F433370

General Info

Members Datasets Scaffolds Average Seq Length
395 246 340 172

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991472|2819739978
Length 172
Sequence AAPRRIIVLRHAKADWPQVDDHERPLAERGRAEAPVAGQWLADSGINPEYVLCSTSVRTRETWKLAAHELPKRQRRTVFEKRIYDATAGEIIEVLKETPGDVADLLLVGHNPGVQNLVEVLAGDESLGDELNQLRQRGFPTAGIAVLTFDGAWDGVEPGVGRLVSYYVPSVD

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
6 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
7 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
8 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
9 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
10 2643221714 Streptomyces sp. Root264 Isolate Unclassified
11 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
12 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
13 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
14 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
15 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
16 2808606448 Streptomyces sp. 193411 Isolate Unclassified
17 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
18 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
19 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
20 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
21 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
22 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
23 2862574272 Streptomyces sp. AcE210 Isolate Nodule
24 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
25 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
26 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
27 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
28 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
29 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
30 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
31 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
32 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
33 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
34 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
35 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
36 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
37 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
38 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
39 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
40 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
41 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
42 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
43 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
44 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
45 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
46 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
47 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
50 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
73 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
88 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
89 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
92 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
95 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
96 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
97 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
98 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
99 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
100 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
101 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
102 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
103 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
104 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
105 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
201 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
231 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
232 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
233 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
234 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
235 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
236 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
237 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
240 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
241 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
242 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
243 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
244 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
245 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
246 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.06
Metatranscriptomes 1.01
Isolates 13.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.3
Nodule 0.76
Rhizoplane 0.76
Rhizosphere 80.51
Stem 0
Stem Tuber 0
Unclassified 13.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10038355 3300003323 Bacteria 1923
2 Ga0006562J51391_1148722 3300003578 Bacteria 1056
3 Ga0058863_11555964 3300004799 Bacteria 1030
4 Ga0068855_100835761 3300005563 Bacteria 977
5 Ga0068856_100616844 3300005614 Bacteria 1105
6 Ga0075365_10060740 3300006038 Bacteria 2522
7 Ga0099826_10072679 3300006948 Bacteria 2176
8 Ga0105244_10335808 3300009036 Bacteria 697
9 Ga0105250_10204772 3300009092 Bacteria 833
10 Ga0105243_10509815 3300009148 Bacteria 1142
11 Ga0105246_10008105 3300011119 Bacteria 6446
12 Ga0105246_10107509 3300011119 Bacteria 2043
13 Ga0157374_10563825 3300013296 Bacteria 1147
14 Ga0157378_10898513 3300013297 Bacteria 916
15 Ga0157372_10272931 3300013307 Bacteria 1965
16 Ga0157375_10282902 3300013308 Bacteria 1822
17 Ga0157375_11062564 3300013308 Bacteria 947
18 Ga0182007_10002461 3300015262 Bacteria 9200
19 Ga0206350_10039647 3300020080 Bacteria 997
20 Ga0209758_1001711 3300025297 Bacteria 24587
21 Ga0207426_1008744 3300025302 Bacteria 4057
22 Ga0207647_10062687 3300025904 Bacteria 2264
23 Ga0207709_10264446 3300025935 Bacteria 1263
24 Ga0207667_11286337 3300025949 Bacteria 708
25 Ga0207702_10577410 3300026078 Bacteria 1102
26 Ga0307515_10001938 3300028794 Bacteria 45899
27 Ga0307515_10102684 3300028794 Bacteria 3436
28 Ga0307515_10329900 3300028794 Bacteria 1185
29 Ga0307511_10001602 3300030521 Bacteria 24022
30 Ga0307511_10036891 3300030521 Bacteria 4234
31 Ga0307512_10003044 3300030522 Bacteria 20110
32 Ga0307512_10112747 3300030522 Bacteria 1782
33 Ga0307513_10014188 3300031456 Bacteria 9746
34 Ga0307513_10072289 3300031456 Bacteria 3595
35 Ga0307509_10037676 3300031507 Bacteria 5284
36 Ga0307509_10044886 3300031507 Bacteria 4771
37 Ga0307508_10020052 3300031616 Bacteria 6071
38 Ga0307508_10119784 3300031616 Bacteria 2234
39 Ga0307508_10122466 3300031616 Bacteria 2204
40 Ga0307514_10229642 3300031649 Bacteria 1126
41 Ga0307516_10016823 3300031730 Bacteria 7637
42 Ga0307516_10187552 3300031730 Bacteria 1797
43 Ga0307405_10362822 3300031731 Bacteria 1122
44 Ga0307413_10793184 3300031824 Bacteria 795
45 Ga0307413_10988169 3300031824 Bacteria 721
46 Ga0307518_10066062 3300031838 Bacteria 2624
47 Ga0307518_10289990 3300031838 Bacteria 1004
48 Ga0307411_10210190 3300032005 Bacteria 1502
49 Ga0307507_10023632 3300033179 Bacteria 6736
50 Ga0307507_10027163 3300033179 Bacteria 6144
51 Ga0307507_10087180 3300033179 Bacteria 2701
52 Ga0307510_10038769 3300033180 Bacteria 5261
53 Ga0307510_10083275 3300033180 Bacteria 3089
54 Ga0307510_10161436 3300033180 Bacteria 1837
55 Ga0307510_10184969 3300033180 Bacteria 1640
56 Ga0395900_0498284 3300037418 Bacteria 1169
57 Ga0395898_0060337 3300037466 Bacteria 3686
58 Ga0439439_0005190 3300041406 Bacteria 2966
59 Ga0451797_1473813 3300041453 Bacteria 749
60 Ga0451837_0093746 3300041494 Bacteria 4403
61 Ga0451853_0129212 3300041512 Bacteria 1305
62 Ga0451853_0830621 3300041512 Bacteria 3576
63 Ga0451853_3973150 3300041512 Bacteria 3450
64 Ga0439433_0005573 3300041999 Bacteria 2702
65 Ga0439442_019406 3300042002 Bacteria 1407
66 Ga0439442_075704 3300042002 Bacteria 718
67 Ga0439448_0007349 3300042005 Bacteria 3190
68 Ga0439448_0079880 3300042005 Bacteria 1097
69 Ga0439432_047017 3300042006 Bacteria 1354
70 Ga0439449_0001580 3300042007 Bacteria 8934
71 Ga0439449_0039849 3300042007 Bacteria 1746
72 Ga0439449_0129089 3300042007 Bacteria 939
73 Ga0439455_0003765 3300042012 Bacteria 2933
74 Ga0439457_001591 3300042014 Bacteria 6767
75 Ga0450894_000002 3300042131 Bacteria 41005
76 Ga0450898_021244 3300042134 Bacteria 1142
77 Ga0450899_000190 3300042135 Bacteria 6243
78 Ga0450900_005944 3300042136 Bacteria 1459
79 Ga0450900_012499 3300042136 Bacteria 1113
80 Ga0450903_001476 3300042138 Bacteria 4381
81 Ga0450906_005969 3300042145 Bacteria 2478
82 Ga0439458_0001227 3300042157 Bacteria 6485
83 Ga0450908_010378 3300042184 Bacteria 1719
84 Ga0466969_0232086 3300044656 Bacteria 838
85 Ga0466972_0001074 3300044658 Bacteria 13093
86 Ga0466972_0003128 3300044658 Bacteria 8218
87 Ga0466972_0023993 3300044658 Bacteria 3029
88 Ga0466972_0073038 3300044658 Bacteria 1635
89 Ga0466972_0083266 3300044658 Bacteria 1522
90 Ga0466972_0272896 3300044658 Bacteria 790
91 Ga0466965_0000187 3300044683 Bacteria 19207
92 Ga0466965_0160394 3300044683 Bacteria 1179
93 Ga0466965_0567778 3300044683 Bacteria 642
94 Ga0466966_0005061 3300044684 Bacteria 8661
95 Ga0466966_0011228 3300044684 Bacteria 5942
96 Ga0466966_0111139 3300044684 Bacteria 1689
97 Ga0466961_0003265 3300044693 Bacteria 10098
98 Ga0466961_0004606 3300044693 Bacteria 8656
99 Ga0466961_0393302 3300044693 Bacteria 841
100 Ga0466963_0000660 3300044694 Bacteria 16639
101 Ga0466963_0007521 3300044694 Bacteria 6499
102 Ga0466964_0020215 3300044706 Bacteria 2562
103 Ga0466964_0188831 3300044706 Bacteria 982
104 Ga0466971_0009720 3300044719 Bacteria 4198
105 Ga0466971_0089925 3300044719 Bacteria 1405
106 Ga0466968_0127330 3300044735 Bacteria 1156
107 Ga0466970_0001067 3300044765 Bacteria 13269
108 Ga0466970_0025317 3300044765 Bacteria 3106
109 Ga0466970_0172332 3300044765 Bacteria 1199
110 Ga0466957_0003790 3300044842 Bacteria 8356
111 Ga0466957_0506796 3300044842 Bacteria 837
112 Ga0466960_0037526 3300044901 Bacteria 2273
113 Ga0466960_0134885 3300044901 Bacteria 1306
114 Ga0466959_0003279 3300045049 Bacteria 10551
115 Ga0466958_0006249 3300045836 Bacteria 6467
116 Ga0466958_0065921 3300045836 Bacteria 2210
117 Ga0466967_0086637 3300045976 Bacteria 2838
118 Ga0466967_1178641 3300045976 Bacteria 763
119 Ga0495592_0004317 3300046454 Bacteria 10399
120 Ga0495592_0016184 3300046454 Bacteria 5658
121 Ga0495592_0019216 3300046454 Bacteria 5198
122 Ga0495603_0011321 3300046455 Bacteria 5403
123 Ga0495603_0013867 3300046455 Bacteria 4877
124 Ga0495603_0189406 3300046455 Bacteria 1189
125 Ga0495603_0209238 3300046455 Bacteria 1126
126 Ga0495603_0297858 3300046455 Bacteria 926
127 Ga0495590_0110158 3300046457 Bacteria 982
128 Ga0495629_0007772 3300046459 Bacteria 7891
129 Ga0495629_0022215 3300046459 Bacteria 4524
130 Ga0495629_0233535 3300046459 Bacteria 1267
131 Ga0495638_0060610 3300046460 Bacteria 2340
132 Ga0495651_0003166 3300046462 Bacteria 12675
133 Ga0495651_0030588 3300046462 Bacteria 4198
134 Ga0495651_0039707 3300046462 Bacteria 3663
135 Ga0495653_0461003 3300046463 Bacteria 798
136 Ga0495580_0462337 3300046472 Bacteria 850
137 Ga0495582_0024112 3300046473 Bacteria 3327
138 Ga0495605_0050382 3300046474 Bacteria 2031
139 Ga0495639_0012047 3300046475 Bacteria 3729
140 Ga0495662_0000925 3300046476 Bacteria 14359
141 Ga0495662_0144028 3300046476 Bacteria 1173
142 Ga0495662_0246728 3300046476 Bacteria 879
143 Ga0495664_0000664 3300046477 Bacteria 17513
144 Ga0495664_0349851 3300046477 Bacteria 890
145 Ga0495584_0227961 3300046491 Bacteria 947
146 Ga0495585_0036468 3300046492 Bacteria 2772
147 Ga0495585_0066694 3300046492 Bacteria 1970
148 Ga0495594_0097906 3300046499 Bacteria 1648
149 Ga0495594_0099162 3300046499 Bacteria 1638
150 Ga0495594_0216411 3300046499 Bacteria 1092
151 Ga0495596_0011437 3300046500 Bacteria 3831
152 Ga0495607_0030069 3300046501 Bacteria 3338
153 Ga0495583_0092036 3300046506 Bacteria 1304
154 Ga0495606_0072602 3300046507 Bacteria 2161
155 Ga0495610_0046203 3300046512 Bacteria 2150
156 Ga0495616_0015848 3300046513 Bacteria 4180
157 Ga0495618_0052303 3300046514 Bacteria 2581
158 Ga0495628_0075606 3300046516 Bacteria 2623
159 Ga0495630_0028469 3300046517 Bacteria 4151
160 Ga0495630_0224306 3300046517 Bacteria 1435
161 Ga0495630_0236518 3300046517 Bacteria 1396
162 Ga0495631_0018108 3300046518 Bacteria 3319
163 Ga0495631_0211368 3300046518 Bacteria 829
164 Ga0495632_0327327 3300046519 Bacteria 676
165 Ga0495637_0101898 3300046520 Bacteria 1121
166 Ga0495643_0032612 3300046522 Bacteria 2889
167 Ga0495648_0058735 3300046524 Bacteria 2298
168 Ga0495666_0033637 3300046526 Bacteria 2503
169 Ga0495666_0086570 3300046526 Bacteria 1480
170 Ga0495652_0116495 3300046529 Bacteria 2139
171 Ga0495665_0269944 3300046531 Bacteria 874
172 Ga0495640_0020207 3300046533 Bacteria 4905
173 Ga0495640_0136235 3300046533 Bacteria 1585
174 Ga0495586_0078123 3300046535 Bacteria 1815
175 Ga0495587_0019200 3300046536 Bacteria 4234
176 Ga0495587_0523963 3300046536 Bacteria 654
177 Ga0495609_0074591 3300046538 Bacteria 1487
178 Ga0495597_0053072 3300046542 Bacteria 1783
179 Ga0495645_0016583 3300046543 Bacteria 5264
180 Ga0495645_0063154 3300046543 Bacteria 2682
181 Ga0495622_0054419 3300046557 Bacteria 1856
182 Ga0495633_0055207 3300046558 Bacteria 1867
183 Ga0495633_0107781 3300046558 Bacteria 1292
184 Ga0495667_0176927 3300046559 Bacteria 1370
185 Ga0495667_0294938 3300046559 Bacteria 1028
186 Ga0495668_0042996 3300046616 Bacteria 2513
187 Ga0495634_0000101 3300046642 Bacteria 70643
188 Ga0495634_0052494 3300046642 Bacteria 2732
189 Ga0495634_0410983 3300046642 Bacteria 802
190 Ga0495611_0008610 3300046648 Bacteria 4316
191 Ga0495625_0007840 3300046660 Bacteria 9199
192 Ga0495625_0185892 3300046660 Bacteria 1379
193 Ga0495635_0025449 3300046663 Bacteria 4122
194 Ga0495635_0028081 3300046663 Bacteria 3911
195 Ga0495635_0123429 3300046663 Bacteria 1766
196 Ga0495635_0626206 3300046663 Bacteria 701
197 Ga0495661_0016254 3300046665 Bacteria 4939
198 Ga0495661_0221457 3300046665 Bacteria 980
199 Ga0495661_0258803 3300046665 Bacteria 885
200 Ga0495588_0015239 3300046674 Bacteria 3695
201 Ga0495588_0031339 3300046674 Bacteria 2675
202 Ga0495588_0492816 3300046674 Bacteria 642
203 Ga0495657_0000552 3300046675 Bacteria 34564
204 Ga0495657_0023935 3300046675 Bacteria 4357
205 Ga0495599_0257800 3300046678 Bacteria 1060
206 Ga0495623_0061064 3300046679 Bacteria 2364
207 Ga0495623_0070575 3300046679 Bacteria 2176
208 Ga0495646_0000429 3300046680 Bacteria 22240
209 Ga0495646_0054798 3300046680 Bacteria 2397
210 Ga0495658_0006006 3300046683 Bacteria 5961
211 Ga0495613_0002646 3300046689 Bacteria 13464
212 Ga0495613_0007186 3300046689 Bacteria 8294
213 Ga0495613_0013427 3300046689 Bacteria 6083
214 Ga0495613_0091161 3300046689 Bacteria 2207
215 Ga0495613_0409839 3300046689 Bacteria 923
216 Ga0495613_0826130 3300046689 Bacteria 603
217 Ga0495670_0052034 3300046691 Bacteria 2050
218 Ga0495670_0410116 3300046691 Bacteria 732
219 Ga0495671_0013411 3300046692 Bacteria 4441
220 Ga0495649_0030964 3300046694 Bacteria 2952
221 Ga0495589_0024986 3300046794 Bacteria 3033
222 Ga0495589_0040309 3300046794 Bacteria 2332
223 Ga0495589_0298755 3300046794 Bacteria 746
224 Ga0495600_0012567 3300046809 Bacteria 5297
225 Ga0495600_0072146 3300046809 Bacteria 2256
226 Ga0495660_0054304 3300046810 Bacteria 2170
227 Ga0495581_0002200 3300047315 Bacteria 11001
228 Ga0495581_0126132 3300047315 Bacteria 1490
229 Ga0495604_0000157 3300047317 Bacteria 59668
230 Ga0495604_0002775 3300047317 Bacteria 14046
231 Ga0495636_0009698 3300047318 Bacteria 3791
232 Ga0495636_0011430 3300047318 Bacteria 3513
233 Ga0495636_0022034 3300047318 Bacteria 2575
234 Ga0495636_0106142 3300047318 Bacteria 1232
235 Ga0495636_0265596 3300047318 Bacteria 796
236 Ga0495636_0299911 3300047318 Bacteria 751
237 Ga0495674_0334379 3300047319 Bacteria 1232
238 Ga0495674_0508128 3300047319 Bacteria 963
239 Ga0495672_0443259 3300047320 Bacteria 587
240 Ga0495676_0002174 3300047321 Bacteria 17362
241 Ga0495676_0084758 3300047321 Bacteria 2389
242 Ga0495676_0245943 3300047321 Bacteria 1222
243 Ga0495680_0003856 3300047322 Bacteria 14535
244 Ga0495687_002172 3300047443 Bacteria 16334
245 Ga0495687_002727 3300047443 Bacteria 13703
246 Ga0495687_052270 3300047443 Bacteria 1728
247 Ga0495687_098412 3300047443 Bacteria 1103
248 Ga0495675_0021049 3300047444 Bacteria 4152
249 Ga0495675_0032953 3300047444 Bacteria 3305
250 Ga0495675_0041688 3300047444 Bacteria 2925
251 Ga0495675_0106443 3300047444 Bacteria 1752
252 Ga0495677_0054375 3300047445 Bacteria 1477
253 Ga0495677_0330819 3300047445 Bacteria 600
254 Ga0495685_005238 3300047447 Bacteria 4222
255 Ga0495685_025652 3300047447 Bacteria 2027
256 Ga0495681_0021797 3300047470 Bacteria 3443
257 Ga0495681_0033708 3300047470 Bacteria 2560
258 Ga0495681_0335249 3300047470 Bacteria 578
259 Ga0495686_0031456 3300047472 Bacteria 3441
260 Ga0495593_0000465 3300047673 Bacteria 22778
261 Ga0495593_0210431 3300047673 Bacteria 976
262 Ga0495614_0007409 3300048089 Bacteria 4885
263 Ga0495614_0044889 3300048089 Bacteria 1895
264 Ga0495614_0164525 3300048089 Bacteria 993
265 Ga0495614_0362063 3300048089 Bacteria 677
266 Ga0495626_0029938 3300048091 Bacteria 2628
267 Ga0496103_0224506 3300048906 Bacteria 1208
268 Ga0496105_0911629 3300048908 Bacteria 662
269 Ga0495678_011135 3300049459 Bacteria 4322
270 Ga0501323_003492 3300049539 Bacteria 1608
271 Ga0501031_0005968 3300049568 Bacteria 7947
272 Ga0501031_0028045 3300049568 Bacteria 3670
273 Ga0501031_0039833 3300049568 Bacteria 3067
274 Ga0501031_0090218 3300049568 Bacteria 1999
275 Ga0501032_0008670 3300049569 Bacteria 7408
276 Ga0501032_0053076 3300049569 Bacteria 2731
277 Ga0501033_0001319 3300049570 Bacteria 22075
278 Ga0501033_0005404 3300049570 Bacteria 10123
279 Ga0501033_0040792 3300049570 Bacteria 3465
280 Ga0501033_0069169 3300049570 Bacteria 2595
281 Ga0501034_0009232 3300049571 Bacteria 10337
282 Ga0501034_0041389 3300049571 Bacteria 4661
283 Ga0501036_0008655 3300049572 Bacteria 8348
284 Ga0501036_0023983 3300049572 Bacteria 5142
285 Ga0501036_0111433 3300049572 Bacteria 2312
286 Ga0501037_0037146 3300049573 Bacteria 3590
287 Ga0501037_0635826 3300049573 Bacteria 714
288 Ga0501037_0804478 3300049573 Bacteria 620
289 Ga0501038_0036674 3300049574 Bacteria 4302
290 Ga0501038_0068262 3300049574 Bacteria 3022
291 Ga0501038_0132122 3300049574 Bacteria 2048
292 Ga0501038_0730494 3300049574 Bacteria 740
293 Ga0501039_0620295 3300049575 Bacteria 847
294 Ga0501039_1236956 3300049575 Bacteria 577
295 Ga0501042_0007416 3300049578 Bacteria 7182
296 Ga0501043_0019022 3300049579 Bacteria 5392
297 Ga0501043_0068692 3300049579 Bacteria 2782
298 Ga0501046_0278905 3300049580 Bacteria 1225
299 Ga0501047_0033598 3300049581 Bacteria 4950
300 Ga0501047_0099475 3300049581 Bacteria 2787
301 Ga0501047_0134261 3300049581 Bacteria 2355
302 Ga0501047_0356207 3300049581 Bacteria 1299
303 Ga0501048_0225550 3300049582 Bacteria 1329
304 Ga0501070_0103989 3300049586 Bacteria 2348
305 Ga0501070_0269471 3300049586 Bacteria 1391
306 Ga0501070_0336562 3300049586 Bacteria 1226
307 Ga0501074_0001576 3300049590 Bacteria 15433
308 Ga0501079_0971664 3300049741 Bacteria 669
309 Ga0501080_0043483 3300049742 Bacteria 4183
310 Ga0501083_0487601 3300049744 Bacteria 802
311 Ga0501035_0004810 3300049822 Bacteria 12798
312 Ga0501035_0047859 3300049822 Bacteria 3836
313 Ga0501035_0160208 3300049822 Bacteria 1948
314 Ga0501035_0277908 3300049822 Bacteria 1416
315 Ga0501044_0001579 3300049823 Bacteria 26660
316 Ga0501044_0015640 3300049823 Bacteria 8173
317 Ga0501044_0020628 3300049823 Bacteria 7036
318 Ga0501044_0107462 3300049823 Bacteria 2801
319 Ga0501044_1135154 3300049823 Bacteria 650
320 Ga0501045_0084824 3300049824 Bacteria 2337
321 nmdc:mga03n38_105223_c2 3300050490 Bacteria 914
322 nmdc:mga03n38_416180_c1 3300050490 Bacteria 742
323 nmdc:mga06z11_68405_c1 3300050494 Bacteria 1872
324 nmdc:mga04h51_24757_c1 3300050495 Bacteria 1841
325 nmdc:mga07m45_662614_c1 3300050496 Bacteria 601
326 Ga0495595_0338995 3300053084 Bacteria 758
327 Ga0495619_0100348 3300053085 Bacteria 1969
328 Ga0500578_0373844 3300053086 Bacteria 828
329 Ga0500644_0018681 3300053088 Bacteria 2035
330 Ga0500583_0309370 3300053092 Bacteria 772
331 Ga0500640_036739 3300053095 Bacteria 2153
332 Ga0500572_137141 3300053111 Bacteria 796
333 Ga0500614_117824 3300053123 Bacteria 780
334 Ga0500652_297514 3300053131 Bacteria 625
335 Ga0500600_0107249 3300053149 Bacteria 1463
336 Ga0500624_004227 3300053157 Bacteria 1884
337 Ga0466962_0001558 3300061719 Bacteria 10702
338 Ga0466962_0050327 3300061719 Bacteria 1991
339 Ga0466962_0146201 3300061719 Bacteria 1146
340 Ga0466962_0325016 3300061719 Bacteria 763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0224506 Ga0496103_0224506_89_574 158
2 3300046674 Ga0495588_0492816 Ga0495588_0492816_43_570 160
3 3300042136 Ga0450900_005944 Ga0450900_005944_86_583 165
4 3300030521 Ga0307511_10036891 Ga0307511_100368913 167
5 iso_pu_bacteria 8033684223 8033689288 167
6 3300028794 Ga0307515_10001938 Ga0307515_1000193842 168
7 3300031730 Ga0307516_10187552 Ga0307516_101875522 168
8 3300033179 Ga0307507_10027163 Ga0307507_100271634 168
9 3300033180 Ga0307510_10161436 Ga0307510_101614364 168
10 3300046459 Ga0495629_0007772 Ga0495629_0007772_3957_4487 168
11 3300046660 Ga0495625_0007840 Ga0495625_0007840_6669_7199 168
12 3300046674 Ga0495588_0015239 Ga0495588_0015239_335_865 168
13 3300046692 Ga0495671_0013411 Ga0495671_0013411_2105_2635 168
14 3300047470 Ga0495681_0021797 Ga0495681_0021797_101_631 168
15 3300048089 Ga0495614_0044889 Ga0495614_0044889_370_900 168
16 3300053131 Ga0500652_297514 Ga0500652_297514_40_570 168
17 iso_pu_bacteria 2547132111 2547411099 168
18 iso_pu_bacteria 2582581313 2585307452 168
19 iso_pu_bacteria 2582581314 2585317616 168
20 iso_pu_bacteria 2616644814 2616693892 168
21 iso_pu_bacteria 2643221587 2643945475 168
22 iso_pu_bacteria 2643221601 2644018040 168
23 iso_pu_bacteria 2643221631 2644180671 168
24 iso_pu_bacteria 2643221677 2644432374 168
25 iso_pu_bacteria 2643221678 2644435408 168
26 iso_pu_bacteria 2643221714 2644631365 168
27 iso_pu_bacteria 2784132148 2784587062 168
28 iso_pu_bacteria 2786546132 2786668595 168
29 iso_pu_bacteria 2808606359 2808848023 168
30 iso_pu_bacteria 2808606375 2808918781 168
31 iso_pu_bacteria 2808606448 2809230624 168
32 iso_pu_bacteria 2811994879 2812359970 168
33 iso_pu_bacteria 2811994917 2812482041 168
34 iso_pu_bacteria 2852635781 2852638058 168
35 iso_pu_bacteria 2862290372 2862291023 168
36 iso_pu_bacteria 2862507626 2862509135 168
37 iso_pu_bacteria 2862574272 2862583327 168
38 iso_pu_bacteria 2863404153 2863406609 168
39 iso_pu_bacteria 2873151551 2873157343 168
40 iso_pu_bacteria 2875391855 2875393021 168
41 iso_pu_bacteria 2877676314 2877683007 168
42 iso_pu_bacteria 2912715099 2912722017 168
43 iso_pu_bacteria 2912723979 2912725783 168
44 iso_pu_bacteria 2919468124 2919476149 168
45 iso_pu_bacteria 2946064051 2946065924 168
46 iso_pu_bacteria 2946072368 2946074254 168
47 iso_pu_bacteria 2947224130 2947231477 168
48 iso_pu_bacteria 2954002825 2954004720 168
49 iso_pu_bacteria 2954673503 2954674871 168
50 iso_pu_bacteria 2954682443 2954689262 168
51 iso_pu_bacteria 2954701450 2954703185 168
52 iso_pu_bacteria 2954711539 2954717989 168
53 iso_pu_bacteria 2954721474 2954727955 168
54 iso_pu_bacteria 2954731030 2954733849 168
55 iso_pu_bacteria 2954749733 2954752732 168
56 iso_pu_bacteria 2954759201 2954765968 168
57 iso_pu_bacteria 2990059506 2990066140 168
58 iso_pu_bacteria 2990088156 2990088593 168
59 iso_pu_bacteria 3006393351 3006398400 168
60 iso_pu_bacteria 3006486233 3006490519 168
61 iso_pu_bacteria 3006493962 3006496666 168
62 iso_pu_bacteria 8008558824 8008561704 168
63 iso_pu_bacteria 8008574985 8008580420 168
64 iso_pu_bacteria 8023623736 8023630709 168
65 iso_pu_bacteria 8048127548 8048130947 168
66 iso_pu_bacteria 8048406513 8048411642 168
67 iso_pu_bacteria 8056829672 8056832961 168
68 iso_pu_bacteria 2818991472 2819739978 169
69 3300041494 Ga0451837_0093746 Ga0451837_0093746_234_749 171
70 3300049568 Ga0501031_0028045 Ga0501031_0028045_1374_1892 171
71 3300049569 Ga0501032_0053076 Ga0501032_0053076_1456_1974 171
72 3300049570 Ga0501033_0040792 Ga0501033_0040792_2109_2627 171
73 3300049574 Ga0501038_0132122 Ga0501038_0132122_61_579 171
74 3300049575 Ga0501039_0620295 Ga0501039_0620295_169_687 171
75 3300049581 Ga0501047_0099475 Ga0501047_0099475_656_1174 171
76 3300049741 Ga0501079_0971664 Ga0501079_0971664_139_657 171
77 3300003323 rootH1_10038355 rootH1_100383552 172
78 3300003578 Ga0006562J51391_1148722 Ga0006562J51391_11487221 172
79 3300004799 Ga0058863_11555964 Ga0058863_115559641 172
80 3300005563 Ga0068855_100835761 Ga0068855_1008357611 172
81 3300005614 Ga0068856_100616844 Ga0068856_1006168442 172
82 3300006038 Ga0075365_10060740 Ga0075365_100607402 172
83 3300006948 Ga0099826_10072679 Ga0099826_100726794 172
84 3300009036 Ga0105244_10335808 Ga0105244_103358081 172
85 3300009092 Ga0105250_10204772 Ga0105250_102047721 172
86 3300009148 Ga0105243_10509815 Ga0105243_105098151 172
87 3300011119 Ga0105246_10008105 Ga0105246_100081054 172
88 3300011119 Ga0105246_10107509 Ga0105246_101075091 172
89 3300013296 Ga0157374_10563825 Ga0157374_105638252 172
90 3300013297 Ga0157378_10898513 Ga0157378_108985131 172
91 3300013307 Ga0157372_10272931 Ga0157372_102729312 172
92 3300013308 Ga0157375_10282902 Ga0157375_102829022 172
93 3300013308 Ga0157375_11062564 Ga0157375_110625642 172
94 3300015262 Ga0182007_10002461 Ga0182007_100024613 172
95 3300020080 Ga0206350_10039647 Ga0206350_100396472 172
96 3300025297 Ga0209758_1001711 Ga0209758_100171117 172
97 3300025302 Ga0207426_1008744 Ga0207426_10087442 172
98 3300025904 Ga0207647_10062687 Ga0207647_100626874 172
99 3300025935 Ga0207709_10264446 Ga0207709_102644461 172
100 3300025949 Ga0207667_11286337 Ga0207667_112863371 172
101 3300026078 Ga0207702_10577410 Ga0207702_105774101 172
102 3300028794 Ga0307515_10102684 Ga0307515_101026844 172
103 3300028794 Ga0307515_10329900 Ga0307515_103299002 172
104 3300030521 Ga0307511_10001602 Ga0307511_1000160220 172
105 3300030522 Ga0307512_10003044 Ga0307512_100030443 172
106 3300030522 Ga0307512_10112747 Ga0307512_101127471 172
107 3300031456 Ga0307513_10014188 Ga0307513_100141887 172
108 3300031456 Ga0307513_10072289 Ga0307513_100722892 172
109 3300031507 Ga0307509_10037676 Ga0307509_100376762 172
110 3300031507 Ga0307509_10044886 Ga0307509_100448862 172
111 3300031616 Ga0307508_10020052 Ga0307508_100200524 172
112 3300031616 Ga0307508_10119784 Ga0307508_101197844 172
113 3300031616 Ga0307508_10122466 Ga0307508_101224662 172
114 3300031649 Ga0307514_10229642 Ga0307514_102296422 172
115 3300031730 Ga0307516_10016823 Ga0307516_100168231 172
116 3300031731 Ga0307405_10362822 Ga0307405_103628221 172
117 3300031824 Ga0307413_10793184 Ga0307413_107931842 172
118 3300031824 Ga0307413_10988169 Ga0307413_109881691 172
119 3300031838 Ga0307518_10066062 Ga0307518_100660624 172
120 3300031838 Ga0307518_10289990 Ga0307518_102899902 172
121 3300032005 Ga0307411_10210190 Ga0307411_102101902 172
122 3300033179 Ga0307507_10023632 Ga0307507_100236328 172
123 3300033179 Ga0307507_10087180 Ga0307507_100871802 172
124 3300033180 Ga0307510_10038769 Ga0307510_100387692 172
125 3300033180 Ga0307510_10083275 Ga0307510_100832753 172
126 3300033180 Ga0307510_10184969 Ga0307510_101849692 172
127 3300037418 Ga0395900_0498284 Ga0395900_0498284_220_738 172
128 3300037466 Ga0395898_0060337 Ga0395898_0060337_1603_2121 172
129 3300041406 Ga0439439_0005190 Ga0439439_0005190_37_579 172
130 3300041453 Ga0451797_1473813 Ga0451797_1473813_16_534 172
131 3300041512 Ga0451853_0129212 Ga0451853_0129212_113_655 172
132 3300041512 Ga0451853_0830621 Ga0451853_0830621_1394_1912 172
133 3300041512 Ga0451853_3973150 Ga0451853_3973150_1525_2043 172
134 3300041999 Ga0439433_0005573 Ga0439433_0005573_134_676 172
135 3300042002 Ga0439442_019406 Ga0439442_019406_613_1131 172
136 3300042002 Ga0439442_075704 Ga0439442_075704_103_645 172
137 3300042005 Ga0439448_0007349 Ga0439448_0007349_2508_3026 172
138 3300042005 Ga0439448_0079880 Ga0439448_0079880_413_931 172
139 3300042006 Ga0439432_047017 Ga0439432_047017_147_665 172
140 3300042007 Ga0439449_0001580 Ga0439449_0001580_2403_2921 172
141 3300042007 Ga0439449_0039849 Ga0439449_0039849_405_947 172
142 3300042007 Ga0439449_0129089 Ga0439449_0129089_329_847 172
143 3300042012 Ga0439455_0003765 Ga0439455_0003765_2282_2800 172
144 3300042014 Ga0439457_001591 Ga0439457_001591_4412_4954 172
145 3300042131 Ga0450894_000002 Ga0450894_000002_36836_37354 172
146 3300042134 Ga0450898_021244 Ga0450898_021244_166_708 172
147 3300042135 Ga0450899_000190 Ga0450899_000190_4196_4714 172
148 3300042136 Ga0450900_012499 Ga0450900_012499_477_995 172
149 3300042138 Ga0450903_001476 Ga0450903_001476_2401_2919 172
150 3300042145 Ga0450906_005969 Ga0450906_005969_583_1101 172
151 3300042157 Ga0439458_0001227 Ga0439458_0001227_1386_1904 172
152 3300042184 Ga0450908_010378 Ga0450908_010378_536_1054 172
153 3300044656 Ga0466969_0232086 Ga0466969_0232086_109_627 172
154 3300044658 Ga0466972_0001074 Ga0466972_0001074_4315_4833 172
155 3300044658 Ga0466972_0003128 Ga0466972_0003128_3408_3926 172
156 3300044658 Ga0466972_0023993 Ga0466972_0023993_2270_2788 172
157 3300044658 Ga0466972_0073038 Ga0466972_0073038_442_984 172
158 3300044658 Ga0466972_0083266 Ga0466972_0083266_35_553 172
159 3300044658 Ga0466972_0272896 Ga0466972_0272896_137_655 172
160 3300044683 Ga0466965_0000187 Ga0466965_0000187_466_1008 172
161 3300044683 Ga0466965_0160394 Ga0466965_0160394_223_741 172
162 3300044683 Ga0466965_0567778 Ga0466965_0567778_23_565 172
163 3300044684 Ga0466966_0005061 Ga0466966_0005061_175_717 172
164 3300044684 Ga0466966_0011228 Ga0466966_0011228_2073_2591 172
165 3300044684 Ga0466966_0111139 Ga0466966_0111139_415_933 172
166 3300044693 Ga0466961_0003265 Ga0466961_0003265_7364_7906 172
167 3300044693 Ga0466961_0004606 Ga0466961_0004606_7818_8336 172
168 3300044693 Ga0466961_0393302 Ga0466961_0393302_46_564 172
169 3300044694 Ga0466963_0000660 Ga0466963_0000660_7817_8359 172
170 3300044694 Ga0466963_0007521 Ga0466963_0007521_1117_1635 172
171 3300044706 Ga0466964_0020215 Ga0466964_0020215_1371_1913 172
172 3300044706 Ga0466964_0188831 Ga0466964_0188831_397_915 172
173 3300044719 Ga0466971_0009720 Ga0466971_0009720_2985_3527 172
174 3300044719 Ga0466971_0089925 Ga0466971_0089925_318_836 172
175 3300044735 Ga0466968_0127330 Ga0466968_0127330_152_670 172
176 3300044765 Ga0466970_0001067 Ga0466970_0001067_650_1168 172
177 3300044765 Ga0466970_0025317 Ga0466970_0025317_692_1234 172
178 3300044765 Ga0466970_0172332 Ga0466970_0172332_43_561 172
179 3300044842 Ga0466957_0003790 Ga0466957_0003790_7097_7639 172
180 3300044842 Ga0466957_0506796 Ga0466957_0506796_39_557 172
181 3300044901 Ga0466960_0037526 Ga0466960_0037526_63_581 172
182 3300044901 Ga0466960_0134885 Ga0466960_0134885_250_792 172
183 3300045049 Ga0466959_0003279 Ga0466959_0003279_2193_2735 172
184 3300045836 Ga0466958_0006249 Ga0466958_0006249_1451_1993 172
185 3300045836 Ga0466958_0065921 Ga0466958_0065921_11_529 172
186 3300045976 Ga0466967_0086637 Ga0466967_0086637_1855_2397 172
187 3300045976 Ga0466967_1178641 Ga0466967_1178641_35_553 172
188 3300046454 Ga0495592_0004317 Ga0495592_0004317_2030_2551 172
189 3300046454 Ga0495592_0016184 Ga0495592_0016184_1938_2456 172
190 3300046454 Ga0495592_0019216 Ga0495592_0019216_3161_3679 172
191 3300046455 Ga0495603_0011321 Ga0495603_0011321_1289_1807 172
192 3300046455 Ga0495603_0013867 Ga0495603_0013867_53_595 172
193 3300046455 Ga0495603_0189406 Ga0495603_0189406_52_570 172
194 3300046455 Ga0495603_0209238 Ga0495603_0209238_278_796 172
195 3300046455 Ga0495603_0297858 Ga0495603_0297858_106_633 172
196 3300046457 Ga0495590_0110158 Ga0495590_0110158_395_913 172
197 3300046459 Ga0495629_0022215 Ga0495629_0022215_475_993 172
198 3300046459 Ga0495629_0233535 Ga0495629_0233535_407_925 172
199 3300046460 Ga0495638_0060610 Ga0495638_0060610_1772_2302 172
200 3300046462 Ga0495651_0003166 Ga0495651_0003166_637_1155 172
201 3300046462 Ga0495651_0030588 Ga0495651_0030588_1866_2384 172
202 3300046462 Ga0495651_0039707 Ga0495651_0039707_2819_3340 172
203 3300046463 Ga0495653_0461003 Ga0495653_0461003_70_588 172
204 3300046472 Ga0495580_0462337 Ga0495580_0462337_269_787 172
205 3300046473 Ga0495582_0024112 Ga0495582_0024112_1267_1785 172
206 3300046474 Ga0495605_0050382 Ga0495605_0050382_54_572 172
207 3300046475 Ga0495639_0012047 Ga0495639_0012047_3173_3691 172
208 3300046476 Ga0495662_0000925 Ga0495662_0000925_2146_2664 172
209 3300046476 Ga0495662_0144028 Ga0495662_0144028_56_583 172
210 3300046476 Ga0495662_0246728 Ga0495662_0246728_334_852 172
211 3300046477 Ga0495664_0000664 Ga0495664_0000664_8028_8546 172
212 3300046477 Ga0495664_0349851 Ga0495664_0349851_48_590 172
213 3300046491 Ga0495584_0227961 Ga0495584_0227961_387_905 172
214 3300046492 Ga0495585_0036468 Ga0495585_0036468_1947_2465 172
215 3300046492 Ga0495585_0066694 Ga0495585_0066694_275_793 172
216 3300046499 Ga0495594_0097906 Ga0495594_0097906_336_854 172
217 3300046499 Ga0495594_0099162 Ga0495594_0099162_761_1279 172
218 3300046499 Ga0495594_0216411 Ga0495594_0216411_488_1030 172
219 3300046500 Ga0495596_0011437 Ga0495596_0011437_1073_1591 172
220 3300046501 Ga0495607_0030069 Ga0495607_0030069_1440_1958 172
221 3300046506 Ga0495583_0092036 Ga0495583_0092036_71_589 172
222 3300046507 Ga0495606_0072602 Ga0495606_0072602_1254_1772 172
223 3300046512 Ga0495610_0046203 Ga0495610_0046203_741_1259 172
224 3300046513 Ga0495616_0015848 Ga0495616_0015848_2323_2841 172
225 3300046514 Ga0495618_0052303 Ga0495618_0052303_253_771 172
226 3300046516 Ga0495628_0075606 Ga0495628_0075606_519_1037 172
227 3300046517 Ga0495630_0028469 Ga0495630_0028469_37_555 172
228 3300046517 Ga0495630_0224306 Ga0495630_0224306_495_1037 172
229 3300046517 Ga0495630_0236518 Ga0495630_0236518_159_686 172
230 3300046518 Ga0495631_0018108 Ga0495631_0018108_1343_1861 172
231 3300046518 Ga0495631_0211368 Ga0495631_0211368_85_603 172
232 3300046519 Ga0495632_0327327 Ga0495632_0327327_25_543 172
233 3300046520 Ga0495637_0101898 Ga0495637_0101898_575_1093 172
234 3300046522 Ga0495643_0032612 Ga0495643_0032612_44_562 172
235 3300046524 Ga0495648_0058735 Ga0495648_0058735_466_984 172
236 3300046526 Ga0495666_0033637 Ga0495666_0033637_795_1313 172
237 3300046526 Ga0495666_0086570 Ga0495666_0086570_250_768 172
238 3300046529 Ga0495652_0116495 Ga0495652_0116495_1428_1946 172
239 3300046531 Ga0495665_0269944 Ga0495665_0269944_19_537 172
240 3300046533 Ga0495640_0020207 Ga0495640_0020207_1218_1736 172
241 3300046533 Ga0495640_0136235 Ga0495640_0136235_27_545 172
242 3300046535 Ga0495586_0078123 Ga0495586_0078123_1139_1657 172
243 3300046536 Ga0495587_0019200 Ga0495587_0019200_602_1120 172
244 3300046536 Ga0495587_0523963 Ga0495587_0523963_24_566 172
245 3300046538 Ga0495609_0074591 Ga0495609_0074591_222_740 172
246 3300046542 Ga0495597_0053072 Ga0495597_0053072_247_765 172
247 3300046543 Ga0495645_0016583 Ga0495645_0016583_944_1462 172
248 3300046543 Ga0495645_0063154 Ga0495645_0063154_1547_2089 172
249 3300046557 Ga0495622_0054419 Ga0495622_0054419_1042_1560 172
250 3300046558 Ga0495633_0055207 Ga0495633_0055207_1249_1767 172
251 3300046558 Ga0495633_0107781 Ga0495633_0107781_185_727 172
252 3300046559 Ga0495667_0176927 Ga0495667_0176927_435_953 172
253 3300046559 Ga0495667_0294938 Ga0495667_0294938_11_553 172
254 3300046616 Ga0495668_0042996 Ga0495668_0042996_1366_1884 172
255 3300046642 Ga0495634_0000101 Ga0495634_0000101_50803_51321 172
256 3300046642 Ga0495634_0052494 Ga0495634_0052494_2013_2534 172
257 3300046642 Ga0495634_0410983 Ga0495634_0410983_192_710 172
258 3300046648 Ga0495611_0008610 Ga0495611_0008610_3506_4024 172
259 3300046660 Ga0495625_0185892 Ga0495625_0185892_795_1313 172
260 3300046663 Ga0495635_0025449 Ga0495635_0025449_20_538 172
261 3300046663 Ga0495635_0028081 Ga0495635_0028081_2457_2975 172
262 3300046663 Ga0495635_0123429 Ga0495635_0123429_1008_1550 172
263 3300046663 Ga0495635_0626206 Ga0495635_0626206_120_662 172
264 3300046665 Ga0495661_0016254 Ga0495661_0016254_2952_3470 172
265 3300046665 Ga0495661_0221457 Ga0495661_0221457_426_944 172
266 3300046665 Ga0495661_0258803 Ga0495661_0258803_19_537 172
267 3300046674 Ga0495588_0031339 Ga0495588_0031339_681_1223 172
268 3300046675 Ga0495657_0000552 Ga0495657_0000552_28975_29493 172
269 3300046675 Ga0495657_0023935 Ga0495657_0023935_2012_2554 172
270 3300046678 Ga0495599_0257800 Ga0495599_0257800_23_541 172
271 3300046679 Ga0495623_0061064 Ga0495623_0061064_562_1080 172
272 3300046679 Ga0495623_0070575 Ga0495623_0070575_726_1244 172
273 3300046680 Ga0495646_0000429 Ga0495646_0000429_12686_13204 172
274 3300046680 Ga0495646_0054798 Ga0495646_0054798_1598_2116 172
275 3300046683 Ga0495658_0006006 Ga0495658_0006006_2758_3276 172
276 3300046689 Ga0495613_0002646 Ga0495613_0002646_9330_9848 172
277 3300046689 Ga0495613_0007186 Ga0495613_0007186_1749_2291 172
278 3300046689 Ga0495613_0013427 Ga0495613_0013427_3858_4376 172
279 3300046689 Ga0495613_0091161 Ga0495613_0091161_781_1299 172
280 3300046689 Ga0495613_0409839 Ga0495613_0409839_349_867 172
281 3300046689 Ga0495613_0826130 Ga0495613_0826130_44_586 172
282 3300046691 Ga0495670_0052034 Ga0495670_0052034_1284_1802 172
283 3300046691 Ga0495670_0410116 Ga0495670_0410116_56_574 172
284 3300046694 Ga0495649_0030964 Ga0495649_0030964_764_1282 172
285 3300046794 Ga0495589_0024986 Ga0495589_0024986_941_1459 172
286 3300046794 Ga0495589_0040309 Ga0495589_0040309_1745_2263 172
287 3300046794 Ga0495589_0298755 Ga0495589_0298755_97_615 172
288 3300046809 Ga0495600_0012567 Ga0495600_0012567_475_993 172
289 3300046809 Ga0495600_0072146 Ga0495600_0072146_1422_1964 172
290 3300046810 Ga0495660_0054304 Ga0495660_0054304_1023_1541 172
291 3300047315 Ga0495581_0002200 Ga0495581_0002200_6734_7252 172
292 3300047315 Ga0495581_0126132 Ga0495581_0126132_956_1474 172
293 3300047317 Ga0495604_0000157 Ga0495604_0000157_19308_19826 172
294 3300047317 Ga0495604_0002775 Ga0495604_0002775_13151_13678 172
295 3300047318 Ga0495636_0009698 Ga0495636_0009698_1571_2089 172
296 3300047318 Ga0495636_0011430 Ga0495636_0011430_33_575 172
297 3300047318 Ga0495636_0022034 Ga0495636_0022034_315_833 172
298 3300047318 Ga0495636_0106142 Ga0495636_0106142_518_1036 172
299 3300047318 Ga0495636_0265596 Ga0495636_0265596_254_772 172
300 3300047318 Ga0495636_0299911 Ga0495636_0299911_166_693 172
301 3300047319 Ga0495674_0334379 Ga0495674_0334379_246_764 172
302 3300047319 Ga0495674_0508128 Ga0495674_0508128_395_913 172
303 3300047320 Ga0495672_0443259 Ga0495672_0443259_25_543 172
304 3300047321 Ga0495676_0002174 Ga0495676_0002174_2072_2590 172
305 3300047321 Ga0495676_0084758 Ga0495676_0084758_1603_2121 172
306 3300047321 Ga0495676_0245943 Ga0495676_0245943_650_1168 172
307 3300047322 Ga0495680_0003856 Ga0495680_0003856_7771_8289 172
308 3300047443 Ga0495687_002172 Ga0495687_002172_5428_5946 172
309 3300047443 Ga0495687_002727 Ga0495687_002727_5912_6430 172
310 3300047443 Ga0495687_052270 Ga0495687_052270_45_563 172
311 3300047443 Ga0495687_098412 Ga0495687_098412_560_1078 172
312 3300047444 Ga0495675_0021049 Ga0495675_0021049_1834_2352 172
313 3300047444 Ga0495675_0032953 Ga0495675_0032953_1270_1797 172
314 3300047444 Ga0495675_0041688 Ga0495675_0041688_1632_2150 172
315 3300047444 Ga0495675_0106443 Ga0495675_0106443_434_976 172
316 3300047445 Ga0495677_0054375 Ga0495677_0054375_929_1447 172
317 3300047445 Ga0495677_0330819 Ga0495677_0330819_11_529 172
318 3300047447 Ga0495685_005238 Ga0495685_005238_1865_2383 172
319 3300047447 Ga0495685_025652 Ga0495685_025652_329_847 172
320 3300047470 Ga0495681_0033708 Ga0495681_0033708_2029_2547 172
321 3300047470 Ga0495681_0335249 Ga0495681_0335249_39_557 172
322 3300047472 Ga0495686_0031456 Ga0495686_0031456_2863_3381 172
323 3300047673 Ga0495593_0000465 Ga0495593_0000465_1572_2090 172
324 3300047673 Ga0495593_0210431 Ga0495593_0210431_411_929 172
325 3300048089 Ga0495614_0007409 Ga0495614_0007409_1253_1771 172
326 3300048089 Ga0495614_0164525 Ga0495614_0164525_262_780 172
327 3300048089 Ga0495614_0362063 Ga0495614_0362063_28_546 172
328 3300048091 Ga0495626_0029938 Ga0495626_0029938_858_1376 172
329 3300048908 Ga0496105_0911629 Ga0496105_0911629_112_639 172
330 3300049459 Ga0495678_011135 Ga0495678_011135_2613_3131 172
331 3300049539 Ga0501323_003492 Ga0501323_003492_160_690 172
332 3300049568 Ga0501031_0005968 Ga0501031_0005968_5643_6161 172
333 3300049568 Ga0501031_0039833 Ga0501031_0039833_2106_2627 172
334 3300049568 Ga0501031_0090218 Ga0501031_0090218_1069_1587 172
335 3300049569 Ga0501032_0008670 Ga0501032_0008670_809_1327 172
336 3300049570 Ga0501033_0001319 Ga0501033_0001319_18960_19562 172
337 3300049570 Ga0501033_0005404 Ga0501033_0005404_8611_9129 172
338 3300049570 Ga0501033_0069169 Ga0501033_0069169_774_1292 172
339 3300049571 Ga0501034_0009232 Ga0501034_0009232_436_954 172
340 3300049571 Ga0501034_0041389 Ga0501034_0041389_1624_2142 172
341 3300049572 Ga0501036_0008655 Ga0501036_0008655_4012_4530 172
342 3300049572 Ga0501036_0023983 Ga0501036_0023983_1925_2443 172
343 3300049572 Ga0501036_0111433 Ga0501036_0111433_1710_2228 172
344 3300049573 Ga0501037_0037146 Ga0501037_0037146_651_1169 172
345 3300049573 Ga0501037_0635826 Ga0501037_0635826_44_562 172
346 3300049573 Ga0501037_0804478 Ga0501037_0804478_56_574 172
347 3300049574 Ga0501038_0036674 Ga0501038_0036674_926_1444 172
348 3300049574 Ga0501038_0068262 Ga0501038_0068262_908_1426 172
349 3300049574 Ga0501038_0730494 Ga0501038_0730494_26_544 172
350 3300049575 Ga0501039_1236956 Ga0501039_1236956_37_555 172
351 3300049578 Ga0501042_0007416 Ga0501042_0007416_1587_2105 172
352 3300049579 Ga0501043_0019022 Ga0501043_0019022_3259_3777 172
353 3300049579 Ga0501043_0068692 Ga0501043_0068692_860_1378 172
354 3300049580 Ga0501046_0278905 Ga0501046_0278905_640_1158 172
355 3300049581 Ga0501047_0033598 Ga0501047_0033598_878_1396 172
356 3300049581 Ga0501047_0134261 Ga0501047_0134261_1024_1542 172
357 3300049581 Ga0501047_0356207 Ga0501047_0356207_218_736 172
358 3300049582 Ga0501048_0225550 Ga0501048_0225550_436_954 172
359 3300049586 Ga0501070_0103989 Ga0501070_0103989_1722_2240 172
360 3300049586 Ga0501070_0269471 Ga0501070_0269471_706_1224 172
361 3300049586 Ga0501070_0336562 Ga0501070_0336562_417_935 172
362 3300049590 Ga0501074_0001576 Ga0501074_0001576_7970_8488 172
363 3300049742 Ga0501080_0043483 Ga0501080_0043483_3423_3941 172
364 3300049744 Ga0501083_0487601 Ga0501083_0487601_68_586 172
365 3300049822 Ga0501035_0004810 Ga0501035_0004810_1937_2455 172
366 3300049822 Ga0501035_0047859 Ga0501035_0047859_2772_3290 172
367 3300049822 Ga0501035_0160208 Ga0501035_0160208_206_724 172
368 3300049822 Ga0501035_0277908 Ga0501035_0277908_182_703 172
369 3300049823 Ga0501044_0001579 Ga0501044_0001579_13577_14095 172
370 3300049823 Ga0501044_0015640 Ga0501044_0015640_4441_4959 172
371 3300049823 Ga0501044_0020628 Ga0501044_0020628_899_1417 172
372 3300049823 Ga0501044_0107462 Ga0501044_0107462_2265_2783 172
373 3300049823 Ga0501044_1135154 Ga0501044_1135154_52_573 172
374 3300049824 Ga0501045_0084824 Ga0501045_0084824_1579_2097 172
375 3300050490 nmdc:mga03n38_105223_c2 nmdc:mga03n38_105223_c2_242_760 172
376 3300050490 nmdc:mga03n38_416180_c1 nmdc:mga03n38_416180_c1_191_709 172
377 3300050494 nmdc:mga06z11_68405_c1 nmdc:mga06z11_68405_c1_479_997 172
378 3300050495 nmdc:mga04h51_24757_c1 nmdc:mga04h51_24757_c1_140_658 172
379 3300050496 nmdc:mga07m45_662614_c1 nmdc:mga07m45_662614_c1_21_539 172
380 3300053084 Ga0495595_0338995 Ga0495595_0338995_20_538 172
381 3300053085 Ga0495619_0100348 Ga0495619_0100348_593_1111 172
382 3300053086 Ga0500578_0373844 Ga0500578_0373844_171_689 172
383 3300053088 Ga0500644_0018681 Ga0500644_0018681_1026_1556 172
384 3300053092 Ga0500583_0309370 Ga0500583_0309370_224_754 172
385 3300053095 Ga0500640_036739 Ga0500640_036739_62_580 172
386 3300053111 Ga0500572_137141 Ga0500572_137141_51_569 172
387 3300053123 Ga0500614_117824 Ga0500614_117824_26_544 172
388 3300053149 Ga0500600_0107249 Ga0500600_0107249_22_540 172
389 3300053157 Ga0500624_004227 Ga0500624_004227_1344_1862 172
390 3300061719 Ga0466962_0001558 Ga0466962_0001558_2320_2862 172
391 3300061719 Ga0466962_0050327 Ga0466962_0050327_1423_1941 172
392 3300061719 Ga0466962_0146201 Ga0466962_0146201_10_528 172
393 3300061719 Ga0466962_0325016 Ga0466962_0325016_53_571 172
394 iso_pu_bacteria 2802429296 2804844131 172
395 iso_pu_bacteria 8025413630 8025418891 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

6

103

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.9022 6 170
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8855 6 170
2rfl-assembly5.cif.gz_E crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8686 6 171
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8676 8 169
2rfl-assembly5.cif.gz_E crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8579 6 171
ID Description Score Start End Superfamily
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.907 13 171 3.40.50.1240
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.896 13 171 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8644 8 169 3.40.50.1240
af_A0A1D6HET3_64_207_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8554 13 83 3.40.50.1240
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8533 1 171 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A3S1ZA95-F1-model_v4 Histidine phosphatase family protein 0.9844 7 120
AF-A0A527ZWY5-F1-model_v4 Histidine phosphatase family protein 0.9813 7 114
AF-A0A4S1ERP2-F1-model_v4 Histidine phosphatase family protein 0.9731 30 120
AF-A0A1A9C351-F1-model_v4 Phosphohistidine phosphatase 0.9725 6 170
AF-A0A1Q9LQS8-F1-model_v4 Phosphohistidine phosphatase 0.9706 1 168

Feature Viewer

pLDDT pTM Quality
96.18 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map