F433358

General Info

Members Datasets Scaffolds Average Seq Length
395 258 790 140

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0117313|Ga0500616_0117313_52_537
Length 161
Sequence MLLLAGCWSKRRSGLSEPKVASAFDNLCGPGKALRAEPPDAQEFAGLVRSGLARLIDAGTTTLSLESQFDLGYNAAHALSLAALRWHGYRSSNRYIVFQLLPHTLGLGPEIWRVLSKCHDIRNLGEYEGDLNVDARIVTDLLSATRRVAAKVEALPPLSSP

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
77 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
160 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
164 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
237 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
240 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
241 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
242 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
247 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
248 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
249 2818991446 Variovorax sp. 1180 Isolate Unclassified
250 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
251 2842677519 Variovorax sp. R-72495 Isolate Unclassified
252 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
253 2928037797 Variovorax sp. 1126 Isolate Unclassified
254 2928044640 Variovorax sp. 1128 Isolate Unclassified
255 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
256 2941479691
257 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
258 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.71
Metatranscriptomes 0
Isolates 3.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.22
Nodule 1.01
Rhizoplane 4.81
Rhizosphere 71.65
Stem 0
Stem Tuber 0
Unclassified 10.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0117313 3300053153 Bacteria 1276
2 JGI25151J46595_10002277 3300003187 Bacteria 11784
3 JGI25151J46595_10005591 3300003187 Bacteria 6469
4 JGI25151J46595_10019468 3300003187 Bacteria 2883
5 JGI25153J46596_10031398 3300003215 Bacteria 1789
6 rootH2_10081404 3300003320 Bacteria 6240
7 rootL2_10263046 3300003322 Bacteria 1098
8 rootH1_10396887 3300003323 Bacteria 1210
9 Ga0055535_1000276 3300003761 Bacteria 53888
10 Ga0055529_1000324 3300003763 Bacteria 53888
11 Ga0055536_1021225 3300003781 Bacteria 1978
12 Ga0055530_10002760 3300003791 Bacteria 10867
13 Ga0055540_1010233 3300003792 Bacteria 3138
14 Ga0055540_1023347 3300003792 Bacteria 1560
15 Ga0055531_10006381 3300003794 Bacteria 6704
16 Ga0065714_10157345 3300005288 Bacteria 1071
17 Ga0065704_10085849 3300005289 Bacteria 3180
18 Ga0065707_10085342 3300005295 Bacteria 6238
19 Ga0070658_10139214 3300005327 Unclassified 2026
20 Ga0070683_100155576 3300005329 Bacteria 2168
21 Ga0070683_100179115 3300005329 Bacteria 2012
22 Ga0070680_101075415 3300005336 Bacteria 695
23 Ga0070660_101741032 3300005339 Bacteria 531
24 Ga0070674_100142362 3300005356 Bacteria 1801
25 Ga0070673_100311794 3300005364 Bacteria 1388
26 Ga0070659_100143099 3300005366 Bacteria 1947
27 Ga0070667_100022327 3300005367 Bacteria 5249
28 Ga0070714_100591532 3300005435 Unclassified 1065
29 Ga0070714_101096178 3300005435 Bacteria 776
30 Ga0070713_101244291 3300005436 Bacteria 721
31 Ga0070701_10725515 3300005438 Unclassified 671
32 Ga0070708_100307559 3300005445 Bacteria 1493
33 Ga0070663_100249964 3300005455 Bacteria 1403
34 Ga0070678_100324083 3300005456 Bacteria 1316
35 Ga0070681_10006194 3300005458 Bacteria 11627
36 Ga0070685_10216974 3300005466 Bacteria 1251
37 Ga0070706_100193133 3300005467 Bacteria 1902
38 Ga0070707_100351351 3300005468 Bacteria 1432
39 Ga0070707_101925211 3300005468 Unclassified 559
40 Ga0070698_100304154 3300005471 Bacteria 1525
41 Ga0070698_101723222 3300005471 Bacteria 579
42 Ga0070679_100226801 3300005530 Bacteria 1828
43 Ga0070679_100355669 3300005530 Bacteria 1412
44 Ga0070679_100419664 3300005530 Bacteria 1283
45 Ga0070684_100384575 3300005535 Bacteria 1293
46 Ga0070697_100143881 3300005536 Bacteria 2006
47 Ga0068853_100158125 3300005539 Bacteria 2043
48 Ga0070695_101030754 3300005545 Bacteria 670
49 Ga0070704_100007678 3300005549 Bacteria 6429
50 Ga0070704_100421955 3300005549 Bacteria 1143
51 Ga0068855_100264787 3300005563 Bacteria 1914
52 Ga0068855_100349877 3300005563 Bacteria 1628
53 Ga0068857_100248791 3300005577 Bacteria 1629
54 Ga0068856_102442787 3300005614 Bacteria 530
55 Ga0070702_100647081 3300005615 Bacteria 799
56 Ga0068852_100307413 3300005616 Unclassified 1536
57 Ga0068864_101774835 3300005618 Bacteria 622
58 Ga0068851_10215653 3300005834 Bacteria 1076
59 Ga0068860_101161446 3300005843 Bacteria 792
60 Ga0068862_100962706 3300005844 Bacteria 842
61 Ga0075365_10879537 3300006038 Bacteria 632
62 Ga0075363_100026476 3300006048 Bacteria 2967
63 Ga0075363_100490261 3300006048 Bacteria 729
64 Ga0075364_10064318 3300006051 Bacteria 2408
65 Ga0075364_10150161 3300006051 Bacteria 1570
66 Ga0070712_100616834 3300006175 Bacteria 919
67 Ga0075362_10082303 3300006177 Bacteria 1485
68 Ga0075362_10133767 3300006177 Unclassified 1181
69 Ga0075362_10169984 3300006177 Bacteria 1053
70 Ga0075366_10040691 3300006195 Bacteria 2750
71 Ga0075366_10070858 3300006195 Bacteria 2077
72 Ga0075366_10105642 3300006195 Bacteria 1692
73 Ga0075366_10169964 3300006195 Bacteria 1322
74 Ga0075366_10977194 3300006195 Bacteria 528
75 Ga0097621_100844089 3300006237 Unclassified 851
76 Ga0075370_10013991 3300006353 Bacteria 4272
77 Ga0075370_10071840 3300006353 Bacteria 1980
78 Ga0075370_10085049 3300006353 Bacteria 1821
79 Ga0075370_10147676 3300006353 Bacteria 1377
80 Ga0075370_10745985 3300006353 Bacteria 596
81 Ga0075428_100176121 3300006844 Bacteria 2316
82 Ga0075431_102212574 3300006847 Bacteria 504
83 Ga0075434_100102730 3300006871 Bacteria 2866
84 Ga0075429_100032755 3300006880 Bacteria 4516
85 Ga0079104_1012934 3300006946 Bacteria 2597
86 Ga0099826_10043207 3300006948 Bacteria 3106
87 Ga0075435_100483446 3300007076 Bacteria 1070
88 Ga0099794_10057860 3300007265 Bacteria 1878
89 Ga0099794_10314889 3300007265 Unclassified 811
90 Ga0105240_10179381 3300009093 Bacteria 2501
91 Ga0105240_10306600 3300009093 Unclassified 1815
92 Ga0105245_10897274 3300009098 Bacteria 928
93 Ga0105247_10079951 3300009101 Bacteria 2058
94 Ga0114129_10140502 3300009147 Unclassified 3311
95 Ga0114129_10418217 3300009147 Unclassified 1764
96 Ga0105241_11131728 3300009174 Bacteria 738
97 Ga0105241_12473243 3300009174 Unclassified 520
98 Ga0105242_10043742 3300009176 Bacteria 3624
99 Ga0105248_10471580 3300009177 Bacteria 1415
100 Ga0105237_10107266 3300009545 Bacteria 2785
101 Ga0105237_10240278 3300009545 Bacteria 1812
102 Ga0105238_10239730 3300009551 Bacteria 1791
103 Ga0105238_10557434 3300009551 Bacteria 1151
104 Ga0105239_10220928 3300010375 Unclassified 2125
105 Ga0157319_1009976 3300012497 Bacteria 757
106 Ga0157347_1001144 3300012502 Bacteria 2009
107 Ga0157373_10557692 3300013100 Bacteria 831
108 Ga0157371_10029842 3300013102 Bacteria 3938
109 Ga0157370_10108752 3300013104 Unclassified 2592
110 Ga0157370_10133526 3300013104 Bacteria 2315
111 Ga0157370_10268263 3300013104 Bacteria 1577
112 Ga0157369_10003824 3300013105 Bacteria 17884
113 Ga0157369_10040312 3300013105 Bacteria 5098
114 Ga0157369_11208144 3300013105 Unclassified 772
115 Ga0157374_11429897 3300013296 Unclassified 714
116 Ga0163162_11354825 3300013306 Bacteria 809
117 Ga0157372_10056645 3300013307 Unclassified 4379
118 Ga0157375_10627682 3300013308 Bacteria 1232
119 Ga0157379_11092259 3300014968 Bacteria 764
120 Ga0157376_10409438 3300014969 Unclassified 1313
121 Ga0163161_10041221 3300017792 Bacteria 3317
122 Ga0209672_106703 3300025228 Bacteria 1845
123 Ga0209258_100402 3300025242 Bacteria 54030
124 Ga0207425_1002795 3300025245 Bacteria 5911
125 Ga0209148_1003025 3300025254 Bacteria 5011
126 Ga0209759_1002429 3300025256 Bacteria 8164
127 Ga0209129_1003895 3300025258 Bacteria 6205
128 Ga0209129_1012237 3300025258 Bacteria 1985
129 Ga0209455_1000287 3300025272 Bacteria 54030
130 Ga0209676_1000125 3300025292 Bacteria 191565
131 Ga0209676_1023026 3300025292 Bacteria 2048
132 Ga0209025_1000185 3300025294 Bacteria 155366
133 Ga0209025_1048264 3300025294 Bacteria 1728
134 Ga0209758_1024575 3300025297 Bacteria 2680
135 Ga0209050_1000012 3300025298 Bacteria 813717
136 Ga0209051_1000134 3300025303 Bacteria 138380
137 Ga0209051_1042233 3300025303 Bacteria 1613
138 Ga0209257_1000024 3300025304 Bacteria 726068
139 Ga0207656_10150444 3300025321 Bacteria 1102
140 Ga0207653_10373795 3300025885 Bacteria 558
141 Ga0207710_10081461 3300025900 Unclassified 1502
142 Ga0207699_10568666 3300025906 Unclassified 823
143 Ga0207705_10074110 3300025909 Unclassified 2470
144 Ga0207684_10023802 3300025910 Bacteria 5227
145 Ga0207707_10029806 3300025912 Bacteria 4773
146 Ga0207707_10116852 3300025912 Bacteria 2331
147 Ga0207695_10747406 3300025913 Unclassified 858
148 Ga0207695_11469461 3300025913 Unclassified 562
149 Ga0207671_10070178 3300025914 Bacteria 2611
150 Ga0207693_10415513 3300025915 Bacteria 1051
151 Ga0207660_10834923 3300025917 Bacteria 752
152 Ga0207657_11353084 3300025919 Bacteria 536
153 Ga0207652_10134369 3300025921 Bacteria 2208
154 Ga0207652_10184876 3300025921 Bacteria 1874
155 Ga0207646_10293136 3300025922 Bacteria 1470
156 Ga0207694_10541726 3300025924 Bacteria 976
157 Ga0207700_10692405 3300025928 Bacteria 909
158 Ga0207664_10444423 3300025929 Unclassified 1157
159 Ga0207644_10247337 3300025931 Bacteria 1422
160 Ga0207690_10759575 3300025932 Bacteria 800
161 Ga0207690_11348376 3300025932 Unclassified 596
162 Ga0207661_10385298 3300025944 Bacteria 1269
163 Ga0207661_10475547 3300025944 Unclassified 1140
164 Ga0207679_11260306 3300025945 Bacteria 678
165 Ga0207667_10018178 3300025949 Bacteria 7891
166 Ga0207667_10496598 3300025949 Bacteria 1238
167 Ga0207658_10043361 3300025986 Bacteria 3270
168 Ga0207658_10152768 3300025986 Bacteria 1883
169 Ga0207703_10183621 3300026035 Bacteria 1847
170 Ga0207703_10920528 3300026035 Bacteria 837
171 Ga0207639_10084971 3300026041 Bacteria 2516
172 Ga0207678_10259633 3300026067 Bacteria 1489
173 Ga0207702_10593115 3300026078 Bacteria 1087
174 Ga0207674_10231741 3300026116 Bacteria 1794
175 Ga0207675_100145714 3300026118 Unclassified 2252
176 Ga0207683_10206060 3300026121 Bacteria 1789
177 Ga0207698_10299179 3300026142 Bacteria 1497
178 Ga0209282_1109784 3300027666 Bacteria 1402
179 Ga0268266_10334985 3300028379 Bacteria 1419
180 Ga0268265_10695491 3300028380 Bacteria 982
181 Ga0307515_10029741 3300028794 Bacteria 9214
182 Ga0307408_100732353 3300031548 Bacteria 891
183 Ga0307508_10124507 3300031616 Bacteria 2180
184 Ga0316578_10139780 3300031728 Bacteria 1458
185 Ga0307516_10374893 3300031730 Unclassified 1085
186 Ga0307405_10145494 3300031731 Bacteria 1659
187 Ga0307413_10167416 3300031824 Bacteria 1551
188 Ga0307410_10535680 3300031852 Bacteria 968
189 Ga0307406_10162986 3300031901 Bacteria 1605
190 Ga0307412_10682666 3300031911 Bacteria 879
191 Ga0307414_10249110 3300032004 Bacteria 1475
192 Ga0307414_11314314 3300032004 Bacteria 671
193 Ga0307411_10081931 3300032005 Bacteria 2223
194 Ga0307415_100769493 3300032126 Bacteria 876
195 Ga0307415_101323010 3300032126 Bacteria 683
196 Ga0373929_0029337 3300035085 Bacteria 1167
197 Ga0373936_0186650 3300035113 Bacteria 911
198 Ga0373943_0054617 3300035170 Bacteria 1976
199 Ga0316574_0014072 3300035398 Bacteria 4614
200 Ga0395899_0032193 3300037312 Bacteria 3939
201 Ga0395899_0119338 3300037312 Bacteria 1890
202 Ga0395900_0000355 3300037418 Bacteria 66598
203 Ga0395900_0358356 3300037418 Bacteria 1430
204 Ga0395898_0002941 3300037466 Bacteria 19375
205 Ga0395898_0413129 3300037466 Bacteria 1286
206 Ga0395901_0116495 3300038443 Bacteria 2806
207 Ga0395901_0503010 3300038443 Bacteria 1233
208 Ga0439439_0040384 3300041406 Bacteria 1208
209 Ga0439465_0113574 3300041413 Bacteria 945
210 Ga0451797_1406017 3300041453 Bacteria 1513
211 Ga0451837_1133749 3300041494 Bacteria 954
212 Ga0451853_3872976 3300041512 Bacteria 585
213 Ga0439462_0002297 3300042015 Bacteria 4423
214 Ga0450890_058903 3300042127 Bacteria 598
215 Ga0450910_051025 3300042147 Bacteria 684
216 Ga0439446_0298128 3300042156 Bacteria 565
217 Ga0451577_0026065 3300042876 Bacteria 5297
218 Ga0451577_0037918 3300042876 Bacteria 4336
219 Ga0466969_0005436 3300044656 Bacteria 6776
220 Ga0466972_0082399 3300044658 Bacteria 1531
221 Ga0453683_0002568 3300044673 Bacteria 13991
222 Ga0453683_0553913 3300044673 Bacteria 748
223 Ga0466965_0341044 3300044683 Bacteria 819
224 Ga0466966_0054179 3300044684 Bacteria 2542
225 Ga0466961_0049569 3300044693 Bacteria 2683
226 Ga0466961_0281533 3300044693 Bacteria 1017
227 Ga0466963_0021644 3300044694 Bacteria 4059
228 Ga0466963_0083790 3300044694 Bacteria 2163
229 Ga0453684_0011431 3300044712 Bacteria 14891
230 Ga0453684_0159749 3300044712 Bacteria 2667
231 Ga0453684_0232584 3300044712 Bacteria 2127
232 Ga0466971_0378732 3300044719 Bacteria 687
233 Ga0466971_0518421 3300044719 Bacteria 589
234 Ga0466957_0018759 3300044842 Bacteria 4064
235 Ga0466957_0025488 3300044842 Bacteria 3505
236 Ga0466957_0261434 3300044842 Bacteria 1153
237 Ga0466957_0323359 3300044842 Bacteria 1041
238 Ga0466959_0006468 3300045049 Bacteria 8116
239 Ga0451576_0006103 3300045051 Bacteria 14853
240 Ga0451576_0018759 3300045051 Bacteria 7565
241 Ga0451576_0489095 3300045051 Unclassified 1293
242 Ga0451576_1432429 3300045051 Unclassified 718
243 Ga0466958_0193370 3300045836 Bacteria 1293
244 Ga0495590_0013064 3300046457 Bacteria 3062
245 Ga0495650_0004720 3300046471 Bacteria 9179
246 Ga0495642_0429309 3300046528 Unclassified 583
247 Ga0495621_0265731 3300046539 Bacteria 704
248 Ga0495660_0080462 3300046810 Bacteria 1709
249 Ga0496101_0044171 3300048904 Bacteria 3188
250 Ga0496102_0030915 3300048905 Bacteria 4796
251 Ga0496103_0018574 3300048906 Bacteria 4171
252 Ga0496104_0012248 3300048907 Bacteria 7708
253 Ga0496105_0101686 3300048908 Bacteria 2373
254 Ga0496105_0578148 3300048908 Bacteria 874
255 Ga0496106_0060166 3300048909 Bacteria 2879
256 Ga0496107_0170169 3300048910 Unclassified 1616
257 Ga0496108_0183377 3300048911 Bacteria 1813
258 Ga0496108_0793453 3300048911 Unclassified 817
259 Ga0496109_0040251 3300048912 Bacteria 4233
260 Ga0496110_0039694 3300048913 Bacteria 4099
261 Ga0496110_0350672 3300048913 Bacteria 1344
262 Ga0496111_0054218 3300048914 Bacteria 2898
263 Ga0496113_0062682 3300048916 Bacteria 2808
264 Ga0496113_0851118 3300048916 Unclassified 723
265 Ga0496114_0003626 3300048917 Bacteria 11871
266 Ga0496114_0453669 3300048917 Bacteria 1135
267 Ga0496116_0029320 3300048919 Bacteria 3970
268 Ga0496125_0023274 3300048928 Bacteria 5722
269 Ga0496126_0022327 3300048929 Bacteria 6160
270 Ga0496126_0110755 3300048929 Bacteria 2391
271 Ga0501031_0031765 3300049568 Bacteria 3444
272 Ga0501031_0061872 3300049568 Bacteria 2439
273 Ga0501032_0063837 3300049569 Bacteria 2465
274 Ga0501032_0071933 3300049569 Bacteria 2304
275 Ga0501032_0253708 3300049569 Bacteria 1141
276 Ga0501032_0818800 3300049569 Bacteria 588
277 Ga0501033_0015447 3300049570 Bacteria 5790
278 Ga0501033_0170840 3300049570 Bacteria 1561
279 Ga0501034_0000344 3300049571 Bacteria 80851
280 Ga0501034_0011025 3300049571 Bacteria 9383
281 Ga0501034_0047128 3300049571 Bacteria 4354
282 Ga0501034_0098072 3300049571 Bacteria 2926
283 Ga0501034_0120561 3300049571 Bacteria 2609
284 Ga0501034_0151877 3300049571 Bacteria 2291
285 Ga0501034_0229817 3300049571 Bacteria 1804
286 Ga0501036_0025638 3300049572 Bacteria 4976
287 Ga0501036_0060744 3300049572 Bacteria 3201
288 Ga0501036_0104699 3300049572 Bacteria 2392
289 Ga0501036_0572761 3300049572 Bacteria 938
290 Ga0501037_0007041 3300049573 Bacteria 8212
291 Ga0501037_0060588 3300049573 Bacteria 2760
292 Ga0501037_0136433 3300049573 Bacteria 1757
293 Ga0501037_0167515 3300049573 Bacteria 1563
294 Ga0501037_0467149 3300049573 Unclassified 859
295 Ga0501038_0035429 3300049574 Bacteria 4381
296 Ga0501038_0046820 3300049574 Bacteria 3748
297 Ga0501038_0416473 3300049574 Bacteria 1037
298 Ga0501039_0089728 3300049575 Bacteria 2395
299 Ga0501039_0860014 3300049575 Bacteria 706
300 Ga0501043_0010447 3300049579 Bacteria 7272
301 Ga0501043_0021166 3300049579 Bacteria 5098
302 Ga0501043_0038895 3300049579 Bacteria 3740
303 Ga0501043_0060779 3300049579 Bacteria 2966
304 Ga0501043_0271811 3300049579 Bacteria 1301
305 Ga0501043_0757334 3300049579 Bacteria 705
306 Ga0501046_0007824 3300049580 Bacteria 9379
307 Ga0501046_0023556 3300049580 Bacteria 5063
308 Ga0501046_0042048 3300049580 Bacteria 3644
309 Ga0501046_0696298 3300049580 Bacteria 716
310 Ga0501046_0785949 3300049580 Bacteria 667
311 Ga0501047_0001809 3300049581 Bacteria 20651
312 Ga0501047_0050094 3300049581 Bacteria 4032
313 Ga0501047_0058759 3300049581 Bacteria 3714
314 Ga0501047_0162020 3300049581 Bacteria 2108
315 Ga0501047_0230393 3300049581 Bacteria 1706
316 Ga0501047_0296409 3300049581 Bacteria 1460
317 Ga0501048_0135691 3300049582 Bacteria 1739
318 Ga0501067_0120148 3300049583 Bacteria 1462
319 Ga0501068_0050119 3300049584 Bacteria 2523
320 Ga0501068_0574886 3300049584 Bacteria 733
321 Ga0501069_0133675 3300049585 Bacteria 1421
322 Ga0501069_0550275 3300049585 Bacteria 690
323 Ga0501070_0009597 3300049586 Bacteria 8175
324 Ga0501070_0185012 3300049586 Bacteria 1713
325 Ga0501070_0493785 3300049586 Bacteria 984
326 Ga0501070_0616930 3300049586 Bacteria 863
327 Ga0501071_0034957 3300049587 Bacteria 3578
328 Ga0501072_0099205 3300049588 Bacteria 2315
329 Ga0501073_0036345 3300049589 Bacteria 3500
330 Ga0501073_0120965 3300049589 Bacteria 1814
331 Ga0501074_0070937 3300049590 Bacteria 2504
332 Ga0501074_0108712 3300049590 Bacteria 1984
333 Ga0501074_0122845 3300049590 Bacteria 1857
334 Ga0501079_0023209 3300049741 Bacteria 4763
335 Ga0501079_0042247 3300049741 Bacteria 3521
336 Ga0501079_0062367 3300049741 Bacteria 2876
337 Ga0501080_0025235 3300049742 Bacteria 5516
338 Ga0501080_0048725 3300049742 Bacteria 3942
339 Ga0501080_0249704 3300049742 Bacteria 1618
340 Ga0501080_0733944 3300049742 Bacteria 869
341 Ga0501083_0156546 3300049744 Bacteria 1491
342 Ga0501035_0164174 3300049822 Bacteria 1921
343 Ga0501035_0204192 3300049822 Bacteria 1693
344 Ga0501044_0002363 3300049823 Bacteria 21502
345 Ga0501044_0034298 3300049823 Bacteria 5323
346 Ga0501044_0096659 3300049823 Bacteria 2975
347 Ga0501044_0283173 3300049823 Bacteria 1590
348 Ga0501044_0296010 3300049823 Bacteria 1548
349 Ga0501044_0464394 3300049823 Unclassified 1171
350 Ga0501044_0775379 3300049823 Bacteria 839
351 Ga0501045_0181303 3300049824 Bacteria 1569
352 nmdc:mga03683_116385_c1 3300050489 Unclassified 1186
353 nmdc:mga03683_16880_c1 3300050489 Bacteria 2753
354 nmdc:mga03683_319782_c1 3300050489 Bacteria 730
355 nmdc:mga03683_71373_c1 3300050489 Bacteria 1485
356 nmdc:mga03n38_293168_c1 3300050490 Bacteria 872
357 nmdc:mga00v17_372244_c1 3300050491 Bacteria 929
358 nmdc:mga00v17_54415_c1 3300050491 Bacteria 2441
359 nmdc:mga0k408_114234_c1 3300050493 Bacteria 1597
360 nmdc:mga0k408_119804_c1 3300050493 Bacteria 1558
361 nmdc:mga0k408_154879_c1 3300050493 Bacteria 1365
362 nmdc:mga0k408_569865_c1 3300050493 Bacteria 669
363 nmdc:mga0k408_91854_c1 3300050493 Bacteria 1784
364 nmdc:mga07m45_714617_c1 3300050496 Bacteria 576
365 nmdc:mga07m45_83641_c1 3300050496 Bacteria 1824
366 nmdc:mga05p37_507184_c1 3300050507 Bacteria 1383
367 nmdc:mga05p37_722487_c1 3300050507 Bacteria 1103
368 nmdc:mga06r32_1890669_c1 3300050510 Bacteria 531
369 nmdc:mga0n895_99608_c1 3300050512 Unclassified 2914
370 nmdc:mga0rr50_443961_c1 3300050513 Bacteria 1099
371 Ga0500610_0094790 3300053079 Bacteria 1548
372 Ga0500569_194802 3300053109 Unclassified 689
373 Ga0500568_0000319 3300053139 Bacteria 38374
374 Ga0500568_0098876 3300053139 Unclassified 1096
375 Ga0500574_054052 3300053141 Bacteria 1154
376 Ga0500577_0180691 3300053142 Unclassified 905
377 Ga0500604_0045098 3300053151 Bacteria 1344
378 Ga0500636_0398819 3300053177 Unclassified 639
379 Ga0501084_0062116 3300054114 Bacteria 3127
380 Ga0501082_1069466 3300060353 Bacteria 705
381 Ga0466962_0034586 3300061719 Bacteria 2419
382 Ga0466962_0090672 3300061719 Bacteria 1464
383 2538835235 2537561836 Bacteria 3910579
384 2643896214 2643221577 Bacteria 3710843
385 2643915965 2643221581 Bacteria 3893603
386 2819600263 2818991446 Bacteria 7757362
387 2838059781 2838054893 Bacteria 7451788
388 2842677664 2842677519 Bacteria 5615038
389 2923518505 2923516293 Bacteria 3716336
390 2928041487 2928037797 Bacteria 7273642
391 2928048329 2928044640 Bacteria 7271509
392 2928066350 2928064002 Bacteria 7419480
393 2941479765
394 2945946250 2945945610 Bacteria 5951079
395 2945975852 2945972063 Bacteria 6086495
396 Ga0500616_0117313
397 JGI25151J46595_10002277
398 JGI25151J46595_10005591
399 JGI25151J46595_10019468
400 JGI25153J46596_10031398
401 rootH2_10081404
402 rootL2_10263046
403 rootH1_10396887
404 Ga0055535_1000276
405 Ga0055529_1000324
406 Ga0055536_1021225
407 Ga0055530_10002760
408 Ga0055540_1010233
409 Ga0055540_1023347
410 Ga0055531_10006381
411 Ga0065714_10157345
412 Ga0065704_10085849
413 Ga0065707_10085342
414 Ga0070658_10139214
415 Ga0070683_100155576
416 Ga0070683_100179115
417 Ga0070680_101075415
418 Ga0070660_101741032
419 Ga0070674_100142362
420 Ga0070673_100311794
421 Ga0070659_100143099
422 Ga0070667_100022327
423 Ga0070714_100591532
424 Ga0070714_101096178
425 Ga0070713_101244291
426 Ga0070701_10725515
427 Ga0070708_100307559
428 Ga0070663_100249964
429 Ga0070678_100324083
430 Ga0070681_10006194
431 Ga0070685_10216974
432 Ga0070706_100193133
433 Ga0070707_100351351
434 Ga0070707_101925211
435 Ga0070698_100304154
436 Ga0070698_101723222
437 Ga0070679_100226801
438 Ga0070679_100355669
439 Ga0070679_100419664
440 Ga0070684_100384575
441 Ga0070697_100143881
442 Ga0068853_100158125
443 Ga0070695_101030754
444 Ga0070704_100007678
445 Ga0070704_100421955
446 Ga0068855_100264787
447 Ga0068855_100349877
448 Ga0068857_100248791
449 Ga0068856_102442787
450 Ga0070702_100647081
451 Ga0068852_100307413
452 Ga0068864_101774835
453 Ga0068851_10215653
454 Ga0068860_101161446
455 Ga0068862_100962706
456 Ga0075365_10879537
457 Ga0075363_100026476
458 Ga0075363_100490261
459 Ga0075364_10064318
460 Ga0075364_10150161
461 Ga0070712_100616834
462 Ga0075362_10082303
463 Ga0075362_10133767
464 Ga0075362_10169984
465 Ga0075366_10040691
466 Ga0075366_10070858
467 Ga0075366_10105642
468 Ga0075366_10169964
469 Ga0075366_10977194
470 Ga0097621_100844089
471 Ga0075370_10013991
472 Ga0075370_10071840
473 Ga0075370_10085049
474 Ga0075370_10147676
475 Ga0075370_10745985
476 Ga0075428_100176121
477 Ga0075431_102212574
478 Ga0075434_100102730
479 Ga0075429_100032755
480 Ga0079104_1012934
481 Ga0099826_10043207
482 Ga0075435_100483446
483 Ga0099794_10057860
484 Ga0099794_10314889
485 Ga0105240_10179381
486 Ga0105240_10306600
487 Ga0105245_10897274
488 Ga0105247_10079951
489 Ga0114129_10140502
490 Ga0114129_10418217
491 Ga0105241_11131728
492 Ga0105241_12473243
493 Ga0105242_10043742
494 Ga0105248_10471580
495 Ga0105237_10107266
496 Ga0105237_10240278
497 Ga0105238_10239730
498 Ga0105238_10557434
499 Ga0105239_10220928
500 Ga0157319_1009976
501 Ga0157347_1001144
502 Ga0157373_10557692
503 Ga0157371_10029842
504 Ga0157370_10108752
505 Ga0157370_10133526
506 Ga0157370_10268263
507 Ga0157369_10003824
508 Ga0157369_10040312
509 Ga0157369_11208144
510 Ga0157374_11429897
511 Ga0163162_11354825
512 Ga0157372_10056645
513 Ga0157375_10627682
514 Ga0157379_11092259
515 Ga0157376_10409438
516 Ga0163161_10041221
517 Ga0209672_106703
518 Ga0209258_100402
519 Ga0207425_1002795
520 Ga0209148_1003025
521 Ga0209759_1002429
522 Ga0209129_1003895
523 Ga0209129_1012237
524 Ga0209455_1000287
525 Ga0209676_1000125
526 Ga0209676_1023026
527 Ga0209025_1000185
528 Ga0209025_1048264
529 Ga0209758_1024575
530 Ga0209050_1000012
531 Ga0209051_1000134
532 Ga0209051_1042233
533 Ga0209257_1000024
534 Ga0207656_10150444
535 Ga0207653_10373795
536 Ga0207710_10081461
537 Ga0207699_10568666
538 Ga0207705_10074110
539 Ga0207684_10023802
540 Ga0207707_10029806
541 Ga0207707_10116852
542 Ga0207695_10747406
543 Ga0207695_11469461
544 Ga0207671_10070178
545 Ga0207693_10415513
546 Ga0207660_10834923
547 Ga0207657_11353084
548 Ga0207652_10134369
549 Ga0207652_10184876
550 Ga0207646_10293136
551 Ga0207694_10541726
552 Ga0207700_10692405
553 Ga0207664_10444423
554 Ga0207644_10247337
555 Ga0207690_10759575
556 Ga0207690_11348376
557 Ga0207661_10385298
558 Ga0207661_10475547
559 Ga0207679_11260306
560 Ga0207667_10018178
561 Ga0207667_10496598
562 Ga0207658_10043361
563 Ga0207658_10152768
564 Ga0207703_10183621
565 Ga0207703_10920528
566 Ga0207639_10084971
567 Ga0207678_10259633
568 Ga0207702_10593115
569 Ga0207674_10231741
570 Ga0207675_100145714
571 Ga0207683_10206060
572 Ga0207698_10299179
573 Ga0209282_1109784
574 Ga0268266_10334985
575 Ga0268265_10695491
576 Ga0307515_10029741
577 Ga0307408_100732353
578 Ga0307508_10124507
579 Ga0316578_10139780
580 Ga0307516_10374893
581 Ga0307405_10145494
582 Ga0307413_10167416
583 Ga0307410_10535680
584 Ga0307406_10162986
585 Ga0307412_10682666
586 Ga0307414_10249110
587 Ga0307414_11314314
588 Ga0307411_10081931
589 Ga0307415_100769493
590 Ga0307415_101323010
591 Ga0373929_0029337
592 Ga0373936_0186650
593 Ga0373943_0054617
594 Ga0316574_0014072
595 Ga0395899_0032193
596 Ga0395899_0119338
597 Ga0395900_0000355
598 Ga0395900_0358356
599 Ga0395898_0002941
600 Ga0395898_0413129
601 Ga0395901_0116495
602 Ga0395901_0503010
603 Ga0439439_0040384
604 Ga0439465_0113574
605 Ga0451797_1406017
606 Ga0451837_1133749
607 Ga0451853_3872976
608 Ga0439462_0002297
609 Ga0450890_058903
610 Ga0450910_051025
611 Ga0439446_0298128
612 Ga0451577_0026065
613 Ga0451577_0037918
614 Ga0466969_0005436
615 Ga0466972_0082399
616 Ga0453683_0002568
617 Ga0453683_0553913
618 Ga0466965_0341044
619 Ga0466966_0054179
620 Ga0466961_0049569
621 Ga0466961_0281533
622 Ga0466963_0021644
623 Ga0466963_0083790
624 Ga0453684_0011431
625 Ga0453684_0159749
626 Ga0453684_0232584
627 Ga0466971_0378732
628 Ga0466971_0518421
629 Ga0466957_0018759
630 Ga0466957_0025488
631 Ga0466957_0261434
632 Ga0466957_0323359
633 Ga0466959_0006468
634 Ga0451576_0006103
635 Ga0451576_0018759
636 Ga0451576_0489095
637 Ga0451576_1432429
638 Ga0466958_0193370
639 Ga0495590_0013064
640 Ga0495650_0004720
641 Ga0495642_0429309
642 Ga0495621_0265731
643 Ga0495660_0080462
644 Ga0496101_0044171
645 Ga0496102_0030915
646 Ga0496103_0018574
647 Ga0496104_0012248
648 Ga0496105_0101686
649 Ga0496105_0578148
650 Ga0496106_0060166
651 Ga0496107_0170169
652 Ga0496108_0183377
653 Ga0496108_0793453
654 Ga0496109_0040251
655 Ga0496110_0039694
656 Ga0496110_0350672
657 Ga0496111_0054218
658 Ga0496113_0062682
659 Ga0496113_0851118
660 Ga0496114_0003626
661 Ga0496114_0453669
662 Ga0496116_0029320
663 Ga0496125_0023274
664 Ga0496126_0022327
665 Ga0496126_0110755
666 Ga0501031_0031765
667 Ga0501031_0061872
668 Ga0501032_0063837
669 Ga0501032_0071933
670 Ga0501032_0253708
671 Ga0501032_0818800
672 Ga0501033_0015447
673 Ga0501033_0170840
674 Ga0501034_0000344
675 Ga0501034_0011025
676 Ga0501034_0047128
677 Ga0501034_0098072
678 Ga0501034_0120561
679 Ga0501034_0151877
680 Ga0501034_0229817
681 Ga0501036_0025638
682 Ga0501036_0060744
683 Ga0501036_0104699
684 Ga0501036_0572761
685 Ga0501037_0007041
686 Ga0501037_0060588
687 Ga0501037_0136433
688 Ga0501037_0167515
689 Ga0501037_0467149
690 Ga0501038_0035429
691 Ga0501038_0046820
692 Ga0501038_0416473
693 Ga0501039_0089728
694 Ga0501039_0860014
695 Ga0501043_0010447
696 Ga0501043_0021166
697 Ga0501043_0038895
698 Ga0501043_0060779
699 Ga0501043_0271811
700 Ga0501043_0757334
701 Ga0501046_0007824
702 Ga0501046_0023556
703 Ga0501046_0042048
704 Ga0501046_0696298
705 Ga0501046_0785949
706 Ga0501047_0001809
707 Ga0501047_0050094
708 Ga0501047_0058759
709 Ga0501047_0162020
710 Ga0501047_0230393
711 Ga0501047_0296409
712 Ga0501048_0135691
713 Ga0501067_0120148
714 Ga0501068_0050119
715 Ga0501068_0574886
716 Ga0501069_0133675
717 Ga0501069_0550275
718 Ga0501070_0009597
719 Ga0501070_0185012
720 Ga0501070_0493785
721 Ga0501070_0616930
722 Ga0501071_0034957
723 Ga0501072_0099205
724 Ga0501073_0036345
725 Ga0501073_0120965
726 Ga0501074_0070937
727 Ga0501074_0108712
728 Ga0501074_0122845
729 Ga0501079_0023209
730 Ga0501079_0042247
731 Ga0501079_0062367
732 Ga0501080_0025235
733 Ga0501080_0048725
734 Ga0501080_0249704
735 Ga0501080_0733944
736 Ga0501083_0156546
737 Ga0501035_0164174
738 Ga0501035_0204192
739 Ga0501044_0002363
740 Ga0501044_0034298
741 Ga0501044_0096659
742 Ga0501044_0283173
743 Ga0501044_0296010
744 Ga0501044_0464394
745 Ga0501044_0775379
746 Ga0501045_0181303
747 nmdc:mga03683_116385_c1
748 nmdc:mga03683_16880_c1
749 nmdc:mga03683_319782_c1
750 nmdc:mga03683_71373_c1
751 nmdc:mga03n38_293168_c1
752 nmdc:mga00v17_372244_c1
753 nmdc:mga00v17_54415_c1
754 nmdc:mga0k408_114234_c1
755 nmdc:mga0k408_119804_c1
756 nmdc:mga0k408_154879_c1
757 nmdc:mga0k408_569865_c1
758 nmdc:mga0k408_91854_c1
759 nmdc:mga07m45_714617_c1
760 nmdc:mga07m45_83641_c1
761 nmdc:mga05p37_507184_c1
762 nmdc:mga05p37_722487_c1
763 nmdc:mga06r32_1890669_c1
764 nmdc:mga0n895_99608_c1
765 nmdc:mga0rr50_443961_c1
766 Ga0500610_0094790
767 Ga0500569_194802
768 Ga0500568_0000319
769 Ga0500568_0098876
770 Ga0500574_054052
771 Ga0500577_0180691
772 Ga0500604_0045098
773 Ga0500636_0398819
774 Ga0501084_0062116
775 Ga0501082_1069466
776 Ga0466962_0034586
777 Ga0466962_0090672
778 2538835235
779 2643896214
780 2643915965
781 2819600263
782 2838059781
783 2842677664
784 2923518505
785 2928041487
786 2928048329
787 2928066350
788 2941479765
789 2945946250
790 2945975852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hsb-assembly1.cif.gz_A crystal structure of a hepn domain containing protein (af_0298) from archaeoglobus fulgidus at 1.95 a resolution 0.8243 24 134
1wol-assembly1.cif.gz_A crystal structure of st0689, an archaeal hepn homologue 0.7802 25 134
2hsb-assembly1.cif.gz_A crystal structure of a hepn domain containing protein (af_0298) from archaeoglobus fulgidus at 1.95 a resolution 0.7317 24 134
1wol-assembly1.cif.gz_A crystal structure of st0689, an archaeal hepn homologue 0.7064 25 134
1v9s-assembly1.cif.gz_C crystal structure of tt0130 protein from thermus thermophilus hb8 0.6881 28 66
ID Description Score Start End Superfamily
af_Q58022_9_132_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.8508 21 134 1.20.120.330
af_Q57607_11_134_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.8222 23 134 1.20.120.330
2hsbA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.8173 24 134 1.20.120.330
af_Q58022_9_132_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7836 21 134 1.20.120.330
1wolA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7802 25 134 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A2V6YZQ6-F1-model_v4 HEPN domain-containing protein 0.9895 1 138
AF-A0A2V7E468-F1-model_v4 HEPN domain-containing protein 0.9861 1 138
AF-A0A1M4JK12-F1-model_v4 HEPN domain-containing protein 0.9814 1 90
AF-A0A208YDL7-F1-model_v4 HEPN domain-containing protein 0.9757 3 142
AF-A0A2V6YZQ6-F1-model_v4 HEPN domain-containing protein 0.9755 1 138

Map