F433255

General Info

Members Datasets Scaffolds Average Seq Length
395 248 790 106

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_12086969|Ga0307410_120869691
Length 122
Sequence MASRIRKGDKVVVIAGAHKGTEGIVTKVLPEFSQVIVEGVNRVKRHQKPTPRLPEGGIIEKDRPIHVSNVALVDPSTGKATRVRFQTDADGKKSRVAAKSGTVIQAAATGNQDAQSNDAGAV

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
111 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
115 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
116 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
117 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
119 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
122 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
123 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
124 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
125 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
149 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
150 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
151 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
152 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
186 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
237 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
238 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
239 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
240 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
243 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
248 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.46
Metatranscriptomes 3.29
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.87
Nodule 0
Rhizoplane 0.51
Rhizosphere 88.61
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_12086969 3300031852 Bacteria 507
2 JGI24750J21931_1061390 3300002070 Bacteria 601
3 JGI25406J46586_10029995 3300003203 Bacteria 2051
4 Ga0007429J51699_1073170 3300003579 Bacteria 780
5 Ga0058861_12040642 3300004800 Bacteria 2087
6 Ga0065712_10718877 3300005290 Bacteria 540
7 Ga0065707_10013046 3300005295 Bacteria 2002
8 Ga0065707_10307588 3300005295 Bacteria 991
9 Ga0070658_10061874 3300005327 Bacteria 3050
10 Ga0070683_100301870 3300005329 Bacteria 1523
11 Ga0070683_101420950 3300005329 Bacteria 667
12 Ga0070690_100074696 3300005330 Bacteria 2208
13 Ga0070670_101817643 3300005331 Bacteria 561
14 Ga0068869_101555158 3300005334 Bacteria 588
15 Ga0070680_100061453 3300005336 Bacteria 3075
16 Ga0070687_100883528 3300005343 Bacteria 640
17 Ga0070661_100068083 3300005344 Bacteria 2617
18 Ga0070692_10093904 3300005345 Bacteria 1634
19 Ga0070692_10924481 3300005345 Bacteria 605
20 Ga0070688_100161923 3300005365 Bacteria 1538
21 Ga0070703_10038629 3300005406 Bacteria 1476
22 Ga0070714_100047656 3300005435 Bacteria 3641
23 Ga0070713_100193708 3300005436 Bacteria 1833
24 Ga0070701_11349184 3300005438 Bacteria 511
25 Ga0070700_100891384 3300005441 Bacteria 724
26 Ga0070694_100123201 3300005444 Bacteria 1863
27 Ga0070694_100705645 3300005444 Bacteria 821
28 Ga0070694_100739581 3300005444 Bacteria 802
29 Ga0070707_100238841 3300005468 Bacteria 1769
30 Ga0070698_101056049 3300005471 Bacteria 760
31 Ga0070699_100895387 3300005518 Bacteria 813
32 Ga0070679_100738041 3300005530 Bacteria 927
33 Ga0070684_100070941 3300005535 Bacteria 3066
34 Ga0070686_100061505 3300005544 Bacteria 2427
35 Ga0070686_101421483 3300005544 Bacteria 583
36 Ga0070695_100908358 3300005545 Bacteria 711
37 Ga0070695_100952782 3300005545 Bacteria 696
38 Ga0070696_101825259 3300005546 Bacteria 526
39 Ga0070693_100661732 3300005547 Bacteria 761
40 Ga0070704_100644738 3300005549 Bacteria 935
41 Ga0068855_100138919 3300005563 Bacteria 2771
42 Ga0068855_101081352 3300005563 Bacteria 839
43 Ga0068856_101142826 3300005614 Bacteria 796
44 Ga0070702_100503811 3300005615 Bacteria 890
45 Ga0068852_100739196 3300005616 Bacteria 996
46 Ga0068859_100021700 3300005617 Bacteria 6443
47 Ga0068864_100076229 3300005618 Bacteria 2929
48 Ga0068863_100258996 3300005841 Bacteria 1681
49 Ga0068862_102717501 3300005844 Bacteria 507
50 Ga0081539_10010390 3300005985 Bacteria 7569
51 Ga0081539_10161149 3300005985 Bacteria 1069
52 Ga0070717_10361170 3300006028 Bacteria 1300
53 Ga0075365_10208530 3300006038 Bacteria 1370
54 Ga0075368_10003054 3300006042 Bacteria 5542
55 Ga0075363_100000856 3300006048 Bacteria 10631
56 Ga0075364_10015296 3300006051 Bacteria 4757
57 Ga0070712_100691409 3300006175 Bacteria 869
58 Ga0070712_101354128 3300006175 Bacteria 621
59 Ga0075362_10001667 3300006177 Bacteria 7203
60 Ga0075362_10039756 3300006177 Bacteria 2069
61 Ga0075362_10223011 3300006177 Bacteria 922
62 Ga0075367_10001881 3300006178 Bacteria 9288
63 Ga0075369_10003827 3300006186 Bacteria 5518
64 Ga0075366_10029562 3300006195 Bacteria 3219
65 Ga0075366_10072831 3300006195 Bacteria 2048
66 Ga0075366_10394105 3300006195 Bacteria 852
67 Ga0075366_10447849 3300006195 Bacteria 797
68 Ga0075370_10017546 3300006353 Bacteria 3869
69 Ga0075370_10393044 3300006353 Bacteria 831
70 Ga0075370_10583153 3300006353 Bacteria 677
71 Ga0075430_100018107 3300006846 Bacteria 5994
72 Ga0075430_100884368 3300006846 Bacteria 736
73 Ga0075431_100171524 3300006847 Bacteria 2229
74 Ga0075431_100657040 3300006847 Bacteria 1028
75 Ga0075433_10079601 3300006852 Bacteria 2887
76 Ga0075433_10660317 3300006852 Bacteria 917
77 Ga0075434_100208963 3300006871 Bacteria 1972
78 Ga0075436_100069889 3300006914 Bacteria 2426
79 Ga0075436_100465695 3300006914 Bacteria 922
80 Ga0097620_100021700 3300006931 Bacteria 6443
81 Ga0075435_100006049 3300007076 Bacteria 8522
82 Ga0075435_100019527 3300007076 Bacteria 5180
83 Ga0099794_10104294 3300007265 Bacteria 1417
84 Ga0099794_10566299 3300007265 Bacteria 600
85 Ga0105240_10252783 3300009093 Bacteria 2037
86 Ga0111539_10069166 3300009094 Bacteria 4169
87 Ga0105237_10809625 3300009545 Bacteria 944
88 Ga0105238_10087095 3300009551 Bacteria 3110
89 Ga0105239_10215856 3300010375 Bacteria 2151
90 Ga0105246_10632441 3300011119 Bacteria 929
91 Ga0157346_1002281 3300012480 Bacteria 987
92 Ga0157373_11022718 3300013100 Bacteria 617
93 Ga0157370_10090984 3300013104 Bacteria 2865
94 Ga0157369_10229169 3300013105 Bacteria 1943
95 Ga0157378_11085783 3300013297 Bacteria 837
96 Ga0157372_10202803 3300013307 Bacteria 2298
97 Ga0206356_11323055 3300020070 Bacteria 1702
98 Ga0209026_1018764 3300025250 Bacteria 1091
99 Ga0207656_10344335 3300025321 Bacteria 743
100 Ga0207653_10109702 3300025885 Bacteria 984
101 Ga0207684_10221976 3300025910 Bacteria 1631
102 Ga0207707_11021102 3300025912 Bacteria 678
103 Ga0207695_10045231 3300025913 Bacteria 4675
104 Ga0207662_10573849 3300025918 Bacteria 783
105 Ga0207649_10101163 3300025920 Bacteria 1908
106 Ga0207652_11311116 3300025921 Bacteria 627
107 Ga0207646_10205220 3300025922 Bacteria 1780
108 Ga0207694_10007098 3300025924 Bacteria 8511
109 Ga0207650_10152420 3300025925 Bacteria 1825
110 Ga0207664_10192610 3300025929 Bacteria 1756
111 Ga0207664_11032378 3300025929 Bacteria 736
112 Ga0207709_10971527 3300025935 Bacteria 693
113 Ga0207670_10038917 3300025936 Bacteria 3110
114 Ga0207665_10862383 3300025939 Bacteria 717
115 Ga0207691_11712497 3300025940 Bacteria 508
116 Ga0207689_10850412 3300025942 Bacteria 770
117 Ga0207661_10242302 3300025944 Bacteria 1600
118 Ga0207667_10019150 3300025949 Bacteria 7654
119 Ga0207667_10223167 3300025949 Bacteria 1931
120 Ga0207712_11642397 3300025961 Bacteria 576
121 Ga0207708_10479958 3300026075 Bacteria 1039
122 Ga0207702_10140039 3300026078 Bacteria 2188
123 Ga0207641_12486549 3300026088 Bacteria 516
124 Ga0207698_10939980 3300026142 Bacteria 873
125 Ga0209996_1017678 3300027395 Bacteria 986
126 Ga0210000_1023199 3300027462 Bacteria 955
127 Ga0209971_1075735 3300027682 Bacteria 818
128 Ga0209813_10001024 3300027866 Bacteria 6287
129 Ga0207428_10449573 3300027907 Bacteria 939
130 Ga0265319_1275611 3300028563 Bacteria 512
131 Ga0307515_10203755 3300028794 Bacteria 1846
132 Ga0307511_10000653 3300030521 Bacteria 37038
133 Ga0265331_10292709 3300031250 Bacteria 729
134 Ga0265327_10131623 3300031251 Bacteria 1176
135 Ga0316575_10000771 3300031665 Bacteria 9685
136 Ga0316575_10003983 3300031665 Bacteria 5170
137 Ga0316575_10251508 3300031665 Bacteria 741
138 Ga0316579_10000952 3300031691 Bacteria 10118
139 Ga0316578_10701883 3300031728 Unclassified 589
140 Ga0307416_101035144 3300032002 Bacteria 925
141 Ga0316583_10002208 3300032133 Bacteria 6709
142 Ga0316583_10007463 3300032133 Bacteria 3936
143 Ga0316583_10008555 3300032133 Bacteria 3690
144 Ga0316583_10068131 3300032133 Bacteria 1245
145 Ga0316585_10143487 3300032137 Unclassified 788
146 Ga0316580_10090579 3300032139 Bacteria 936
147 Ga0316593_10000192 3300032168 Bacteria 9387
148 Ga0316593_10002233 3300032168 Bacteria 4536
149 Ga0316593_10238377 3300032168 Bacteria 678
150 Ga0307507_10032678 3300033179 Bacteria 5425
151 Ga0316586_1026237 3300033527 Bacteria 983
152 Ga0316586_1030302 3300033527 Bacteria 924
153 Ga0316596_1000154 3300033541 Bacteria 9581
154 Ga0316596_1003277 3300033541 Bacteria 3527
155 Ga0373930_0074285 3300034816 Bacteria 777
156 Ga0373948_0077689 3300034817 Bacteria 753
157 Ga0373959_0064232 3300034820 Bacteria 818
158 Ga0373959_0137091 3300034820 Bacteria 610
159 Ga0373938_0060798 3300034957 Bacteria 883
160 Ga0373926_0005302 3300035083 Bacteria 4243
161 Ga0373928_0168036 3300035084 Bacteria 617
162 Ga0373944_0011229 3300035089 Bacteria 2450
163 Ga0373952_0000366 3300035092 Bacteria 7677
164 Ga0373952_0024981 3300035092 Bacteria 1287
165 Ga0373936_0020227 3300035113 Bacteria 2584
166 Ga0373939_0234584 3300035114 Bacteria 708
167 Ga0373939_0250851 3300035114 Bacteria 689
168 Ga0373939_0320046 3300035114 Bacteria 623
169 Ga0373941_0013805 3300035115 Bacteria 2144
170 Ga0373941_0321593 3300035115 Bacteria 622
171 Ga0373954_0294714 3300035118 Bacteria 800
172 Ga0373960_0028386 3300035121 Bacteria 1544
173 Ga0373960_0035512 3300035121 Bacteria 1415
174 Ga0373960_0134525 3300035121 Bacteria 832
175 Ga0373960_0165858 3300035121 Bacteria 763
176 Ga0373943_0036624 3300035170 Bacteria 2350
177 Ga0373943_0954970 3300035170 Bacteria 513
178 Ga0373946_0049130 3300035171 Bacteria 1758
179 Ga0373946_0095412 3300035171 Bacteria 1325
180 Ga0373961_0010397 3300035241 Bacteria 2292
181 Ga0373962_0102169 3300035242 Bacteria 895
182 Ga0316574_0203373 3300035398 Bacteria 1272
183 Ga0316574_0208020 3300035398 Bacteria 1256
184 Ga0373924_0026912 3300035410 Bacteria 2284
185 Ga0373931_0002669 3300035691 Bacteria 7930
186 Ga0373931_0203983 3300035691 Bacteria 1183
187 Ga0373931_1073477 3300035691 Bacteria 547
188 Ga0373935_0034613 3300035692 Bacteria 3149
189 Ga0373935_0255183 3300035692 Bacteria 1228
190 Ga0373927_0036300 3300035695 Bacteria 3205
191 Ga0373947_0136207 3300035725 Bacteria 1571
192 Ga0373937_0065847 3300036401 Bacteria 3336
193 Ga0316582_0002553 3300036647 Bacteria 8612
194 Ga0316582_0004346 3300036647 Bacteria 7138
195 Ga0316582_0008752 3300036647 Bacteria 5453
196 Ga0316584_0006254 3300036712 Bacteria 8068
197 Ga0316584_0167539 3300036712 Bacteria 1631
198 Ga0373925_0007409 3300037068 Bacteria 8006
199 Ga0316581_0001079 3300037588 Bacteria 5893
200 Ga0451794_10550 3300041446 Bacteria 649
201 Ga0439441_003617 3300042001 Bacteria 2290
202 Ga0439441_060985 3300042001 Bacteria 794
203 Ga0439443_000264 3300042003 Bacteria 4196
204 Ga0439451_002659 3300042009 Bacteria 3625
205 Ga0439434_0032682 3300042435 Bacteria 1584
206 Ga0439434_0359885 3300042435 Bacteria 509
207 Ga0439435_0004015 3300042436 Bacteria 3130
208 Ga0439460_0002792 3300042461 Bacteria 4203
209 Ga0439460_0072199 3300042461 Bacteria 1071
210 Ga0451577_0000013 3300042876 Bacteria 550689
211 Ga0451577_0101172 3300042876 Bacteria 2575
212 Ga0451577_0200639 3300042876 Bacteria 1801
213 Ga0451577_0454646 3300042876 Bacteria 1163
214 Ga0453683_0000059 3300044673 Bacteria 187158
215 Ga0453683_0009125 3300044673 Bacteria 6624
216 Ga0453683_0030079 3300044673 Bacteria 3434
217 Ga0453683_0247322 3300044673 Bacteria 1136
218 Ga0453683_0424396 3300044673 Bacteria 858
219 Ga0466963_0283213 3300044694 Bacteria 1165
220 Ga0466964_0020860 3300044706 Bacteria 2527
221 Ga0453684_0000585 3300044712 Bacteria 135647
222 Ga0453684_0000989 3300044712 Bacteria 92793
223 Ga0453684_0020632 3300044712 Bacteria 9917
224 Ga0453684_0098007 3300044712 Bacteria 3596
225 Ga0453684_0205823 3300044712 Bacteria 2290
226 Ga0453684_0674870 3300044712 Bacteria 1125
227 Ga0453684_0780306 3300044712 Bacteria 1032
228 Ga0466957_0152111 3300044842 Bacteria 1497
229 Ga0451576_0000013 3300045051 Bacteria 665120
230 Ga0451576_0000018 3300045051 Bacteria 550689
231 Ga0451576_0184196 3300045051 Bacteria 2180
232 Ga0451576_0235909 3300045051 Bacteria 1910
233 Ga0451576_0239449 3300045051 Bacteria 1895
234 Ga0451576_0405589 3300045051 Bacteria 1429
235 Ga0451576_1489920 3300045051 Bacteria 703
236 Ga0466967_0016890 3300045976 Bacteria 5771
237 Ga0495603_0022916 3300046455 Bacteria 3779
238 Ga0495629_0062948 3300046459 Bacteria 2591
239 Ga0495650_0007879 3300046471 Bacteria 6324
240 Ga0495580_0004729 3300046472 Bacteria 11405
241 Ga0495582_0022900 3300046473 Bacteria 3417
242 Ga0495594_0815542 3300046499 Bacteria 526
243 Ga0495663_0118720 3300046525 Bacteria 884
244 Ga0495666_0042539 3300046526 Bacteria 2196
245 Ga0495666_0045650 3300046526 Bacteria 2113
246 Ga0495665_0067989 3300046531 Bacteria 1879
247 Ga0495586_0012832 3300046535 Bacteria 4441
248 Ga0495586_0051053 3300046535 Bacteria 2238
249 Ga0495598_0329516 3300046537 Bacteria 583
250 Ga0495621_0008009 3300046539 Bacteria 3150
251 Ga0495621_0197696 3300046539 Bacteria 808
252 Ga0495621_0211786 3300046539 Bacteria 782
253 Ga0495588_0023940 3300046674 Bacteria 3029
254 Ga0495657_0372718 3300046675 Bacteria 843
255 Ga0495647_0001629 3300046681 Bacteria 6939
256 Ga0495647_0056319 3300046681 Bacteria 1541
257 Ga0495658_0025293 3300046683 Bacteria 3171
258 Ga0495581_0574986 3300047315 Bacteria 653
259 Ga0495676_0091846 3300047321 Bacteria 2267
260 Ga0495593_0297968 3300047673 Bacteria 806
261 Ga0496108_1724654 3300048911 Bacteria 515
262 Ga0501305_057274 3300049161 Bacteria 665
263 Ga0501292_078776 3300049515 Bacteria 624
264 Ga0501298_194201 3300049521 Bacteria 513
265 Ga0501031_0089009 3300049568 Bacteria 2013
266 Ga0501031_0122019 3300049568 Bacteria 1702
267 Ga0501032_0091873 3300049569 Bacteria 2013
268 Ga0501032_0769578 3300049569 Bacteria 609
269 Ga0501033_0004098 3300049570 Bacteria 11751
270 Ga0501034_0043134 3300049571 Bacteria 4566
271 Ga0501036_0006553 3300049572 Bacteria 9458
272 Ga0501036_0034324 3300049572 Bacteria 4291
273 Ga0501037_0005636 3300049573 Bacteria 9129
274 Ga0501037_0148517 3300049573 Bacteria 1676
275 Ga0501037_0311987 3300049573 Bacteria 1090
276 Ga0501037_0521904 3300049573 Bacteria 804
277 Ga0501037_0978367 3300049573 Bacteria 552
278 Ga0501038_0000891 3300049574 Bacteria 26448
279 Ga0501038_0542607 3300049574 Bacteria 885
280 Ga0501039_0005177 3300049575 Bacteria 9877
281 Ga0501039_0065773 3300049575 Bacteria 2813
282 Ga0501039_0252162 3300049575 Bacteria 1387
283 Ga0501039_0415136 3300049575 Bacteria 1057
284 Ga0501039_0419135 3300049575 Bacteria 1052
285 Ga0501039_0955700 3300049575 Bacteria 666
286 Ga0501040_0003846 3300049576 Bacteria 9734
287 Ga0501040_0067749 3300049576 Bacteria 2460
288 Ga0501040_0170862 3300049576 Bacteria 1539
289 Ga0501041_0000815 3300049577 Bacteria 16702
290 Ga0501041_0003344 3300049577 Bacteria 9229
291 Ga0501041_0022479 3300049577 Bacteria 3776
292 Ga0501041_0344804 3300049577 Bacteria 941
293 Ga0501042_0009869 3300049578 Bacteria 6379
294 Ga0501042_0012358 3300049578 Bacteria 5781
295 Ga0501042_0083145 3300049578 Bacteria 2295
296 Ga0501043_0006848 3300049579 Bacteria 9099
297 Ga0501043_0273161 3300049579 Bacteria 1297
298 Ga0501043_0952010 3300049579 Bacteria 613
299 Ga0501043_1043587 3300049579 Bacteria 580
300 Ga0501046_0004387 3300049580 Bacteria 12824
301 Ga0501047_0447682 3300049581 Bacteria 1121
302 Ga0501048_0005618 3300049582 Bacteria 9536
303 Ga0501048_0049929 3300049582 Bacteria 2980
304 Ga0501069_0030284 3300049585 Bacteria 2972
305 Ga0501070_0021717 3300049586 Bacteria 5382
306 Ga0501071_0005936 3300049587 Bacteria 7901
307 Ga0501071_0058963 3300049587 Bacteria 2776
308 Ga0501071_0114002 3300049587 Bacteria 1999
309 Ga0501071_0209267 3300049587 Bacteria 1466
310 Ga0501071_0545569 3300049587 Bacteria 890
311 Ga0501072_0000447 3300049588 Bacteria 29642
312 Ga0501072_0018930 3300049588 Bacteria 5314
313 Ga0501072_0082224 3300049588 Bacteria 2553
314 Ga0501073_0008056 3300049589 Bacteria 7819
315 Ga0501073_0108715 3300049589 Bacteria 1924
316 Ga0501073_0168115 3300049589 Bacteria 1518
317 Ga0501074_0005165 3300049590 Bacteria 9387
318 Ga0501074_0098233 3300049590 Bacteria 2096
319 Ga0501074_0819335 3300049590 Bacteria 656
320 Ga0501075_0003793 3300049591 Bacteria 10167
321 Ga0501075_0009583 3300049591 Bacteria 6780
322 Ga0501075_0024398 3300049591 Bacteria 4434
323 Ga0501075_0251037 3300049591 Bacteria 1348
324 Ga0501076_0000663 3300049592 Bacteria 22052
325 Ga0501076_0006205 3300049592 Bacteria 8650
326 Ga0501076_0047645 3300049592 Bacteria 3389
327 Ga0501077_0000810 3300049593 Bacteria 18971
328 Ga0501077_0049998 3300049593 Bacteria 2657
329 Ga0501079_0004844 3300049741 Bacteria 9972
330 Ga0501079_0015785 3300049741 Bacteria 5770
331 Ga0501079_0039556 3300049741 Bacteria 3637
332 Ga0501079_0039713 3300049741 Bacteria 3630
333 Ga0501080_0001428 3300049742 Bacteria 20060
334 Ga0501080_0005999 3300049742 Bacteria 10889
335 Ga0501080_0088780 3300049742 Bacteria 2872
336 Ga0501081_0000747 3300049743 Bacteria 19029
337 Ga0501081_0014826 3300049743 Bacteria 5143
338 Ga0501081_0031168 3300049743 Bacteria 3613
339 Ga0501081_0691130 3300049743 Bacteria 766
340 Ga0501083_0159295 3300049744 Bacteria 1477
341 Ga0501279_027112 3300049775 Bacteria 838
342 Ga0501035_0010710 3300049822 Bacteria 8490
343 Ga0501044_0091955 3300049823 Bacteria 3060
344 Ga0501045_0002784 3300049824 Bacteria 11951
345 Ga0501045_0003651 3300049824 Bacteria 10578
346 Ga0501045_0276452 3300049824 Bacteria 1250
347 Ga0501045_1126349 3300049824 Bacteria 574
348 nmdc:mga03683_13626_c1 3300050489 Bacteria 2997
349 nmdc:mga03n38_4317_c1 3300050490 Bacteria 4691
350 nmdc:mga00v17_13392_c1 3300050491 Bacteria 4553
351 nmdc:mga0yw44_1035393_c1 3300050492 Bacteria 555
352 nmdc:mga0yw44_22084_c1 3300050492 Bacteria 3562
353 nmdc:mga0k408_13979_c1 3300050493 Bacteria 4412
354 nmdc:mga0k408_4092_c1 3300050493 Bacteria 5935
355 nmdc:mga0k408_49492_c1 3300050493 Bacteria 2432
356 nmdc:mga0k408_81119_c1 3300050493 Bacteria 1899
357 nmdc:mga06z11_1936_c1 3300050494 Bacteria 7811
358 nmdc:mga04h51_1577_c1 3300050495 Bacteria 5306
359 nmdc:mga07m45_6867_c1 3300050496 Bacteria 5791
360 nmdc:mga09592_521261_c1 3300050508 Bacteria 1022
361 nmdc:mga0qj67_48066_c1 3300050509 Bacteria 3371
362 nmdc:mga0qj67_689026_c1 3300050509 Bacteria 813
363 nmdc:mga06r32_19068_c1 3300050510 Bacteria 6291
364 nmdc:mga06r32_541056_c1 3300050510 Bacteria 1139
365 nmdc:mga08y16_72548_c1 3300050511 Bacteria 3587
366 nmdc:mga0n895_129139_c1 3300050512 Bacteria 2552
367 nmdc:mga0rr50_7934_c1 3300050513 Bacteria 6586
368 nmdc:mga0rr50_84504_c1 3300050513 Bacteria 2458
369 nmdc:mga08x19_240811_c1 3300050514 Bacteria 1247
370 nmdc:mga08x19_395522_c1 3300050514 Bacteria 969
371 nmdc:mga0a205_16068_c1 3300050515 Bacteria 7006
372 nmdc:mga0a205_630597_c1 3300050515 Bacteria 924
373 nmdc:mga0sz30_7140_c1 3300050516 Bacteria 4180
374 Ga0500644_0467712 3300053088 Bacteria 553
375 Ga0500644_0557996 3300053088 Bacteria 506
376 Ga0500646_0004768 3300053090 Bacteria 3432
377 Ga0500651_0435178 3300053093 Bacteria 732
378 Ga0500555_059434 3300053103 Bacteria 1031
379 Ga0500655_051593 3300053133 Bacteria 820
380 Ga0500568_0199261 3300053139 Bacteria 733
381 Ga0500588_0090947 3300053146 Bacteria 1037
382 Ga0500604_0000352 3300053151 Bacteria 12731
383 Ga0501084_0006534 3300054114 Bacteria 9581
384 Ga0501084_0018257 3300054114 Bacteria 5841
385 Ga0501084_0465926 3300054114 Bacteria 1068
386 Ga0587071_137359 3300060344 Bacteria 598
387 Ga0501082_0008910 3300060353 Bacteria 8656
388 Ga0501082_0659821 3300060353 Bacteria 915
389 Ga0501082_1127184 3300060353 Bacteria 686
390 Ga0530510_0005052 3300061734 Bacteria 9103
391 Ga0530510_0006785 3300061734 Bacteria 7977
392 Ga0530510_0243851 3300061734 Bacteria 1338
393 Ga0530510_1349035 3300061734 Bacteria 547
394 Ga0530510_1541995 3300061734 Bacteria 510
395 2891635734 2891633521 Bacteria 4602265
396 Ga0307410_12086969
397 JGI24750J21931_1061390
398 JGI25406J46586_10029995
399 Ga0007429J51699_1073170
400 Ga0058861_12040642
401 Ga0065712_10718877
402 Ga0065707_10013046
403 Ga0065707_10307588
404 Ga0070658_10061874
405 Ga0070683_100301870
406 Ga0070683_101420950
407 Ga0070690_100074696
408 Ga0070670_101817643
409 Ga0068869_101555158
410 Ga0070680_100061453
411 Ga0070687_100883528
412 Ga0070661_100068083
413 Ga0070692_10093904
414 Ga0070692_10924481
415 Ga0070688_100161923
416 Ga0070703_10038629
417 Ga0070714_100047656
418 Ga0070713_100193708
419 Ga0070701_11349184
420 Ga0070700_100891384
421 Ga0070694_100123201
422 Ga0070694_100705645
423 Ga0070694_100739581
424 Ga0070707_100238841
425 Ga0070698_101056049
426 Ga0070699_100895387
427 Ga0070679_100738041
428 Ga0070684_100070941
429 Ga0070686_100061505
430 Ga0070686_101421483
431 Ga0070695_100908358
432 Ga0070695_100952782
433 Ga0070696_101825259
434 Ga0070693_100661732
435 Ga0070704_100644738
436 Ga0068855_100138919
437 Ga0068855_101081352
438 Ga0068856_101142826
439 Ga0070702_100503811
440 Ga0068852_100739196
441 Ga0068859_100021700
442 Ga0068864_100076229
443 Ga0068863_100258996
444 Ga0068862_102717501
445 Ga0081539_10010390
446 Ga0081539_10161149
447 Ga0070717_10361170
448 Ga0075365_10208530
449 Ga0075368_10003054
450 Ga0075363_100000856
451 Ga0075364_10015296
452 Ga0070712_100691409
453 Ga0070712_101354128
454 Ga0075362_10001667
455 Ga0075362_10039756
456 Ga0075362_10223011
457 Ga0075367_10001881
458 Ga0075369_10003827
459 Ga0075366_10029562
460 Ga0075366_10072831
461 Ga0075366_10394105
462 Ga0075366_10447849
463 Ga0075370_10017546
464 Ga0075370_10393044
465 Ga0075370_10583153
466 Ga0075430_100018107
467 Ga0075430_100884368
468 Ga0075431_100171524
469 Ga0075431_100657040
470 Ga0075433_10079601
471 Ga0075433_10660317
472 Ga0075434_100208963
473 Ga0075436_100069889
474 Ga0075436_100465695
475 Ga0097620_100021700
476 Ga0075435_100006049
477 Ga0075435_100019527
478 Ga0099794_10104294
479 Ga0099794_10566299
480 Ga0105240_10252783
481 Ga0111539_10069166
482 Ga0105237_10809625
483 Ga0105238_10087095
484 Ga0105239_10215856
485 Ga0105246_10632441
486 Ga0157346_1002281
487 Ga0157373_11022718
488 Ga0157370_10090984
489 Ga0157369_10229169
490 Ga0157378_11085783
491 Ga0157372_10202803
492 Ga0206356_11323055
493 Ga0209026_1018764
494 Ga0207656_10344335
495 Ga0207653_10109702
496 Ga0207684_10221976
497 Ga0207707_11021102
498 Ga0207695_10045231
499 Ga0207662_10573849
500 Ga0207649_10101163
501 Ga0207652_11311116
502 Ga0207646_10205220
503 Ga0207694_10007098
504 Ga0207650_10152420
505 Ga0207664_10192610
506 Ga0207664_11032378
507 Ga0207709_10971527
508 Ga0207670_10038917
509 Ga0207665_10862383
510 Ga0207691_11712497
511 Ga0207689_10850412
512 Ga0207661_10242302
513 Ga0207667_10019150
514 Ga0207667_10223167
515 Ga0207712_11642397
516 Ga0207708_10479958
517 Ga0207702_10140039
518 Ga0207641_12486549
519 Ga0207698_10939980
520 Ga0209996_1017678
521 Ga0210000_1023199
522 Ga0209971_1075735
523 Ga0209813_10001024
524 Ga0207428_10449573
525 Ga0265319_1275611
526 Ga0307515_10203755
527 Ga0307511_10000653
528 Ga0265331_10292709
529 Ga0265327_10131623
530 Ga0316575_10000771
531 Ga0316575_10003983
532 Ga0316575_10251508
533 Ga0316579_10000952
534 Ga0316578_10701883
535 Ga0307416_101035144
536 Ga0316583_10002208
537 Ga0316583_10007463
538 Ga0316583_10008555
539 Ga0316583_10068131
540 Ga0316585_10143487
541 Ga0316580_10090579
542 Ga0316593_10000192
543 Ga0316593_10002233
544 Ga0316593_10238377
545 Ga0307507_10032678
546 Ga0316586_1026237
547 Ga0316586_1030302
548 Ga0316596_1000154
549 Ga0316596_1003277
550 Ga0373930_0074285
551 Ga0373948_0077689
552 Ga0373959_0064232
553 Ga0373959_0137091
554 Ga0373938_0060798
555 Ga0373926_0005302
556 Ga0373928_0168036
557 Ga0373944_0011229
558 Ga0373952_0000366
559 Ga0373952_0024981
560 Ga0373936_0020227
561 Ga0373939_0234584
562 Ga0373939_0250851
563 Ga0373939_0320046
564 Ga0373941_0013805
565 Ga0373941_0321593
566 Ga0373954_0294714
567 Ga0373960_0028386
568 Ga0373960_0035512
569 Ga0373960_0134525
570 Ga0373960_0165858
571 Ga0373943_0036624
572 Ga0373943_0954970
573 Ga0373946_0049130
574 Ga0373946_0095412
575 Ga0373961_0010397
576 Ga0373962_0102169
577 Ga0316574_0203373
578 Ga0316574_0208020
579 Ga0373924_0026912
580 Ga0373931_0002669
581 Ga0373931_0203983
582 Ga0373931_1073477
583 Ga0373935_0034613
584 Ga0373935_0255183
585 Ga0373927_0036300
586 Ga0373947_0136207
587 Ga0373937_0065847
588 Ga0316582_0002553
589 Ga0316582_0004346
590 Ga0316582_0008752
591 Ga0316584_0006254
592 Ga0316584_0167539
593 Ga0373925_0007409
594 Ga0316581_0001079
595 Ga0451794_10550
596 Ga0439441_003617
597 Ga0439441_060985
598 Ga0439443_000264
599 Ga0439451_002659
600 Ga0439434_0032682
601 Ga0439434_0359885
602 Ga0439435_0004015
603 Ga0439460_0002792
604 Ga0439460_0072199
605 Ga0451577_0000013
606 Ga0451577_0101172
607 Ga0451577_0200639
608 Ga0451577_0454646
609 Ga0453683_0000059
610 Ga0453683_0009125
611 Ga0453683_0030079
612 Ga0453683_0247322
613 Ga0453683_0424396
614 Ga0466963_0283213
615 Ga0466964_0020860
616 Ga0453684_0000585
617 Ga0453684_0000989
618 Ga0453684_0020632
619 Ga0453684_0098007
620 Ga0453684_0205823
621 Ga0453684_0674870
622 Ga0453684_0780306
623 Ga0466957_0152111
624 Ga0451576_0000013
625 Ga0451576_0000018
626 Ga0451576_0184196
627 Ga0451576_0235909
628 Ga0451576_0239449
629 Ga0451576_0405589
630 Ga0451576_1489920
631 Ga0466967_0016890
632 Ga0495603_0022916
633 Ga0495629_0062948
634 Ga0495650_0007879
635 Ga0495580_0004729
636 Ga0495582_0022900
637 Ga0495594_0815542
638 Ga0495663_0118720
639 Ga0495666_0042539
640 Ga0495666_0045650
641 Ga0495665_0067989
642 Ga0495586_0012832
643 Ga0495586_0051053
644 Ga0495598_0329516
645 Ga0495621_0008009
646 Ga0495621_0197696
647 Ga0495621_0211786
648 Ga0495588_0023940
649 Ga0495657_0372718
650 Ga0495647_0001629
651 Ga0495647_0056319
652 Ga0495658_0025293
653 Ga0495581_0574986
654 Ga0495676_0091846
655 Ga0495593_0297968
656 Ga0496108_1724654
657 Ga0501305_057274
658 Ga0501292_078776
659 Ga0501298_194201
660 Ga0501031_0089009
661 Ga0501031_0122019
662 Ga0501032_0091873
663 Ga0501032_0769578
664 Ga0501033_0004098
665 Ga0501034_0043134
666 Ga0501036_0006553
667 Ga0501036_0034324
668 Ga0501037_0005636
669 Ga0501037_0148517
670 Ga0501037_0311987
671 Ga0501037_0521904
672 Ga0501037_0978367
673 Ga0501038_0000891
674 Ga0501038_0542607
675 Ga0501039_0005177
676 Ga0501039_0065773
677 Ga0501039_0252162
678 Ga0501039_0415136
679 Ga0501039_0419135
680 Ga0501039_0955700
681 Ga0501040_0003846
682 Ga0501040_0067749
683 Ga0501040_0170862
684 Ga0501041_0000815
685 Ga0501041_0003344
686 Ga0501041_0022479
687 Ga0501041_0344804
688 Ga0501042_0009869
689 Ga0501042_0012358
690 Ga0501042_0083145
691 Ga0501043_0006848
692 Ga0501043_0273161
693 Ga0501043_0952010
694 Ga0501043_1043587
695 Ga0501046_0004387
696 Ga0501047_0447682
697 Ga0501048_0005618
698 Ga0501048_0049929
699 Ga0501069_0030284
700 Ga0501070_0021717
701 Ga0501071_0005936
702 Ga0501071_0058963
703 Ga0501071_0114002
704 Ga0501071_0209267
705 Ga0501071_0545569
706 Ga0501072_0000447
707 Ga0501072_0018930
708 Ga0501072_0082224
709 Ga0501073_0008056
710 Ga0501073_0108715
711 Ga0501073_0168115
712 Ga0501074_0005165
713 Ga0501074_0098233
714 Ga0501074_0819335
715 Ga0501075_0003793
716 Ga0501075_0009583
717 Ga0501075_0024398
718 Ga0501075_0251037
719 Ga0501076_0000663
720 Ga0501076_0006205
721 Ga0501076_0047645
722 Ga0501077_0000810
723 Ga0501077_0049998
724 Ga0501079_0004844
725 Ga0501079_0015785
726 Ga0501079_0039556
727 Ga0501079_0039713
728 Ga0501080_0001428
729 Ga0501080_0005999
730 Ga0501080_0088780
731 Ga0501081_0000747
732 Ga0501081_0014826
733 Ga0501081_0031168
734 Ga0501081_0691130
735 Ga0501083_0159295
736 Ga0501279_027112
737 Ga0501035_0010710
738 Ga0501044_0091955
739 Ga0501045_0002784
740 Ga0501045_0003651
741 Ga0501045_0276452
742 Ga0501045_1126349
743 nmdc:mga03683_13626_c1
744 nmdc:mga03n38_4317_c1
745 nmdc:mga00v17_13392_c1
746 nmdc:mga0yw44_1035393_c1
747 nmdc:mga0yw44_22084_c1
748 nmdc:mga0k408_13979_c1
749 nmdc:mga0k408_4092_c1
750 nmdc:mga0k408_49492_c1
751 nmdc:mga0k408_81119_c1
752 nmdc:mga06z11_1936_c1
753 nmdc:mga04h51_1577_c1
754 nmdc:mga07m45_6867_c1
755 nmdc:mga09592_521261_c1
756 nmdc:mga0qj67_48066_c1
757 nmdc:mga0qj67_689026_c1
758 nmdc:mga06r32_19068_c1
759 nmdc:mga06r32_541056_c1
760 nmdc:mga08y16_72548_c1
761 nmdc:mga0n895_129139_c1
762 nmdc:mga0rr50_7934_c1
763 nmdc:mga0rr50_84504_c1
764 nmdc:mga08x19_240811_c1
765 nmdc:mga08x19_395522_c1
766 nmdc:mga0a205_16068_c1
767 nmdc:mga0a205_630597_c1
768 nmdc:mga0sz30_7140_c1
769 Ga0500644_0467712
770 Ga0500644_0557996
771 Ga0500646_0004768
772 Ga0500651_0435178
773 Ga0500555_059434
774 Ga0500655_051593
775 Ga0500568_0199261
776 Ga0500588_0090947
777 Ga0500604_0000352
778 Ga0501084_0006534
779 Ga0501084_0018257
780 Ga0501084_0465926
781 Ga0587071_137359
782 Ga0501082_0008910
783 Ga0501082_0659821
784 Ga0501082_1127184
785 Ga0530510_0005052
786 Ga0530510_0006785
787 Ga0530510_0243851
788 Ga0530510_1349035
789 Ga0530510_1541995
790 2891635734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

40

104

0.98

PF00467

KOW

KOW motif

7

38

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgv-assembly1.cif.gz_t tiamulin bound to the 50s subunit 0.9615 3 103
8cam-assembly1.cif.gz_t evernimicin bound to the 50s subunit 0.9534 3 103
7nwt-assembly1.cif.gz_U initiated 70s ribosome in complex with 2a protein from encephalomyocarditis virus (emcv) 0.9508 3 104
6vwl-assembly1.cif.gz_S 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) 0.9508 3 103
6vwn-assembly1.cif.gz_S 70s ribosome bound to hiv frameshifting stem-loop (fss) and p-site trna (non-rotated conformation, structure ii) 0.9494 3 103
ID Description Score Start End Superfamily
af_C6SX56_4_111_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9128 3 100 2.30.30.30
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9098 1 100 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8978 4 101 2.30.30.30
af_P9WHB7_1_104_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8839 3 101 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8758 4 101 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A2S8H2I7-F1-model_v4 deleted 0.9878 1 105
AF-A0A7C3GS56-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9858 1 66 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A836S9C2-F1-model_v4 Large ribosomal subunit protein uL24 0.9834 1 105 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2V3VNT6-F1-model_v4 Large ribosomal subunit protein uL24 0.9803 1 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A352Q4Q8-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9787 1 82 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map