435314 3300005347 Bacteria 1125
21 Ga0070669_100000433 3300005353 Bacteria 31979
22 Ga0070669_100001232 3300005353 Bacteria 18563
23 Ga0070669_100002282 3300005353 Bacteria 13908
24 Ga0070671_100004829 3300005355 Bacteria 10718
25 Ga0070671_100006311 3300005355 Bacteria 9455
26 Ga0070671_100006895 3300005355 Bacteria 9098
27 Ga0070673_101966211 3300005364 Bacteria 555
28 Ga0070659_100089040 3300005366 Bacteria 2472
29 Ga0070659_100859595 3300005366 Bacteria 791
30 Ga0070667_100001292 3300005367 Bacteria 22636
31 Ga0070667_100006451 3300005367 Bacteria 9750
32 Ga0070667_100074297 3300005367 Bacteria 2900
33 Ga0070667_100212580 3300005367 Bacteria 1719
34 Ga0070705_100058567 3300005440 Bacteria 2277
35 Ga0070663_100820014 3300005455 Bacteria 799
36 Ga0070662_100002280 3300005457 Bacteria 11772
37 Ga0070662_100415970 3300005457 Bacteria 1111
38 Ga0070685_10394268 3300005466 Bacteria 957
39 Ga0070684_100777157 3300005535 Bacteria 895
40 Ga0070684_101127663 3300005535 Bacteria 737
41 Ga0068853_100067345 3300005539 Bacteria 3111
42 Ga0070665_100005435 3300005548 Bacteria 13141
43 Ga0070665_100007081 3300005548 Bacteria 11395
44 Ga0070665_100115821 3300005548 Bacteria 2683
45 Ga0070665_100939639 3300005548 Bacteria 877
46 Ga0070665_101580217 3300005548 Bacteria 664
47 Ga0068855_100045413 3300005563 Bacteria 5196
48 Ga0068855_100358291 3300005563 Bacteria 1605
49 Ga0068855_100603233 3300005563 Bacteria 1184
50 Ga0070664_100419846 3300005564 Bacteria 1225
51 Ga0068857_100085157 3300005577 Bacteria 2825
52 Ga0068857_100710383 3300005577 Bacteria 955
53 Ga0068857_101145360 3300005577 Bacteria 752
54 Ga0068854_100001393 3300005578 Bacteria 14568
55 Ga0068854_100002938 3300005578 Bacteria 10571
56 Ga0068854_100211027 3300005578 Bacteria 1531
57 Ga0068856_100032338 3300005614 Bacteria 5121
58 Ga0068852_100032633 3300005616 Bacteria 4313
59 Ga0068852_100182067 3300005616 Bacteria 1977
60 Ga0068859_100011590 3300005617 Bacteria 8866
61 Ga0068859_100140485 3300005617 Bacteria 2488
62 Ga0068864_100026310 3300005618 Bacteria 4907
63 Ga0068864_100344550 3300005618 Bacteria 1405
64 Ga0068864_101378072 3300005618 Bacteria 707
65 Ga0068851_10056413 3300005834 Bacteria 2003
66 Ga0068851_10280480 3300005834 Bacteria 953
67 Ga0068863_100000196 3300005841 Bacteria 64527
68 Ga0068863_100004664 3300005841 Bacteria 13513
69 Ga0068863_100120089 3300005841 Bacteria 2505
70 Ga0068858_100022102 3300005842 Bacteria 5940
71 Ga0068858_100085442 3300005842 Bacteria 2935
72 Ga0068858_100384523 3300005842 Bacteria 1347
73 Ga0068860_100000008 3300005843 Bacteria 427367
74 Ga0068860_100021808 3300005843 Bacteria 6196
75 Ga0068860_100075749 3300005843 Bacteria 3200
76 Ga0068862_100007404 3300005844 Bacteria 9102
77 Ga0068862_100086611 3300005844 Bacteria 2723
78 Ga0068862_100465158 3300005844 Bacteria 1194
79 Ga0075363_100000079 3300006048 Bacteria 20652
80 Ga0075364_10004443 3300006051 Bacteria 8069
81 Ga0075432_10002238 3300006058 Bacteria 6435
82 Ga0075362_10000006 3300006177 Bacteria 123313
83 Ga0075362_10025842 3300006177 Bacteria 2504
84 Ga0075369_10015646 3300006186 Bacteria 3049
85 Ga0075369_10033518 3300006186 Bacteria 2177
86 Ga0075366_10000394 3300006195 Bacteria 20296
87 Ga0075366_10104379 3300006195 Bacteria 1703
88 Ga0097621_100234366 3300006237 Bacteria 1603
89 Ga0075370_10000005 3300006353 Bacteria 112202
90 Ga0075370_10032057 3300006353 Bacteria 2936
91 Ga0075370_10099883 3300006353 Bacteria 1679
92 Ga0075370_10793243 3300006353 Bacteria 577
93 Ga0097620_100011589 3300006931 Bacteria 8866
94 Ga0097620_100140482 3300006931 Bacteria 2488
95 Ga0097620_100390053 3300006931 Bacteria 1488
96 Ga0105251_10006570 3300009011 Bacteria 7376
97 Ga0105250_10040041 3300009092 Bacteria 1879
98 Ga0105240_10008624 3300009093 Bacteria 14565
99 Ga0105240_10417078 3300009093 Bacteria 1509
100 Ga0105247_10382176 3300009101 Bacteria 999
101 Ga0105247_10639156 3300009101 Bacteria 794
102 Ga0105243_10130091 3300009148 Bacteria 2134
103 Ga0105248_10016997 3300009177 Bacteria 8013
104 Ga0105248_10103991 3300009177 Bacteria 3201
105 Ga0105248_10116285 3300009177 Bacteria 3016
106 Ga0105248_10135518 3300009177 Bacteria 2778
107 Ga0105248_10822148 3300009177 Bacteria 1049
108 Ga0105238_10553939 3300009551 Bacteria 1154
109 Ga0105249_10190952 3300009553 Bacteria 1999
110 Ga0105249_10758020 3300009553 Bacteria 1033
111 Ga0105246_10001156 3300011119 Bacteria 15320
112 Ga0157373_10039459 3300013100 Bacteria 3381
113 Ga0157371_10085566 3300013102 Bacteria 2233
114 Ga0157371_10156945 3300013102 Bacteria 1624
115 Ga0157371_10217132 3300013102 Bacteria 1373
116 Ga0157369_10275541 3300013105 Bacteria 1752
117 Ga0157369_10362204 3300013105 Bacteria 1505
118 Ga0163162_10119689 3300013306 Bacteria 2736
119 Ga0157380_10028744 3300014326 Bacteria 4243
120 Ga0157380_10226439 3300014326 Bacteria 1676
121 Ga0157379_10230949 3300014968 Bacteria 1677
122 Ga0163161_10139416 3300017792 Bacteria 1835
123 Ga0207697_10196722 3300025315 Bacteria 886
124 Ga0207697_10218813 3300025315 Bacteria 840
125 Ga0207656_10200811 3300025321 Bacteria 963
126 Ga0207656_10245684 3300025321 Bacteria 876
127 Ga0207696_1002233 3300025711 Bacteria 9665
128 Ga0207713_1008197 3300025735 Bacteria 6046
129 Ga0207710_10175695 3300025900 Bacteria 1049
130 Ga0207710_10228707 3300025900 Bacteria 925
131 Ga0207680_10205030 3300025903 Bacteria 1346
132 Ga0207680_10484378 3300025903 Bacteria 880
133 Ga0207680_10596089 3300025903 Bacteria 790
134 Ga0207647_10019896 3300025904 Bacteria 4507
135 Ga0207705_10000009 3300025909 Bacteria 576128
136 Ga0207705_10922395 3300025909 Bacteria 676
137 Ga0207695_10294559 3300025913 Bacteria 1515
138 Ga0207695_10513093 3300025913 Bacteria 1080
139 Ga0207657_10031188 3300025919 Bacteria 4831
140 Ga0207681_10000153 3300025923 Bacteria 57579
141 Ga0207681_10000667 3300025923 Bacteria 22714
142 Ga0207681_10083718 3300025923 Bacteria 2259
143 Ga0207681_10085417 3300025923 Bacteria 2239
144 Ga0207681_11065670 3300025923 Bacteria 679
145 Ga0207694_10034937 3300025924 Bacteria 3854
146 Ga0207650_10072422 3300025925 Bacteria 2593
147 Ga0207650_10182576 3300025925 Bacteria 1673
148 Ga0207659_10322131 3300025926 Bacteria 1275
149 Ga0207644_10000060 3300025931 Bacteria 79209
150 Ga0207644_10003305 3300025931 Bacteria 10420
151 Ga0207644_10007312 3300025931 Bacteria 7187
152 Ga0207644_10473775 3300025931 Bacteria 1030
153 Ga0207690_10076062 3300025932 Bacteria 2330
154 Ga0207690_10083211 3300025932 Bacteria 2240
155 Ga0207706_10002879 3300025933 Bacteria 16670
156 Ga0207709_10106193 3300025935 Bacteria 1867
157 Ga0207711_10005404 3300025941 Bacteria 10801
158 Ga0207711_10072227 3300025941 Bacteria 2997
159 Ga0207711_10498981 3300025941 Bacteria 1134
160 Ga0207711_10535239 3300025941 Bacteria 1092
161 Ga0207667_10019288 3300025949 Bacteria 7618
162 Ga0207667_10298521 3300025949 Bacteria 1646
163 Ga0207667_10369900 3300025949 Bacteria 1461
164 Ga0207712_10124769 3300025961 Bacteria 1953
165 Ga0207668_10005460 3300025972 Bacteria 7486
166 Ga0207668_10036617 3300025972 Bacteria 3276
167 Ga0207668_10138780 3300025972 Bacteria 1866
168 Ga0207668_10291346 3300025972 Bacteria 1343
169 Ga0207668_11298302 3300025972 Bacteria 655
170 Ga0207640_10002190 3300025981 Bacteria 10505
171 Ga0207640_10005323 3300025981 Bacteria 7011
172 Ga0207640_10112906 3300025981 Bacteria 1930
173 Ga0207658_10002564 3300025986 Bacteria 13198
174 Ga0207658_10017870 3300025986 Bacteria 4887
175 Ga0207658_10134026 3300025986 Bacteria 1994
176 Ga0207658_10341035 3300025986 Bacteria 1302
177 Ga0207658_10840993 3300025986 Bacteria 834
178 Ga0207703_10023421 3300026035 Bacteria 4850
179 Ga0207703_10048176 3300026035 Bacteria 3439
180 Ga0207639_10034825 3300026041 Bacteria 3724
181 Ga0207639_10406137 3300026041 Bacteria 1228
182 Ga0207678_10353618 3300026067 Bacteria 1267
183 Ga0207702_10012943 3300026078 Bacteria 6942
184 Ga0207702_10684973 3300026078 Bacteria 1010
185 Ga0207702_11011793 3300026078 Bacteria 824
186 Ga0207641_10000102 3300026088 Bacteria 122366
187 Ga0207641_10002385 3300026088 Bacteria 17328
188 Ga0207641_10054884 3300026088 Bacteria 3383
189 Ga0207676_10454297 3300026095 Bacteria 1208
190 Ga0207676_10622537 3300026095 Bacteria 1039
191 Ga0207674_10105705 3300026116 Bacteria 2793
192 Ga0207674_10567450 3300026116 Bacteria 1096
193 Ga0207674_11132432 3300026116 Bacteria 752
194 Ga0207675_101526935 3300026118 Bacteria 688
195 Ga0207698_10000111 3300026142 Bacteria 50675
196 Ga0207698_10067981 3300026142 Bacteria 2812
197 Ga0207428_10043348 3300027907 Bacteria 3634
198 Ga0268266_10004773 3300028379 Bacteria 12886
199 Ga0268266_10086468 3300028379 Bacteria 2741
200 Ga0268266_11825713 3300028379 Bacteria 582
201 Ga0268265_10005043 3300028380 Bacteria 9063
202 Ga0268265_10024978 3300028380 Bacteria 4234
203 Ga0268265_10032844 3300028380 Bacteria 3766
204 Ga0268265_10208013 3300028380 Bacteria 1703
205 Ga0268265_12120805 3300028380 Bacteria 569
206 Ga0268264_10000018 3300028381 Bacteria 495324
207 Ga0268264_10051498 3300028381 Bacteria 3431
208 Ga0316177_1076818 3300030731 Bacteria 780
209 Ga0307408_100036697 3300031548 Bacteria 3447
210 Ga0307408_100081943 3300031548 Bacteria 2414
211 Ga0307408_100954959 3300031548 Bacteria 788
212 Ga0316579_10010352 3300031691 Bacteria 3942
213 Ga0307405_10128796 3300031731 Bacteria 1745
214 Ga0307413_10003180 3300031824 Bacteria 6865
215 Ga0307413_10066747 3300031824 Bacteria 2246
216 Ga0307413_10138381 3300031824 Bacteria 1678
217 Ga0307413_10492835 3300031824 Bacteria 982
218 Ga0307410_10042442 3300031852 Bacteria 3006
219 Ga0307410_10096570 3300031852 Bacteria 2109
220 Ga0307410_10108598 3300031852 Bacteria 2004
221 Ga0307410_11497643 3300031852 Bacteria 594
222 Ga0307406_10019279 3300031901 Bacteria 4001
223 Ga0307406_10092554 3300031901 Bacteria 2039
224 Ga0307406_10135400 3300031901 Bacteria 1736
225 Ga0307406_10211979 3300031901 Bacteria 1434
226 Ga0307406_10611331 3300031901 Bacteria 900
227 Ga0307406_10806343 3300031901 Bacteria 793
228 Ga0307407_10071987 3300031903 Bacteria 2060
229 Ga0307407_10296099 3300031903 Bacteria 1126
230 Ga0307407_10803167 3300031903 Bacteria 716
231 Ga0307407_11243852 3300031903 Bacteria 583
232 Ga0307412_10001519 3300031911 Bacteria 12833
233 Ga0307412_10124258 3300031911 Bacteria 1863
234 Ga0307412_10330538 3300031911 Bacteria 1216
235 Ga0307412_10573656 3300031911 Bacteria 951
236 Ga0307412_11069640 3300031911 Bacteria 716
237 Ga0307412_11701311 3300031911 Bacteria 578
238 Ga0307409_100014846 3300031995 Bacteria 5085
239 Ga0307416_100033104 3300032002 Bacteria 3914
240 Ga0307416_100177602 3300032002 Bacteria 1992
241 Ga0307416_100561971 3300032002 Bacteria 1216
242 Ga0307416_100749586 3300032002 Bacteria 1069
243 Ga0307416_101167812 3300032002 Bacteria 875
244 Ga0307416_101935467 3300032002 Bacteria 693
245 Ga0307414_10002133 3300032004 Bacteria 10327
246 Ga0307414_10038008 3300032004 Bacteria 3228
247 Ga0307414_10048037 3300032004 Bacteria 2941
248 Ga0307414_10268452 3300032004 Bacteria 1427
249 Ga0307414_10532033 3300032004 Bacteria 1045
250 Ga0307414_11149783 3300032004 Bacteria 718
251 Ga0307411_10015317 3300032005 Bacteria 4302
252 Ga0307411_10064076 3300032005 Bacteria 2459
253 Ga0307411_10297116 3300032005 Bacteria 1293
254 Ga0307415_100321935 3300032126 Bacteria 1290
255 Ga0307415_100356510 3300032126 Bacteria 1233
256 Ga0307415_101346963 3300032126 Bacteria 678
257 Ga0316583_10010481 3300032133 Bacteria 3343
258 Ga0373929_0035845 3300035085 Bacteria 1082
259 Ga0373951_0127336 3300035091 Bacteria 698
260 Ga0373932_0117109 3300035112 Bacteria 885
261 Ga0373939_0253201 3300035114 Bacteria 686
262 Ga0373960_0037886 3300035121 Bacteria 1380
263 Ga0316582_0000241 3300036647 Bacteria 18135
264 Ga0316584_0074925 3300036712 Bacteria 2537
265 Ga0436365_1360338 3300039437 Bacteria 2402
266 Ga0439461_0212843 3300041410 Bacteria 524
267 Ga0451849_1410363 3300041505 Bacteria 787
268 Ga0439445_0230820 3300042004 Bacteria 551
269 Ga0450912_001978 3300042116 Bacteria 1327
270 Ga0450923_098071 3300042125 Bacteria 674
271 Ga0451577_0385908 3300042876 Bacteria 1271
272 Ga0451576_0023602 3300045051 Bacteria 6658
273 Ga0495632_0000007 3300046519 Bacteria 343246
274 Ga0495637_0001086 3300046520 Bacteria 16822
275 Ga0495643_0000304 3300046522 Bacteria 68483
276 Ga0495643_0064904 3300046522 Bacteria 1928
277 Ga0495663_0000005 3300046525 Bacteria 342265
278 Ga0495654_0357556 3300046530 Bacteria 586
279 Ga0495598_0001651 3300046537 Bacteria 4481
280 Ga0495598_0054782 3300046537 Bacteria 1212
281 Ga0495621_0076721 3300046539 Bacteria 1240
282 Ga0495622_0012188 3300046557 Bacteria 3977
283 Ga0495633_0000447 3300046558 Bacteria 42625
284 Ga0495633_0000491 3300046558 Bacteria 39973
285 Ga0495633_0012643 3300046558 Bacteria 4480
286 Ga0495633_0263648 3300046558 Bacteria 785
287 Ga0495625_0338299 3300046660 Bacteria 954
288 Ga0495625_0797317 3300046660 Bacteria 549
289 Ga0495661_0026370 3300046665 Bacteria 3744
290 Ga0495671_0000126 3300046692 Bacteria 68483
291 Ga0495671_0004841 3300046692 Bacteria 7960
292 Ga0495681_0007530 3300047470 Bacteria 6938
293 Ga0495615_0241106 3300048090 Bacteria 570
294 Ga0496100_0073864 3300048903 Bacteria 2283
295 Ga0496100_0992154 3300048903 Bacteria 661
296 Ga0496101_0001612 3300048904 Bacteria 13571
297 Ga0496101_0124348 3300048904 Bacteria 1953
298 Ga0496102_0000106 3300048905 Bacteria 118841
299 Ga0496102_0610414 3300048905 Bacteria 1014
300 Ga0496102_0651905 3300048905 Bacteria 976
301 Ga0496103_0000095 3300048906 Bacteria 98260
302 Ga0496103_0026875 3300048906 Bacteria 3483
303 Ga0496103_0504669 3300048906 Bacteria 774
304 Ga0496103_0629715 3300048906 Bacteria 682
305 Ga0496104_0000060 3300048907 Bacteria 117966
306 Ga0496104_0132698 3300048907 Bacteria 2392
307 Ga0496104_0681267 3300048907 Bacteria 936
308 Ga0496105_0000274 3300048908 Bacteria 34048
309 Ga0496105_0011723 3300048908 Bacteria 6937
310 Ga0496105_0252429 3300048908 Bacteria 1428
311 Ga0496106_0000338 3300048909 Bacteria 32910
312 Ga0496106_0129532 3300048909 Bacteria 1978
313 Ga0496107_0002397 3300048910 Bacteria 12134
314 Ga0496107_0044020 3300048910 Bacteria 3209
315 Ga0496108_0219071 3300048911 Bacteria 1653
316 Ga0496109_1251075 3300048912 Bacteria 678
317 Ga0496110_0453598 3300048913 Bacteria 1168
318 Ga0496110_1087834 3300048913 Bacteria 707
319 Ga0496111_0423480 3300048914 Bacteria 983
320 Ga0496111_0584446 3300048914 Bacteria 818
321 Ga0496112_0092192 3300048915 Bacteria 2999
322 Ga0496112_0479489 3300048915 Bacteria 1180
323 Ga0496113_0048133 3300048916 Bacteria 3171
324 Ga0496114_0030111 3300048917 Bacteria 4464
325 Ga0496114_0271847 3300048917 Bacteria 1493
326 Ga0496115_0242992 3300048918 Bacteria 1484
327 Ga0496116_0053648 3300048919 Bacteria 2661
328 Ga0496117_0000366 3300048920 Bacteria 78816
329 Ga0496117_0098702 3300048920 Bacteria 1856
330 Ga0496118_0016076 3300048921 Bacteria 6885
331 Ga0496118_0025062 3300048921 Bacteria 5129
332 Ga0496118_0069711 3300048921 Bacteria 2544
333 Ga0496118_0330165 3300048921 Bacteria 823
334 Ga0496119_0001213 3300048922 Bacteria 32201
335 Ga0496119_0295222 3300048922 Bacteria 801
336 Ga0496120_0001109 3300048923 Bacteria 35064
337 Ga0496121_0002478 3300048924 Bacteria 28115
338 Ga0496121_0002522 3300048924 Bacteria 27770
339 Ga0496121_0006338 3300048924 Bacteria 14748
340 Ga0496122_0013226 3300048925 Bacteria 8095
341 Ga0496122_0122826 3300048925 Bacteria 1670
342 Ga0496124_0001019 3300048927 Bacteria 44416
343 Ga0496124_0059376 3300048927 Bacteria 3213
344 Ga0496124_0406904 3300048927 Bacteria 942
345 Ga0496126_0000294 3300048929 Bacteria 106327
346 Ga0496126_0005782 3300048929 Bacteria 13983
347 Ga0501034_0102239 3300049571 Bacteria 2859
348 Ga0501034_0325492 3300049571 Bacteria 1469
349 Ga0501034_1246698 3300049571 Bacteria 621
350 Ga0501037_0418637 3300049573 Bacteria 917
351 Ga0501039_0359517 3300049575 Bacteria 1144
352 Ga0501047_0100271 3300049581 Bacteria 2775
353 Ga0501223_000230 3300049663 Bacteria 14369
354 Ga0501225_0000080 3300049705 Bacteria 30728
355 Ga0501035_0333501 3300049822 Bacteria 1272
356 Ga0501044_0280404 3300049823 Bacteria 1600
357 nmdc:mga03683_11283_c1 3300050489 Bacteria 3230
358 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
359 nmdc:mga03n38_8177_c1 3300050490 Bacteria 3741
360 nmdc:mga00v17_1761_c1 3300050491 Bacteria 11247
361 nmdc:mga0k408_130208_c1 3300050493 Bacteria 1493
362 nmdc:mga0k408_20_c1 3300050493 Bacteria 109563
363 nmdc:mga07m45_188783_c1 3300050496 Bacteria 1198
364 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
365 nmdc:mga07m45_22277_c1 3300050496 Bacteria 3457
366 nmdc:mga0sz30_19232_c2 3300050516 Bacteria 1912
367 nmdc:mga0sz30_2385_c2 3300050516 Bacteria 2090
368 Ga0500643_000001 3300053087 Bacteria 1440111
369 Ga0500647_0121998 3300053091 Bacteria 1233
370 Ga0500641_0094126 3300053096 Bacteria 1281
371 Ga0500594_0069685 3300053118 Bacteria 1031
372 Ga0500618_000868 3300053125 Bacteria 16150
373 Ga0500588_0041064 3300053146 Bacteria 1394
374 Ga0500590_051364 3300053148 Bacteria 2094
375 Ga0500616_0152784 3300053153 Bacteria 1067
376 Ga0500624_037254 3300053157 Bacteria 861
377 Ga0500633_0246403 3300053160 Bacteria 664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100067345 Ga0068853_1000673453 133
2 3300025932 Ga0207690_10076062 Ga0207690_100760622 133
3 3300026041 Ga0207639_10034825 Ga0207639_100348253 133
4 3300046660 Ga0495625_0797317 Ga0495625_0797317_76_516 141
5 3300048924 Ga0496121_0002522 Ga0496121_0002522_20706_21188 141
6 3300002075 JGI24738J21930_10041054 JGI24738J21930_100410542 143
7 3300005457 Ga0070662_100002280 Ga0070662_1000022806 143
8 3300006237 Ga0097621_100234366 Ga0097621_1002343662 143
9 3300011119 Ga0105246_10001156 Ga0105246_100011563 143
10 3300013100 Ga0157373_10039459 Ga0157373_100394593 143
11 3300025926 Ga0207659_10322131 Ga0207659_103221313 143
12 3300025933 Ga0207706_10002879 Ga0207706_1000287912 143
13 3300025949 Ga0207667_10369900 Ga0207667_103699001 143
14 3300026041 Ga0207639_10406137 Ga0207639_104061372 143
15 3300053148 Ga0500590_051364 Ga0500590_051364_239_706 143
16 3300041410 Ga0439461_0212843 Ga0439461_0212843_29_469 145
17 3300042116 Ga0450912_001978 Ga0450912_001978_11_451 145
18 3300046539 Ga0495621_0076721 Ga0495621_0076721_163_603 145
19 3300048090 Ga0495615_0241106 Ga0495615_0241106_32_472 145
20 3300031691 Ga0316579_10010352 Ga0316579_100103525 147
21 3300036647 Ga0316582_0000241 Ga0316582_0000241_14140_14682 147
22 3300005844 Ga0068862_100007404 Ga0068862_1000074048 151
23 3300028380 Ga0268265_10005043 Ga0268265_1000504313 151
24 3300005335 Ga0070666_10534371 Ga0070666_105343712 153
25 3300005347 Ga0070668_100025040 Ga0070668_1000250402 153
26 3300005353 Ga0070669_100002282 Ga0070669_10000228218 153
27 3300005355 Ga0070671_100004829 Ga0070671_1000048298 153
28 3300005367 Ga0070667_100212580 Ga0070667_1002125803 153
29 3300005841 Ga0068863_100004664 Ga0068863_10000466413 153
30 3300005843 Ga0068860_100075749 Ga0068860_1000757494 153
31 3300005844 Ga0068862_100465158 Ga0068862_1004651582 153
32 3300009011 Ga0105251_10006570 Ga0105251_100065706 153
33 3300009101 Ga0105247_10382176 Ga0105247_103821762 153
34 3300009177 Ga0105248_10016997 Ga0105248_100169974 153
35 3300025315 Ga0207697_10218813 Ga0207697_102188132 153
36 3300025735 Ga0207713_1008197 Ga0207713_10081974 153
37 3300025900 Ga0207710_10175695 Ga0207710_101756953 153
38 3300025903 Ga0207680_10484378 Ga0207680_104843781 153
39 3300025923 Ga0207681_10000667 Ga0207681_1000066718 153
40 3300025931 Ga0207644_10007312 Ga0207644_100073123 153
41 3300025941 Ga0207711_10072227 Ga0207711_100722273 153
42 3300025972 Ga0207668_10036617 Ga0207668_100366173 153
43 3300025986 Ga0207658_10134026 Ga0207658_101340264 153
44 3300026088 Ga0207641_10002385 Ga0207641_1000238516 153
45 3300028380 Ga0268265_10032844 Ga0268265_100328443 153
46 3300035085 Ga0373929_0035845 Ga0373929_0035845_243_707 153
47 3300035112 Ga0373932_0117109 Ga0373932_0117109_395_859 153
48 3300048903 Ga0496100_0992154 Ga0496100_0992154_92_601 153
49 3300048906 Ga0496103_0026875 Ga0496103_0026875_1119_1628 153
50 3300048919 Ga0496116_0053648 Ga0496116_0053648_1758_2267 153
51 3300048921 Ga0496118_0069711 Ga0496118_0069711_568_1077 153
52 3300048922 Ga0496119_0295222 Ga0496119_0295222_25_534 153
53 3300048924 Ga0496121_0006338 Ga0496121_0006338_6930_7439 153
54 3300048925 Ga0496122_0122826 Ga0496122_0122826_658_1167 153
55 3300048927 Ga0496124_0059376 Ga0496124_0059376_371_880 153
56 3300048927 Ga0496124_0406904 Ga0496124_0406904_253_762 153
57 iso_pu_bacteria 2775507255 2778123418 153
58 iso_pu_bacteria 2808606401 2809064958 153
59 iso_pu_bacteria 2808606404 2809080876 153
60 iso_pu_bacteria 2808606405 2809085290 153
61 iso_pu_bacteria 2880518877 2880522024 153
62 iso_pu_bacteria 2919709256 2919712126 153
63 3300005367 Ga0070667_100006451 Ga0070667_1000064516 154
64 3300005548 Ga0070665_100005435 Ga0070665_10000543513 154
65 3300005842 Ga0068858_100022102 Ga0068858_1000221023 154
66 3300005843 Ga0068860_100000008 Ga0068860_100000008151 154
67 3300025986 Ga0207658_10017870 Ga0207658_100178705 154
68 3300026035 Ga0207703_10048176 Ga0207703_100481763 154
69 3300028379 Ga0268266_10004773 Ga0268266_1000477313 154
70 3300028381 Ga0268264_10000018 Ga0268264_10000018381 154
71 3300035091 Ga0373951_0127336 Ga0373951_0127336_54_518 154
72 3300035114 Ga0373939_0253201 Ga0373939_0253201_28_492 154
73 3300039437 Ga0436365_1360338 Ga0436365_1360338_39_506 154
74 3300031901 Ga0307406_10611331 Ga0307406_106113311 156
75 iso_pu_bacteria 2895880812 2895885937 156
76 3300001904 JGI24736J21556_1010009 JGI24736J21556_10100093 157
77 3300001990 JGI24737J22298_10062236 JGI24737J22298_100622363 157
78 3300005327 Ga0070658_10716863 Ga0070658_107168632 157
79 3300005366 Ga0070659_100089040 Ga0070659_1000890401 157
80 3300005457 Ga0070662_100415970 Ga0070662_1004159702 157
81 3300005563 Ga0068855_100358291 Ga0068855_1003582912 157
82 3300005577 Ga0068857_100710383 Ga0068857_1007103832 157
83 3300005578 Ga0068854_100211027 Ga0068854_1002110272 157
84 3300005834 Ga0068851_10056413 Ga0068851_100564132 157
85 3300009093 Ga0105240_10417078 Ga0105240_104170782 157
86 3300009551 Ga0105238_10553939 Ga0105238_105539392 157
87 3300013102 Ga0157371_10217132 Ga0157371_102171322 157
88 3300013105 Ga0157369_10362204 Ga0157369_103622043 157
89 3300025321 Ga0207656_10245684 Ga0207656_102456842 157
90 3300025909 Ga0207705_10922395 Ga0207705_109223951 157
91 3300025913 Ga0207695_10294559 Ga0207695_102945593 157
92 3300025919 Ga0207657_10031188 Ga0207657_100311884 157
93 3300025924 Ga0207694_10034937 Ga0207694_100349372 157
94 3300025932 Ga0207690_10083211 Ga0207690_100832111 157
95 3300025981 Ga0207640_10112906 Ga0207640_101129063 157
96 3300026116 Ga0207674_10567450 Ga0207674_105674502 157
97 3300041505 Ga0451849_1410363 Ga0451849_1410363_217_750 157
98 3300046519 Ga0495632_0000007 Ga0495632_0000007_297925_298419 157
99 3300046520 Ga0495637_0001086 Ga0495637_0001086_2352_2846 157
100 3300046522 Ga0495643_0000304 Ga0495643_0000304_23492_23986 157
101 3300046525 Ga0495663_0000005 Ga0495663_0000005_296944_297438 157
102 3300046558 Ga0495633_0000447 Ga0495633_0000447_25709_26203 157
103 3300046558 Ga0495633_0000491 Ga0495633_0000491_1927_2421 157
104 3300046558 Ga0495633_0012643 Ga0495633_0012643_2037_2531 157
105 3300046660 Ga0495625_0338299 Ga0495625_0338299_365_859 157
106 3300046665 Ga0495661_0026370 Ga0495661_0026370_2143_2712 157
107 3300046692 Ga0495671_0000126 Ga0495671_0000126_44498_44992 157
108 3300047470 Ga0495681_0007530 Ga0495681_0007530_5660_6154 157
109 3300048905 Ga0496102_0651905 Ga0496102_0651905_322_831 157
110 3300049663 Ga0501223_000230 Ga0501223_000230_1746_2240 157
111 3300049705 Ga0501225_0000080 Ga0501225_0000080_12249_12743 157
112 3300053091 Ga0500647_0121998 Ga0500647_0121998_140_634 157
113 3300053160 Ga0500633_0246403 Ga0500633_0246403_12_506 157
114 3300006353 Ga0075370_10032057 Ga0075370_100320572 158
115 3300006931 Ga0097620_100390053 Ga0097620_1003900533 158
116 3300009148 Ga0105243_10130091 Ga0105243_101300913 158
117 3300009177 Ga0105248_10135518 Ga0105248_101355182 158
118 3300014968 Ga0157379_10230949 Ga0157379_102309491 158
119 3300025935 Ga0207709_10106193 Ga0207709_101061933 158
120 3300025941 Ga0207711_10005404 Ga0207711_100054042 158
121 3300031731 Ga0307405_10128796 Ga0307405_101287963 158
122 3300031911 Ga0307412_10001519 Ga0307412_1000151910 158
123 3300032004 Ga0307414_10002133 Ga0307414_100021333 158
124 3300032005 Ga0307411_10015317 Ga0307411_100153176 158
125 3300046530 Ga0495654_0357556 Ga0495654_0357556_50_532 158
126 3300046557 Ga0495622_0012188 Ga0495622_0012188_1699_2181 158
127 3300046558 Ga0495633_0263648 Ga0495633_0263648_45_527 158
128 3300046692 Ga0495671_0004841 Ga0495671_0004841_5012_5494 158
129 3300050496 nmdc:mga07m45_22277_c1 nmdc:mga07m45_22277_c1_2708_3205 158
130 3300053118 Ga0500594_0069685 Ga0500594_0069685_539_1021 158
131 3300053157 Ga0500624_037254 Ga0500624_037254_350_832 158
132 iso_pu_bacteria 2643221588 2643948998 158
133 iso_pu_bacteria 2738541275 2738712560 158
134 iso_pu_bacteria 2738541301 2738850984 158
135 iso_pu_bacteria 2738541304 2738866714 158
136 iso_pu_bacteria 2738543022 2739299231 158
137 iso_pu_bacteria 2738543033 2739360910 158
138 iso_pu_bacteria 2896253425 2896255482 158
139 iso_pu_bacteria 2928100450 2928103868 158
140 iso_pu_bacteria 2928959182 2928961797 158
141 3300005364 Ga0070673_101966211 Ga0070673_1019662111 159
142 3300005366 Ga0070659_100859595 Ga0070659_1008595952 159
143 3300031548 Ga0307408_100081943 Ga0307408_1000819433 159
144 3300031824 Ga0307413_10138381 Ga0307413_101383812 159
145 3300031852 Ga0307410_10096570 Ga0307410_100965702 159
146 3300031903 Ga0307407_10296099 Ga0307407_102960992 159
147 3300031911 Ga0307412_11069640 Ga0307412_110696401 159
148 3300032005 Ga0307411_10064076 Ga0307411_100640764 159
149 3300045051 Ga0451576_0023602 Ga0451576_0023602_4885_5370 159
150 3300005335 Ga0070666_10112726 Ga0070666_101127262 160
151 3300005340 Ga0070689_100254042 Ga0070689_1002540423 160
152 3300005347 Ga0070668_100096685 Ga0070668_1000966854 160
153 3300005353 Ga0070669_100000433 Ga0070669_1000004335 160
154 3300005355 Ga0070671_100006311 Ga0070671_1000063112 160
155 3300005367 Ga0070667_100074297 Ga0070667_1000742973 160
156 3300005466 Ga0070685_10394268 Ga0070685_103942682 160
157 3300005548 Ga0070665_100007081 Ga0070665_10000708113 160
158 3300005563 Ga0068855_100603233 Ga0068855_1006032332 160
159 3300005617 Ga0068859_100140485 Ga0068859_1001404853 160
160 3300005618 Ga0068864_100026310 Ga0068864_1000263104 160
161 3300005841 Ga0068863_100120089 Ga0068863_1001200894 160
162 3300005842 Ga0068858_100085442 Ga0068858_1000854424 160
163 3300005843 Ga0068860_100021808 Ga0068860_1000218087 160
164 3300005844 Ga0068862_100086611 Ga0068862_1000866112 160
165 3300006058 Ga0075432_10002238 Ga0075432_100022384 160
166 3300006353 Ga0075370_10099883 Ga0075370_100998832 160
167 3300006931 Ga0097620_100140482 Ga0097620_1001404822 160
168 3300009101 Ga0105247_10639156 Ga0105247_106391561 160
169 3300013306 Ga0163162_10119689 Ga0163162_101196893 160
170 3300025315 Ga0207697_10196722 Ga0207697_101967222 160
171 3300025903 Ga0207680_10596089 Ga0207680_105960892 160
172 3300025923 Ga0207681_10000153 Ga0207681_1000015328 160
173 3300025931 Ga0207644_10000060 Ga0207644_1000006045 160
174 3300025949 Ga0207667_10019288 Ga0207667_100192883 160
175 3300025949 Ga0207667_10298521 Ga0207667_102985212 160
176 3300025972 Ga0207668_10291346 Ga0207668_102913462 160
177 3300025986 Ga0207658_10840993 Ga0207658_108409932 160
178 3300026078 Ga0207702_10684973 Ga0207702_106849732 160
179 3300026078 Ga0207702_11011793 Ga0207702_110117932 160
180 3300026088 Ga0207641_10054884 Ga0207641_100548841 160
181 3300027907 Ga0207428_10043348 Ga0207428_100433483 160
182 3300028379 Ga0268266_11825713 Ga0268266_118257131 160
183 3300028380 Ga0268265_10208013 Ga0268265_102080132 160
184 3300028380 Ga0268265_12120805 Ga0268265_121208051 160
185 3300031903 Ga0307407_10803167 Ga0307407_108031672 160
186 3300032004 Ga0307414_11149783 Ga0307414_111497831 160
187 3300032126 Ga0307415_101346963 Ga0307415_1013469631 160
188 3300042876 Ga0451577_0385908 Ga0451577_0385908_106_600 160
189 3300046537 Ga0495598_0054782 Ga0495598_0054782_632_1120 160
190 3300048904 Ga0496101_0124348 Ga0496101_0124348_227_712 160
191 3300048906 Ga0496103_0504669 Ga0496103_0504669_234_719 160
192 3300048907 Ga0496104_0132698 Ga0496104_0132698_1331_1816 160
193 3300048908 Ga0496105_0252429 Ga0496105_0252429_824_1309 160
194 3300048909 Ga0496106_0000338 Ga0496106_0000338_25486_25971 160
195 3300048910 Ga0496107_0002397 Ga0496107_0002397_2886_3371 160
196 3300048911 Ga0496108_0219071 Ga0496108_0219071_195_680 160
197 3300048912 Ga0496109_1251075 Ga0496109_1251075_92_577 160
198 3300048913 Ga0496110_0453598 Ga0496110_0453598_210_695 160
199 3300048915 Ga0496112_0479489 Ga0496112_0479489_572_1057 160
200 3300048918 Ga0496115_0242992 Ga0496115_0242992_169_654 160
201 3300050496 nmdc:mga07m45_188783_c1 nmdc:mga07m45_188783_c1_657_1142 160
202 iso_pu_bacteria 3000865235 3000865758 160
203 3300005289 Ga0065704_10284504 Ga0065704_102845042 161
204 3300005327 Ga0070658_10000124 Ga0070658_1000012430 161
205 3300005331 Ga0070670_100086111 Ga0070670_1000861115 161
206 3300005339 Ga0070660_101240902 Ga0070660_1012409021 161
207 3300005347 Ga0070668_100365424 Ga0070668_1003654242 161
208 3300005347 Ga0070668_100435314 Ga0070668_1004353142 161
209 3300005440 Ga0070705_100058567 Ga0070705_1000585672 161
210 3300005535 Ga0070684_101127663 Ga0070684_1011276632 161
211 3300005548 Ga0070665_101580217 Ga0070665_1015802171 161
212 3300005563 Ga0068855_100045413 Ga0068855_1000454138 161
213 3300005577 Ga0068857_100085157 Ga0068857_1000851572 161
214 3300005577 Ga0068857_101145360 Ga0068857_1011453602 161
215 3300005578 Ga0068854_100001393 Ga0068854_10000139312 161
216 3300005578 Ga0068854_100002938 Ga0068854_1000029386 161
217 3300005614 Ga0068856_100032338 Ga0068856_1000323386 161
218 3300005616 Ga0068852_100032633 Ga0068852_1000326333 161
219 3300005616 Ga0068852_100182067 Ga0068852_1001820672 161
220 3300005617 Ga0068859_100011590 Ga0068859_1000115905 161
221 3300005618 Ga0068864_100344550 Ga0068864_1003445502 161
222 3300005618 Ga0068864_101378072 Ga0068864_1013780722 161
223 3300005834 Ga0068851_10280480 Ga0068851_102804801 161
224 3300005841 Ga0068863_100000196 Ga0068863_10000019659 161
225 3300005842 Ga0068858_100384523 Ga0068858_1003845232 161
226 3300006051 Ga0075364_10004443 Ga0075364_1000444311 161
227 3300006177 Ga0075362_10025842 Ga0075362_100258425 161
228 3300006186 Ga0075369_10015646 Ga0075369_100156462 161
229 3300006353 Ga0075370_10000005 Ga0075370_1000000563 161
230 3300006931 Ga0097620_100011589 Ga0097620_1000115895 161
231 3300009093 Ga0105240_10008624 Ga0105240_1000862419 161
232 3300009177 Ga0105248_10103991 Ga0105248_101039913 161
233 3300009177 Ga0105248_10822148 Ga0105248_108221482 161
234 3300009553 Ga0105249_10758020 Ga0105249_107580202 161
235 3300014326 Ga0157380_10028744 Ga0157380_100287446 161
236 3300014326 Ga0157380_10226439 Ga0157380_102264392 161
237 3300025321 Ga0207656_10200811 Ga0207656_102008111 161
238 3300025900 Ga0207710_10228707 Ga0207710_102287072 161
239 3300025903 Ga0207680_10205030 Ga0207680_102050302 161
240 3300025904 Ga0207647_10019896 Ga0207647_100198968 161
241 3300025909 Ga0207705_10000009 Ga0207705_10000009517 161
242 3300025913 Ga0207695_10513093 Ga0207695_105130932 161
243 3300025923 Ga0207681_10083718 Ga0207681_100837182 161
244 3300025925 Ga0207650_10182576 Ga0207650_101825763 161
245 3300025931 Ga0207644_10473775 Ga0207644_104737752 161
246 3300025941 Ga0207711_10498981 Ga0207711_104989812 161
247 3300025941 Ga0207711_10535239 Ga0207711_105352392 161
248 3300025972 Ga0207668_10138780 Ga0207668_101387802 161
249 3300025972 Ga0207668_11298302 Ga0207668_112983022 161
250 3300025981 Ga0207640_10002190 Ga0207640_100021904 161
251 3300025981 Ga0207640_10005323 Ga0207640_100053239 161
252 3300025986 Ga0207658_10341035 Ga0207658_103410352 161
253 3300026035 Ga0207703_10023421 Ga0207703_100234216 161
254 3300026078 Ga0207702_10012943 Ga0207702_100129439 161
255 3300026088 Ga0207641_10000102 Ga0207641_10000102119 161
256 3300026095 Ga0207676_10454297 Ga0207676_104542972 161
257 3300026095 Ga0207676_10622537 Ga0207676_106225372 161
258 3300026116 Ga0207674_10105705 Ga0207674_101057054 161
259 3300026116 Ga0207674_11132432 Ga0207674_111324322 161
260 3300026118 Ga0207675_101526935 Ga0207675_1015269352 161
261 3300026142 Ga0207698_10000111 Ga0207698_1000011114 161
262 3300026142 Ga0207698_10067981 Ga0207698_100679813 161
263 3300030731 Ga0316177_1076818 Ga0316177_10768181 161
264 3300031548 Ga0307408_100036697 Ga0307408_1000366973 161
265 3300031824 Ga0307413_10003180 Ga0307413_100031804 161
266 3300031852 Ga0307410_10042442 Ga0307410_100424423 161
267 3300031901 Ga0307406_10019279 Ga0307406_100192793 161
268 3300031903 Ga0307407_10071987 Ga0307407_100719872 161
269 3300031911 Ga0307412_10124258 Ga0307412_101242583 161
270 3300031995 Ga0307409_100014846 Ga0307409_1000148462 161
271 3300032002 Ga0307416_100033104 Ga0307416_1000331045 161
272 3300032002 Ga0307416_100561971 Ga0307416_1005619712 161
273 3300032002 Ga0307416_100749586 Ga0307416_1007495862 161
274 3300032005 Ga0307411_10297116 Ga0307411_102971162 161
275 3300032126 Ga0307415_100356510 Ga0307415_1003565102 161
276 3300048905 Ga0496102_0610414 Ga0496102_0610414_139_633 161
277 3300048906 Ga0496103_0629715 Ga0496103_0629715_43_546 161
278 3300048907 Ga0496104_0681267 Ga0496104_0681267_282_785 161
279 3300048913 Ga0496110_1087834 Ga0496110_1087834_189_695 161
280 3300048914 Ga0496111_0423480 Ga0496111_0423480_419_925 161
281 3300048917 Ga0496114_0030111 Ga0496114_0030111_2371_2877 161
282 3300048917 Ga0496114_0271847 Ga0496114_0271847_236_739 161
283 3300048920 Ga0496117_0098702 Ga0496117_0098702_1121_1633 161
284 3300048921 Ga0496118_0025062 Ga0496118_0025062_3410_3904 161
285 3300048921 Ga0496118_0330165 Ga0496118_0330165_26_520 161
286 3300048924 Ga0496121_0002478 Ga0496121_0002478_23094_23588 161
287 3300048929 Ga0496126_0005782 Ga0496126_0005782_5170_5676 161
288 3300050489 nmdc:mga03683_11283_c1 nmdc:mga03683_11283_c1_71_574 161
289 3300050491 nmdc:mga00v17_1761_c1 nmdc:mga00v17_1761_c1_709_1212 161
290 3300050496 nmdc:mga07m45_1_c1 nmdc:mga07m45_1_c1_355988_356491 161
291 3300050516 nmdc:mga0sz30_19232_c2 nmdc:mga0sz30_19232_c2_1163_1666 161
292 3300053125 Ga0500618_000868 Ga0500618_000868_8670_9173 161
293 iso_pu_bacteria 8054302542 8054302963 161
294 2162886007 SwRhRL2b_contig_57490 SwRhRL2b_0562.00004850 162
295 3300005289 Ga0065704_10071553 Ga0065704_100715536 162
296 3300005329 Ga0070683_100670576 Ga0070683_1006705762 162
297 3300005337 Ga0070682_100201976 Ga0070682_1002019762 162
298 3300005347 Ga0070668_100000646 Ga0070668_10000064618 162
299 3300005353 Ga0070669_100001232 Ga0070669_1000012323 162
300 3300005355 Ga0070671_100006895 Ga0070671_10000689511 162
301 3300005367 Ga0070667_100001292 Ga0070667_10000129214 162
302 3300005455 Ga0070663_100820014 Ga0070663_1008200142 162
303 3300005535 Ga0070684_100777157 Ga0070684_1007771571 162
304 3300005548 Ga0070665_100115821 Ga0070665_1001158213 162
305 3300005548 Ga0070665_100939639 Ga0070665_1009396391 162
306 3300005564 Ga0070664_100419846 Ga0070664_1004198462 162
307 3300006048 Ga0075363_100000079 Ga0075363_10000007915 162
308 3300006177 Ga0075362_10000006 Ga0075362_1000000651 162
309 3300006186 Ga0075369_10033518 Ga0075369_100335184 162
310 3300006195 Ga0075366_10000394 Ga0075366_100003945 162
311 3300006195 Ga0075366_10104379 Ga0075366_101043792 162
312 3300006353 Ga0075370_10793243 Ga0075370_107932431 162
313 3300009092 Ga0105250_10040041 Ga0105250_100400412 162
314 3300009177 Ga0105248_10116285 Ga0105248_101162853 162
315 3300009553 Ga0105249_10190952 Ga0105249_101909523 162
316 3300013102 Ga0157371_10085566 Ga0157371_100855663 162
317 3300013102 Ga0157371_10156945 Ga0157371_101569453 162
318 3300013105 Ga0157369_10275541 Ga0157369_102755411 162
319 3300017792 Ga0163161_10139416 Ga0163161_101394163 162
320 3300025711 Ga0207696_1002233 Ga0207696_10022334 162
321 3300025923 Ga0207681_10085417 Ga0207681_100854174 162
322 3300025923 Ga0207681_11065670 Ga0207681_110656701 162
323 3300025925 Ga0207650_10072422 Ga0207650_100724223 162
324 3300025931 Ga0207644_10003305 Ga0207644_1000330510 162
325 3300025961 Ga0207712_10124769 Ga0207712_101247693 162
326 3300025972 Ga0207668_10005460 Ga0207668_100054606 162
327 3300025986 Ga0207658_10002564 Ga0207658_100025643 162
328 3300026067 Ga0207678_10353618 Ga0207678_103536182 162
329 3300028379 Ga0268266_10086468 Ga0268266_100864683 162
330 3300028380 Ga0268265_10024978 Ga0268265_100249784 162
331 3300028381 Ga0268264_10051498 Ga0268264_100514985 162
332 3300031548 Ga0307408_100954959 Ga0307408_1009549591 162
333 3300031824 Ga0307413_10066747 Ga0307413_100667473 162
334 3300031824 Ga0307413_10492835 Ga0307413_104928352 162
335 3300031852 Ga0307410_10108598 Ga0307410_101085983 162
336 3300031852 Ga0307410_11497643 Ga0307410_114976431 162
337 3300031901 Ga0307406_10092554 Ga0307406_100925542 162
338 3300031901 Ga0307406_10135400 Ga0307406_101354002 162
339 3300031901 Ga0307406_10211979 Ga0307406_102119792 162
340 3300031901 Ga0307406_10806343 Ga0307406_108063432 162
341 3300031903 Ga0307407_11243852 Ga0307407_112438521 162
342 3300031911 Ga0307412_10330538 Ga0307412_103305382 162
343 3300031911 Ga0307412_10573656 Ga0307412_105736561 162
344 3300031911 Ga0307412_11701311 Ga0307412_117013111 162
345 3300032002 Ga0307416_100177602 Ga0307416_1001776025 162
346 3300032002 Ga0307416_101167812 Ga0307416_1011678122 162
347 3300032002 Ga0307416_101935467 Ga0307416_1019354672 162
348 3300032004 Ga0307414_10038008 Ga0307414_100380083 162
349 3300032004 Ga0307414_10048037 Ga0307414_100480373 162
350 3300032004 Ga0307414_10268452 Ga0307414_102684523 162
351 3300032004 Ga0307414_10532033 Ga0307414_105320332 162
352 3300032126 Ga0307415_100321935 Ga0307415_1003219352 162
353 3300032133 Ga0316583_10010481 Ga0316583_100104813 162
354 3300035121 Ga0373960_0037886 Ga0373960_0037886_880_1368 162
355 3300036712 Ga0316584_0074925 Ga0316584_0074925_843_1331 162
356 3300042004 Ga0439445_0230820 Ga0439445_0230820_13_504 162
357 3300042125 Ga0450923_098071 Ga0450923_098071_93_584 162
358 3300046522 Ga0495643_0064904 Ga0495643_0064904_670_1161 162
359 3300046537 Ga0495598_0001651 Ga0495598_0001651_2198_2689 162
360 3300048903 Ga0496100_0073864 Ga0496100_0073864_10_498 162
361 3300048904 Ga0496101_0001612 Ga0496101_0001612_11989_12477 162
362 3300048905 Ga0496102_0000106 Ga0496102_0000106_54818_55306 162
363 3300048906 Ga0496103_0000095 Ga0496103_0000095_48723_49211 162
364 3300048907 Ga0496104_0000060 Ga0496104_0000060_33645_34133 162
365 3300048908 Ga0496105_0000274 Ga0496105_0000274_27850_28338 162
366 3300048908 Ga0496105_0011723 Ga0496105_0011723_1734_2231 162
367 3300048909 Ga0496106_0129532 Ga0496106_0129532_1403_1891 162
368 3300048910 Ga0496107_0044020 Ga0496107_0044020_1760_2248 162
369 3300048914 Ga0496111_0584446 Ga0496111_0584446_100_588 162
370 3300048915 Ga0496112_0092192 Ga0496112_0092192_2246_2734 162
371 3300048916 Ga0496113_0048133 Ga0496113_0048133_2329_2817 162
372 3300048920 Ga0496117_0000366 Ga0496117_0000366_65669_66157 162
373 3300048921 Ga0496118_0016076 Ga0496118_0016076_2878_3366 162
374 3300048922 Ga0496119_0001213 Ga0496119_0001213_2245_2733 162
375 3300048923 Ga0496120_0001109 Ga0496120_0001109_28866_29354 162
376 3300048925 Ga0496122_0013226 Ga0496122_0013226_3533_4021 162
377 3300048927 Ga0496124_0001019 Ga0496124_0001019_40127_40615 162
378 3300048929 Ga0496126_0000294 Ga0496126_0000294_43244_43732 162
379 3300049571 Ga0501034_0102239 Ga0501034_0102239_1871_2359 162
380 3300049571 Ga0501034_0325492 Ga0501034_0325492_756_1247 162
381 3300049571 Ga0501034_1246698 Ga0501034_1246698_95_583 162
382 3300049573 Ga0501037_0418637 Ga0501037_0418637_323_814 162
383 3300049575 Ga0501039_0359517 Ga0501039_0359517_621_1112 162
384 3300049581 Ga0501047_0100271 Ga0501047_0100271_1437_1928 162
385 3300049822 Ga0501035_0333501 Ga0501035_0333501_704_1195 162
386 3300049823 Ga0501044_0280404 Ga0501044_0280404_710_1201 162
387 3300050489 nmdc:mga03683_3_c1 nmdc:mga03683_3_c1_88697_89185 162
388 3300050490 nmdc:mga03n38_8177_c1 nmdc:mga03n38_8177_c1_1304_1792 162
389 3300050493 nmdc:mga0k408_130208_c1 nmdc:mga0k408_130208_c1_485_973 162
390 3300050493 nmdc:mga0k408_20_c1 nmdc:mga0k408_20_c1_45140_45628 162
391 3300050516 nmdc:mga0sz30_2385_c2 nmdc:mga0sz30_2385_c2_1256_1744 162
392 3300053087 Ga0500643_000001 Ga0500643_000001_1131102_1131590 162
393 3300053096 Ga0500641_0094126 Ga0500641_0094126_706_1197 162
394 3300053146 Ga0500588_0041064 Ga0500588_0041064_194_697 162
395 3300053153 Ga0500616_0152784 Ga0500616_0152784_217_708 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01782

RimM

RimM N-terminal domain

25

102

0.9

PF05239

PRC

PRC-barrel domain

108

179

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.8377 93 157
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.8139 5 162
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.7958 5 162
4d7e-assembly2.cif.gz_A an unprecedented nadph domain conformation in lysine monooxygenase nbtg from nocardia farcinica 0.7919 113 140
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.7793 115 140
ID Description Score Start End Superfamily
af_P0A7X6_101_182_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9269 89 157 2.30.30.240
af_P9WH19_99_175_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.891 93 162 2.30.30.240
2f1lA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8834 5 88 2.40.30.60
af_Q2FZ44_92_167_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8788 89 162 2.30.30.240
3a1pC02 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8771 90 157 2.30.30.240
ID Description Score Start End GO Terms
AF-A0A7W7ADM9-F1-model_v4 Ribosome maturation factor RimM 0.9744 2 162 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A7W7ADM9-F1-model_v4 Ribosome maturation factor RimM 0.9685 2 162 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A7W9F1E1-F1-model_v4 Ribosome maturation factor RimM 0.9469 1 160 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A7W9F1E1-F1-model_v4 Ribosome maturation factor RimM 0.9299 1 160 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A0E9MNR2-F1-model_v4 Ribosome maturation factor RimM 0.9243 5 162 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022

Feature Viewer

pLDDT pTM Quality
92.78 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map