F433384

General Info

Members Datasets Scaffolds Average Seq Length
396 230 792 68

Family's Representative Sequence

Representative Sequence 3300002075|JGI24738J21930_10156844|JGI24738J21930_101568441
Length 72
Sequence MAATTKKAAAKQDGGKRLTITLRKSTIGFNRNQARVVEGMGLRRIGHSVELPDTPATRGMILKVRHLVEVGE

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
163 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
164 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
167 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
168 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
169 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
170 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
171 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
172 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
179 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
206 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 3.03
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10156844 3300002075 Bacteria 508
2 JGI24751J29686_10026839 3300002459 Bacteria 1195
3 Ga0065704_10199312 3300005289 Bacteria 1153
4 Ga0065712_10005304 3300005290 Bacteria 4603
5 Ga0065712_10628143 3300005290 Bacteria 577
6 Ga0065712_10695243 3300005290 Unclassified 549
7 Ga0065712_10791807 3300005290 Bacteria 515
8 Ga0065715_10009723 3300005293 Bacteria 2626
9 Ga0065715_10101878 3300005293 Bacteria 3162
10 Ga0065715_10980255 3300005293 Bacteria 551
11 Ga0065707_10013364 3300005295 Bacteria 2336
12 Ga0065707_10277108 3300005295 Bacteria 1057
13 Ga0065707_10613372 3300005295 Unclassified 671
14 Ga0065707_10721127 3300005295 Bacteria 630
15 Ga0070676_10019754 3300005328 Bacteria 3753
16 Ga0070676_10607962 3300005328 Bacteria 789
17 Ga0070676_11503362 3300005328 Bacteria 519
18 Ga0070690_100009989 3300005330 Bacteria 5510
19 Ga0070690_100035053 3300005330 Bacteria 3147
20 Ga0070670_100014012 3300005331 Bacteria 6875
21 Ga0070670_100038303 3300005331 Bacteria 4123
22 Ga0070670_100039016 3300005331 Bacteria 4084
23 Ga0070670_100362036 3300005331 Bacteria 1275
24 Ga0070670_101819799 3300005331 Bacteria 561
25 Ga0070677_10116145 3300005333 Bacteria 1202
26 Ga0070677_10623507 3300005333 Bacteria 600
27 Ga0070666_10739451 3300005335 Bacteria 722
28 Ga0070680_100334728 3300005336 Bacteria 1286
29 Ga0070682_100250460 3300005337 Bacteria 1277
30 Ga0068868_100043245 3300005338 Bacteria 3518
31 Ga0070689_100051061 3300005340 Bacteria 3195
32 Ga0070689_100266349 3300005340 Bacteria 1417
33 Ga0070691_10024379 3300005341 Bacteria 2812
34 Ga0070687_100013541 3300005343 Bacteria 3637
35 Ga0070687_100158159 3300005343 Bacteria 1337
36 Ga0070661_100156789 3300005344 Bacteria 1723
37 Ga0070661_100828352 3300005344 Bacteria 761
38 Ga0070692_10043493 3300005345 Bacteria 2310
39 Ga0070669_100030130 3300005353 Bacteria 3914
40 Ga0070669_100590479 3300005353 Bacteria 929
41 Ga0070669_101072145 3300005353 Bacteria 693
42 Ga0070675_100037307 3300005354 Bacteria 3958
43 Ga0070675_100169036 3300005354 Bacteria 1884
44 Ga0070671_100212121 3300005355 Bacteria 1642
45 Ga0070671_100262263 3300005355 Bacteria 1468
46 Ga0070671_101750575 3300005355 Unclassified 552
47 Ga0070674_100626499 3300005356 Bacteria 912
48 Ga0070673_100026895 3300005364 Bacteria 4256
49 Ga0070673_100035006 3300005364 Bacteria 3805
50 Ga0070688_100011546 3300005365 Bacteria 4910
51 Ga0070688_100486417 3300005365 Bacteria 929
52 Ga0070659_100928462 3300005366 Bacteria 762
53 Ga0070659_101650498 3300005366 Bacteria 573
54 Ga0070667_100169201 3300005367 Bacteria 1928
55 Ga0070703_10074089 3300005406 Bacteria 1144
56 Ga0070701_10464753 3300005438 Bacteria 815
57 Ga0070705_100087060 3300005440 Bacteria 1935
58 Ga0070700_100046807 3300005441 Bacteria 2674
59 Ga0070700_100421505 3300005441 Bacteria 1009
60 Ga0070700_100588462 3300005441 Bacteria 870
61 Ga0070663_100310737 3300005455 Bacteria 1265
62 Ga0070678_101441324 3300005456 Bacteria 644
63 Ga0070662_100987277 3300005457 Bacteria 720
64 Ga0070662_101834739 3300005457 Bacteria 524
65 Ga0070681_10230721 3300005458 Bacteria 1766
66 Ga0068867_100008420 3300005459 Bacteria 7274
67 Ga0070698_101420934 3300005471 Bacteria 645
68 Ga0070672_100151061 3300005543 Bacteria 1921
69 Ga0070686_100036019 3300005544 Bacteria 3060
70 Ga0070686_100205146 3300005544 Bacteria 1416
71 Ga0070695_100021897 3300005545 Bacteria 3916
72 Ga0070696_100486214 3300005546 Bacteria 980
73 Ga0070696_101002630 3300005546 Bacteria 698
74 Ga0070696_101556559 3300005546 Bacteria 567
75 Ga0070693_100008359 3300005547 Bacteria 5098
76 Ga0070693_101231445 3300005547 Bacteria 576
77 Ga0070704_100016923 3300005549 Bacteria 4622
78 Ga0070704_101541520 3300005549 Bacteria 612
79 Ga0070704_101711910 3300005549 Bacteria 581
80 Ga0068855_101673062 3300005563 Bacteria 650
81 Ga0070664_100011368 3300005564 Bacteria 7221
82 Ga0070664_100210715 3300005564 Bacteria 1736
83 Ga0070664_100365519 3300005564 Bacteria 1315
84 Ga0070664_100427625 3300005564 Bacteria 1214
85 Ga0068857_100067995 3300005577 Bacteria 3172
86 Ga0068854_100023296 3300005578 Bacteria 4228
87 Ga0068854_101066246 3300005578 Bacteria 718
88 Ga0068856_102593091 3300005614 Unclassified 513
89 Ga0070702_100010684 3300005615 Bacteria 4534
90 Ga0070702_100637899 3300005615 Bacteria 804
91 Ga0068852_101082363 3300005616 Bacteria 822
92 Ga0068859_100100341 3300005617 Bacteria 2950
93 Ga0068859_100440954 3300005617 Bacteria 1398
94 Ga0068859_102177926 3300005617 Bacteria 612
95 Ga0068864_100027039 3300005618 Bacteria 4840
96 Ga0068864_100316461 3300005618 Bacteria 1465
97 Ga0068866_10215694 3300005718 Bacteria 1155
98 Ga0068861_100357155 3300005719 Bacteria 1284
99 Ga0068861_101447533 3300005719 Bacteria 672
100 Ga0068851_10094376 3300005834 Bacteria 1580
101 Ga0068858_100020935 3300005842 Bacteria 6111
102 Ga0068858_101242088 3300005842 Bacteria 733
103 Ga0068860_100010205 3300005843 Bacteria 9295
104 Ga0068860_100676533 3300005843 Bacteria 1041
105 Ga0068862_100484075 3300005844 Bacteria 1172
106 Ga0075365_10009452 3300006038 Bacteria 5606
107 Ga0075364_11059851 3300006051 Bacteria 551
108 Ga0075367_10194655 3300006178 Bacteria 1266
109 Ga0075430_100596916 3300006846 Bacteria 911
110 Ga0075430_101276816 3300006846 Bacteria 604
111 Ga0075431_100106985 3300006847 Bacteria 2886
112 Ga0075431_100179510 3300006847 Bacteria 2173
113 Ga0075431_100722481 3300006847 Bacteria 973
114 Ga0075431_101263980 3300006847 Bacteria 700
115 Ga0075433_10889505 3300006852 Bacteria 777
116 Ga0075434_100988719 3300006871 Bacteria 855
117 Ga0075434_101121090 3300006871 Bacteria 800
118 Ga0075429_100350986 3300006880 Bacteria 1291
119 Ga0075429_101440942 3300006880 Bacteria 600
120 Ga0068865_100715375 3300006881 Bacteria 857
121 Ga0068865_101055835 3300006881 Bacteria 714
122 Ga0097620_100100341 3300006931 Bacteria 2950
123 Ga0097620_100440960 3300006931 Bacteria 1398
124 Ga0097620_102178200 3300006931 Bacteria 612
125 Ga0075435_100001248 3300007076 Bacteria 16274
126 Ga0111539_10377841 3300009094 Bacteria 1649
127 Ga0111539_11725807 3300009094 Bacteria 726
128 Ga0105245_10197897 3300009098 Bacteria 1928
129 Ga0114129_12738559 3300009147 Bacteria 587
130 Ga0114129_13136368 3300009147 Bacteria 539
131 Ga0105243_10080790 3300009148 Bacteria 2652
132 Ga0105243_10234095 3300009148 Bacteria 1631
133 Ga0105243_11990091 3300009148 Bacteria 615
134 Ga0105243_12860714 3300009148 Bacteria 523
135 Ga0105241_10220231 3300009174 Bacteria 1595
136 Ga0105242_10281761 3300009176 Bacteria 1510
137 Ga0105242_13082246 3300009176 Bacteria 516
138 Ga0105248_10060479 3300009177 Bacteria 4253
139 Ga0105248_10711291 3300009177 Bacteria 1133
140 Ga0105248_13320082 3300009177 Bacteria 511
141 Ga0105248_13349815 3300009177 Bacteria 509
142 Ga0105237_10790873 3300009545 Bacteria 955
143 Ga0105238_10049434 3300009551 Bacteria 4235
144 Ga0105249_10214634 3300009553 Bacteria 1890
145 Ga0157378_10062106 3300013297 Bacteria 3336
146 Ga0163162_11058114 3300013306 Bacteria 918
147 Ga0163162_13212414 3300013306 Unclassified 524
148 Ga0163163_10058011 3300014325 Bacteria 3828
149 Ga0163163_10800450 3300014325 Bacteria 1006
150 Ga0157380_11088622 3300014326 Bacteria 838
151 Ga0157380_11868791 3300014326 Bacteria 661
152 Ga0157380_13543460 3300014326 Viruses 500
153 Ga0157377_10038657 3300014745 Bacteria 2635
154 Ga0157377_11420025 3300014745 Bacteria 548
155 Ga0157379_12439889 3300014968 Bacteria 522
156 Ga0207697_10010162 3300025315 Bacteria 4035
157 Ga0207656_10125764 3300025321 Bacteria 1197
158 Ga0207653_10123726 3300025885 Bacteria 933
159 Ga0207682_10021534 3300025893 Bacteria 2537
160 Ga0207682_10480518 3300025893 Bacteria 588
161 Ga0207710_10678954 3300025900 Bacteria 540
162 Ga0207680_10340971 3300025903 Bacteria 1051
163 Ga0207647_10155815 3300025904 Bacteria 1334
164 Ga0207699_10178198 3300025906 Bacteria 1427
165 Ga0207645_10071009 3300025907 Bacteria 2228
166 Ga0207645_10242636 3300025907 Bacteria 1190
167 Ga0207684_11284641 3300025910 Bacteria 603
168 Ga0207654_10040955 3300025911 Bacteria 2613
169 Ga0207707_10254463 3300025912 Bacteria 1525
170 Ga0207660_10749254 3300025917 Bacteria 797
171 Ga0207662_10000335 3300025918 Bacteria 21250
172 Ga0207662_10142143 3300025918 Bacteria 1521
173 Ga0207649_10085759 3300025920 Bacteria 2050
174 Ga0207681_10178290 3300025923 Bacteria 1616
175 Ga0207694_10104481 3300025924 Bacteria 2248
176 Ga0207650_10011317 3300025925 Bacteria 6139
177 Ga0207650_10040503 3300025925 Bacteria 3409
178 Ga0207650_10089887 3300025925 Bacteria 2345
179 Ga0207650_11254587 3300025925 Bacteria 631
180 Ga0207659_10014003 3300025926 Bacteria 5160
181 Ga0207659_11440210 3300025926 Bacteria 590
182 Ga0207687_10073245 3300025927 Bacteria 2452
183 Ga0207644_10042289 3300025931 Bacteria 3228
184 Ga0207644_10650120 3300025931 Bacteria 878
185 Ga0207690_10902460 3300025932 Bacteria 733
186 Ga0207706_10076797 3300025933 Bacteria 2938
187 Ga0207686_10152213 3300025934 Bacteria 1611
188 Ga0207709_10061992 3300025935 Bacteria 2339
189 Ga0207670_10037561 3300025936 Bacteria 3157
190 Ga0207670_10152888 3300025936 Bacteria 1714
191 Ga0207669_10160493 3300025937 Bacteria 1587
192 Ga0207669_10328543 3300025937 Bacteria 1173
193 Ga0207704_10137452 3300025938 Bacteria 1703
194 Ga0207704_10434770 3300025938 Bacteria 1044
195 Ga0207691_10012406 3300025940 Bacteria 8169
196 Ga0207691_10041206 3300025940 Bacteria 4265
197 Ga0207711_10024917 3300025941 Bacteria 5018
198 Ga0207689_10056244 3300025942 Bacteria 3237
199 Ga0207679_10668527 3300025945 Bacteria 941
200 Ga0207651_10001161 3300025960 Bacteria 11777
201 Ga0207712_10117868 3300025961 Bacteria 2003
202 Ga0207712_10866004 3300025961 Bacteria 797
203 Ga0207668_10626419 3300025972 Bacteria 939
204 Ga0207640_10369946 3300025981 Bacteria 1158
205 Ga0207640_10417392 3300025981 Bacteria 1097
206 Ga0207640_11140248 3300025981 Bacteria 691
207 Ga0207658_10116517 3300025986 Bacteria 2122
208 Ga0207658_10720889 3300025986 Bacteria 902
209 Ga0207703_10051492 3300026035 Bacteria 3337
210 Ga0207703_10090636 3300026035 Bacteria 2570
211 Ga0207639_10667808 3300026041 Bacteria 962
212 Ga0207678_10336625 3300026067 Bacteria 1300
213 Ga0207708_10000882 3300026075 Bacteria 22535
214 Ga0207708_10299714 3300026075 Bacteria 1307
215 Ga0207708_11117426 3300026075 Bacteria 687
216 Ga0207648_10003371 3300026089 Bacteria 16779
217 Ga0207676_10018723 3300026095 Bacteria 5040
218 Ga0207676_10232029 3300026095 Bacteria 1650
219 Ga0207676_10739549 3300026095 Bacteria 956
220 Ga0207675_100343014 3300026118 Bacteria 1463
221 Ga0207675_100872346 3300026118 Bacteria 915
222 Ga0207683_10161807 3300026121 Bacteria 2024
223 Ga0207683_10636821 3300026121 Bacteria 987
224 Ga0207683_10766920 3300026121 Bacteria 895
225 Ga0207698_10627548 3300026142 Bacteria 1062
226 Ga0209968_1021819 3300027526 Unclassified 1041
227 Ga0209971_1046856 3300027682 Bacteria 1043
228 Ga0209971_1095077 3300027682 Bacteria 728
229 Ga0209974_10431506 3300027876 Bacteria 521
230 Ga0268265_10107346 3300028380 Bacteria 2270
231 Ga0268265_10145151 3300028380 Bacteria 1993
232 Ga0268265_11273436 3300028380 Bacteria 735
233 Ga0268264_10029587 3300028381 Bacteria 4487
234 Ga0268264_10312125 3300028381 Bacteria 1484
235 Ga0307408_100073898 3300031548 Bacteria 2528
236 Ga0307408_100168824 3300031548 Bacteria 1745
237 Ga0307408_100330001 3300031548 Bacteria 1288
238 Ga0307408_101387808 3300031548 Bacteria 661
239 Ga0307405_10024531 3300031731 Bacteria 3446
240 Ga0307405_10191269 3300031731 Bacteria 1478
241 Ga0307405_10835918 3300031731 Bacteria 774
242 Ga0307405_11943833 3300031731 Bacteria 525
243 Ga0307413_10007392 3300031824 Bacteria 5099
244 Ga0307413_10091526 3300031824 Bacteria 1982
245 Ga0307413_10465830 3300031824 Bacteria 1006
246 Ga0307413_10859903 3300031824 Bacteria 767
247 Ga0307413_11340502 3300031824 Bacteria 627
248 Ga0307410_10017954 3300031852 Bacteria 4262
249 Ga0307410_10188147 3300031852 Bacteria 1568
250 Ga0307410_10521256 3300031852 Bacteria 981
251 Ga0307410_10540033 3300031852 Bacteria 965
252 Ga0307406_10034012 3300031901 Bacteria 3124
253 Ga0307406_10088032 3300031901 Bacteria 2083
254 Ga0307406_11146276 3300031901 Unclassified 673
255 Ga0307407_10003307 3300031903 Bacteria 6582
256 Ga0307407_11501173 3300031903 Unclassified 533
257 Ga0307412_10046055 3300031911 Bacteria 2855
258 Ga0307412_10125764 3300031911 Bacteria 1854
259 Ga0307412_11349862 3300031911 Bacteria 643
260 Ga0307409_100116478 3300031995 Bacteria 2252
261 Ga0307409_100134040 3300031995 Bacteria 2122
262 Ga0307409_100496133 3300031995 Bacteria 1188
263 Ga0307409_100643684 3300031995 Bacteria 1053
264 Ga0307409_100724431 3300031995 Bacteria 996
265 Ga0307409_101483007 3300031995 Bacteria 705
266 Ga0307416_100012107 3300032002 Bacteria 5792
267 Ga0307416_100023548 3300032002 Bacteria 4471
268 Ga0307416_100031363 3300032002 Bacteria 4000
269 Ga0307416_100051011 3300032002 Bacteria 3302
270 Ga0307416_100081379 3300032002 Bacteria 2738
271 Ga0307416_100488480 3300032002 Bacteria 1293
272 Ga0307416_100761028 3300032002 Bacteria 1062
273 Ga0307416_101005152 3300032002 Bacteria 937
274 Ga0307416_101049757 3300032002 Bacteria 919
275 Ga0307414_10018571 3300032004 Bacteria 4287
276 Ga0307414_10153801 3300032004 Bacteria 1818
277 Ga0307414_10405466 3300032004 Bacteria 1185
278 Ga0307411_10012380 3300032005 Bacteria 4653
279 Ga0307411_10221680 3300032005 Bacteria 1468
280 Ga0307411_10586039 3300032005 Bacteria 957
281 Ga0307411_10814863 3300032005 Bacteria 823
282 Ga0307411_10956835 3300032005 Bacteria 764
283 Ga0307411_11057332 3300032005 Unclassified 729
284 Ga0307411_11859865 3300032005 Unclassified 560
285 Ga0307415_100006073 3300032126 Bacteria 6475
286 Ga0307415_100309441 3300032126 Bacteria 1312
287 Ga0307415_100608623 3300032126 Bacteria 973
288 Ga0307415_100827605 3300032126 Bacteria 847
289 Ga0373951_0019734 3300035091 Bacteria 1539
290 Ga0373951_0076755 3300035091 Bacteria 859
291 Ga0373936_0371709 3300035113 Bacteria 653
292 Ga0373939_0022997 3300035114 Bacteria 1723
293 Ga0373945_0065344 3300035116 Bacteria 1366
294 Ga0373942_0022269 3300035207 Bacteria 1606
295 Ga0373961_0216077 3300035241 Bacteria 682
296 Ga0373931_0266913 3300035691 Bacteria 1046
297 Ga0373935_0042913 3300035692 Bacteria 2845
298 Ga0373925_0032783 3300037068 Bacteria 3825
299 Ga0395905_0135023 3300037471 Bacteria 2321
300 Ga0395905_0525141 3300037471 Bacteria 1084
301 Ga0439453_0072041 3300041408 Bacteria 732
302 Ga0439461_0040708 3300041410 Bacteria 1003
303 Ga0439461_0086542 3300041410 Bacteria 746
304 Ga0451807_1794473 3300041486 Bacteria 1148
305 Ga0451851_1280590 3300041507 Bacteria 621
306 Ga0439433_0019043 3300041999 Bacteria 1529
307 Ga0439441_011650 3300042001 Bacteria 1495
308 Ga0439449_0093547 3300042007 Bacteria 1110
309 Ga0439450_047826 3300042008 Bacteria 1009
310 Ga0439454_052621 3300042011 Bacteria 691
311 Ga0439455_0061011 3300042012 Bacteria 1000
312 Ga0439457_067586 3300042014 Bacteria 813
313 Ga0439463_184984 3300042016 Bacteria 541
314 Ga0450923_062758 3300042125 Bacteria 813
315 Ga0450896_046435 3300042133 Bacteria 685
316 Ga0450896_079036 3300042133 Unclassified 552
317 Ga0439446_0115149 3300042156 Bacteria 861
318 Ga0439446_0122052 3300042156 Bacteria 839
319 Ga0439446_0334373 3300042156 Bacteria 537
320 Ga0439434_0103486 3300042435 Bacteria 918
321 Ga0439434_0158958 3300042435 Bacteria 750
322 Ga0439435_0007316 3300042436 Bacteria 2521
323 Ga0439435_0172370 3300042436 Bacteria 703
324 Ga0439435_0181772 3300042436 Bacteria 687
325 Ga0439444_0069312 3300042437 Bacteria 752
326 Ga0439460_0110595 3300042461 Bacteria 891
327 Ga0450918_070689 3300042531 Bacteria 655
328 Ga0439440_0263278 3300042993 Bacteria 528
329 Ga0451576_1415356 3300045051 Bacteria 723
330 Ga0495666_0516016 3300046526 Bacteria 534
331 Ga0495586_0215405 3300046535 Bacteria 1090
332 Ga0495598_0023370 3300046537 Bacteria 1664
333 Ga0495598_0072293 3300046537 Bacteria 1089
334 Ga0495621_0286816 3300046539 Bacteria 679
335 Ga0495633_0021446 3300046558 Bacteria 3232
336 Ga0495659_0432640 3300046664 Bacteria 571
337 Ga0495658_0209304 3300046683 Bacteria 1218
338 Ga0495674_0597207 3300047319 Bacteria 875
339 Ga0495674_1310908 3300047319 Bacteria 543
340 Ga0495681_0217040 3300047470 Bacteria 769
341 Ga0496101_0767954 3300048904 Bacteria 760
342 Ga0496102_0392073 3300048905 Bacteria 1306
343 Ga0496103_0228537 3300048906 Bacteria 1197
344 Ga0496103_0622506 3300048906 Bacteria 687
345 Ga0496106_0103383 3300048909 Bacteria 2211
346 Ga0496106_0832788 3300048909 Bacteria 731
347 Ga0496109_0154384 3300048912 Bacteria 2150
348 Ga0496112_0242199 3300048915 Bacteria 1756
349 Ga0496112_0946218 3300048915 Bacteria 782
350 Ga0496112_0977004 3300048915 Bacteria 767
351 Ga0496113_0451158 3300048916 Bacteria 1033
352 Ga0501297_044387 3300049520 Unclassified 636
353 Ga0501040_0488150 3300049576 Bacteria 888
354 Ga0501046_0897983 3300049580 Unclassified 618
355 Ga0501067_0317714 3300049583 Bacteria 867
356 Ga0501068_0559092 3300049584 Bacteria 744
357 Ga0501068_0849587 3300049584 Bacteria 600
358 Ga0501072_0531812 3300049588 Bacteria 929
359 Ga0501075_1179899 3300049591 Bacteria 581
360 Ga0501076_0346983 3300049592 Bacteria 1219
361 Ga0501253_099233 3300049683 Bacteria 680
362 Ga0501234_052656 3300049707 Bacteria 680
363 Ga0501079_0036393 3300049741 Bacteria 3792
364 Ga0501079_1325696 3300049741 Bacteria 567
365 Ga0501080_1118382 3300049742 Bacteria 680
366 Ga0501080_1336613 3300049742 Bacteria 613
367 Ga0501081_0469930 3300049743 Bacteria 935
368 Ga0501270_111474 3300049767 Unclassified 584
369 Ga0501045_0796578 3300049824 Bacteria 696
370 Ga0501045_1225471 3300049824 Bacteria 547
371 nmdc:mga03683_558934_c1 3300050489 Bacteria 557
372 nmdc:mga00v17_121847_c1 3300050491 Bacteria 1661
373 nmdc:mga0yw44_19137_c1 3300050492 Bacteria 3768
374 nmdc:mga0k408_297854_c1 3300050493 Bacteria 963
375 nmdc:mga06z11_190113_c1 3300050494 Bacteria 1188
376 nmdc:mga06z11_458953_c1 3300050494 Bacteria 770
377 nmdc:mga09592_207282_c1 3300050508 Bacteria 1698
378 nmdc:mga0qj67_670552_c1 3300050509 Bacteria 826
379 nmdc:mga06r32_244889_c1 3300050510 Bacteria 1780
380 nmdc:mga06r32_327719_c1 3300050510 Bacteria 1516
381 nmdc:mga06r32_85488_c1 3300050510 Bacteria 3075
382 nmdc:mga06r32_932947_c1 3300050510 Bacteria 823
383 nmdc:mga08y16_128304_c1 3300050511 Bacteria 2638
384 nmdc:mga08y16_866376_c1 3300050511 Bacteria 891
385 nmdc:mga0n895_699372_c1 3300050512 Bacteria 1010
386 nmdc:mga0rr50_710864_c1 3300050513 Bacteria 858
387 nmdc:mga08x19_132890_c1 3300050514 Bacteria 1675
388 nmdc:mga0a205_159708_c1 3300050515 Bacteria 2151
389 Ga0495619_0096332 3300053085 Bacteria 2009
390 Ga0501084_1429377 3300054114 Bacteria 579
391 Ga0590071_042185 3300059421 Bacteria 1099
392 Ga0590075_197560 3300059424 Bacteria 532
393 Ga0590075_203459 3300059424 Bacteria 524
394 Ga0501082_0133739 3300060353 Bacteria 2152
395 Ga0501082_1137392 3300060353 Bacteria 682
396 Ga0530510_0671923 3300061734 Bacteria 789
397 JGI24738J21930_10156844
398 JGI24751J29686_10026839
399 Ga0065704_10199312
400 Ga0065712_10005304
401 Ga0065712_10628143
402 Ga0065712_10695243
403 Ga0065712_10791807
404 Ga0065715_10009723
405 Ga0065715_10101878
406 Ga0065715_10980255
407 Ga0065707_10013364
408 Ga0065707_10277108
409 Ga0065707_10613372
410 Ga0065707_10721127
411 Ga0070676_10019754
412 Ga0070676_10607962
413 Ga0070676_11503362
414 Ga0070690_100009989
415 Ga0070690_100035053
416 Ga0070670_100014012
417 Ga0070670_100038303
418 Ga0070670_100039016
419 Ga0070670_100362036
420 Ga0070670_101819799
421 Ga0070677_10116145
422 Ga0070677_10623507
423 Ga0070666_10739451
424 Ga0070680_100334728
425 Ga0070682_100250460
426 Ga0068868_100043245
427 Ga0070689_100051061
428 Ga0070689_100266349
429 Ga0070691_10024379
430 Ga0070687_100013541
431 Ga0070687_100158159
432 Ga0070661_100156789
433 Ga0070661_100828352
434 Ga0070692_10043493
435 Ga0070669_100030130
436 Ga0070669_100590479
437 Ga0070669_101072145
438 Ga0070675_100037307
439 Ga0070675_100169036
440 Ga0070671_100212121
441 Ga0070671_100262263
442 Ga0070671_101750575
443 Ga0070674_100626499
444 Ga0070673_100026895
445 Ga0070673_100035006
446 Ga0070688_100011546
447 Ga0070688_100486417
448 Ga0070659_100928462
449 Ga0070659_101650498
450 Ga0070667_100169201
451 Ga0070703_10074089
452 Ga0070701_10464753
453 Ga0070705_100087060
454 Ga0070700_100046807
455 Ga0070700_100421505
456 Ga0070700_100588462
457 Ga0070663_100310737
458 Ga0070678_101441324
459 Ga0070662_100987277
460 Ga0070662_101834739
461 Ga0070681_10230721
462 Ga0068867_100008420
463 Ga0070698_101420934
464 Ga0070672_100151061
465 Ga0070686_100036019
466 Ga0070686_100205146
467 Ga0070695_100021897
468 Ga0070696_100486214
469 Ga0070696_101002630
470 Ga0070696_101556559
471 Ga0070693_100008359
472 Ga0070693_101231445
473 Ga0070704_100016923
474 Ga0070704_101541520
475 Ga0070704_101711910
476 Ga0068855_101673062
477 Ga0070664_100011368
478 Ga0070664_100210715
479 Ga0070664_100365519
480 Ga0070664_100427625
481 Ga0068857_100067995
482 Ga0068854_100023296
483 Ga0068854_101066246
484 Ga0068856_102593091
485 Ga0070702_100010684
486 Ga0070702_100637899
487 Ga0068852_101082363
488 Ga0068859_100100341
489 Ga0068859_100440954
490 Ga0068859_102177926
491 Ga0068864_100027039
492 Ga0068864_100316461
493 Ga0068866_10215694
494 Ga0068861_100357155
495 Ga0068861_101447533
496 Ga0068851_10094376
497 Ga0068858_100020935
498 Ga0068858_101242088
499 Ga0068860_100010205
500 Ga0068860_100676533
501 Ga0068862_100484075
502 Ga0075365_10009452
503 Ga0075364_11059851
504 Ga0075367_10194655
505 Ga0075430_100596916
506 Ga0075430_101276816
507 Ga0075431_100106985
508 Ga0075431_100179510
509 Ga0075431_100722481
510 Ga0075431_101263980
511 Ga0075433_10889505
512 Ga0075434_100988719
513 Ga0075434_101121090
514 Ga0075429_100350986
515 Ga0075429_101440942
516 Ga0068865_100715375
517 Ga0068865_101055835
518 Ga0097620_100100341
519 Ga0097620_100440960
520 Ga0097620_102178200
521 Ga0075435_100001248
522 Ga0111539_10377841
523 Ga0111539_11725807
524 Ga0105245_10197897
525 Ga0114129_12738559
526 Ga0114129_13136368
527 Ga0105243_10080790
528 Ga0105243_10234095
529 Ga0105243_11990091
530 Ga0105243_12860714
531 Ga0105241_10220231
532 Ga0105242_10281761
533 Ga0105242_13082246
534 Ga0105248_10060479
535 Ga0105248_10711291
536 Ga0105248_13320082
537 Ga0105248_13349815
538 Ga0105237_10790873
539 Ga0105238_10049434
540 Ga0105249_10214634
541 Ga0157378_10062106
542 Ga0163162_11058114
543 Ga0163162_13212414
544 Ga0163163_10058011
545 Ga0163163_10800450
546 Ga0157380_11088622
547 Ga0157380_11868791
548 Ga0157380_13543460
549 Ga0157377_10038657
550 Ga0157377_11420025
551 Ga0157379_12439889
552 Ga0207697_10010162
553 Ga0207656_10125764
554 Ga0207653_10123726
555 Ga0207682_10021534
556 Ga0207682_10480518
557 Ga0207710_10678954
558 Ga0207680_10340971
559 Ga0207647_10155815
560 Ga0207699_10178198
561 Ga0207645_10071009
562 Ga0207645_10242636
563 Ga0207684_11284641
564 Ga0207654_10040955
565 Ga0207707_10254463
566 Ga0207660_10749254
567 Ga0207662_10000335
568 Ga0207662_10142143
569 Ga0207649_10085759
570 Ga0207681_10178290
571 Ga0207694_10104481
572 Ga0207650_10011317
573 Ga0207650_10040503
574 Ga0207650_10089887
575 Ga0207650_11254587
576 Ga0207659_10014003
577 Ga0207659_11440210
578 Ga0207687_10073245
579 Ga0207644_10042289
580 Ga0207644_10650120
581 Ga0207690_10902460
582 Ga0207706_10076797
583 Ga0207686_10152213
584 Ga0207709_10061992
585 Ga0207670_10037561
586 Ga0207670_10152888
587 Ga0207669_10160493
588 Ga0207669_10328543
589 Ga0207704_10137452
590 Ga0207704_10434770
591 Ga0207691_10012406
592 Ga0207691_10041206
593 Ga0207711_10024917
594 Ga0207689_10056244
595 Ga0207679_10668527
596 Ga0207651_10001161
597 Ga0207712_10117868
598 Ga0207712_10866004
599 Ga0207668_10626419
600 Ga0207640_10369946
601 Ga0207640_10417392
602 Ga0207640_11140248
603 Ga0207658_10116517
604 Ga0207658_10720889
605 Ga0207703_10051492
606 Ga0207703_10090636
607 Ga0207639_10667808
608 Ga0207678_10336625
609 Ga0207708_10000882
610 Ga0207708_10299714
611 Ga0207708_11117426
612 Ga0207648_10003371
613 Ga0207676_10018723
614 Ga0207676_10232029
615 Ga0207676_10739549
616 Ga0207675_100343014
617 Ga0207675_100872346
618 Ga0207683_10161807
619 Ga0207683_10636821
620 Ga0207683_10766920
621 Ga0207698_10627548
622 Ga0209968_1021819
623 Ga0209971_1046856
624 Ga0209971_1095077
625 Ga0209974_10431506
626 Ga0268265_10107346
627 Ga0268265_10145151
628 Ga0268265_11273436
629 Ga0268264_10029587
630 Ga0268264_10312125
631 Ga0307408_100073898
632 Ga0307408_100168824
633 Ga0307408_100330001
634 Ga0307408_101387808
635 Ga0307405_10024531
636 Ga0307405_10191269
637 Ga0307405_10835918
638 Ga0307405_11943833
639 Ga0307413_10007392
640 Ga0307413_10091526
641 Ga0307413_10465830
642 Ga0307413_10859903
643 Ga0307413_11340502
644 Ga0307410_10017954
645 Ga0307410_10188147
646 Ga0307410_10521256
647 Ga0307410_10540033
648 Ga0307406_10034012
649 Ga0307406_10088032
650 Ga0307406_11146276
651 Ga0307407_10003307
652 Ga0307407_11501173
653 Ga0307412_10046055
654 Ga0307412_10125764
655 Ga0307412_11349862
656 Ga0307409_100116478
657 Ga0307409_100134040
658 Ga0307409_100496133
659 Ga0307409_100643684
660 Ga0307409_100724431
661 Ga0307409_101483007
662 Ga0307416_100012107
663 Ga0307416_100023548
664 Ga0307416_100031363
665 Ga0307416_100051011
666 Ga0307416_100081379
667 Ga0307416_100488480
668 Ga0307416_100761028
669 Ga0307416_101005152
670 Ga0307416_101049757
671 Ga0307414_10018571
672 Ga0307414_10153801
673 Ga0307414_10405466
674 Ga0307411_10012380
675 Ga0307411_10221680
676 Ga0307411_10586039
677 Ga0307411_10814863
678 Ga0307411_10956835
679 Ga0307411_11057332
680 Ga0307411_11859865
681 Ga0307415_100006073
682 Ga0307415_100309441
683 Ga0307415_100608623
684 Ga0307415_100827605
685 Ga0373951_0019734
686 Ga0373951_0076755
687 Ga0373936_0371709
688 Ga0373939_0022997
689 Ga0373945_0065344
690 Ga0373942_0022269
691 Ga0373961_0216077
692 Ga0373931_0266913
693 Ga0373935_0042913
694 Ga0373925_0032783
695 Ga0395905_0135023
696 Ga0395905_0525141
697 Ga0439453_0072041
698 Ga0439461_0040708
699 Ga0439461_0086542
700 Ga0451807_1794473
701 Ga0451851_1280590
702 Ga0439433_0019043
703 Ga0439441_011650
704 Ga0439449_0093547
705 Ga0439450_047826
706 Ga0439454_052621
707 Ga0439455_0061011
708 Ga0439457_067586
709 Ga0439463_184984
710 Ga0450923_062758
711 Ga0450896_046435
712 Ga0450896_079036
713 Ga0439446_0115149
714 Ga0439446_0122052
715 Ga0439446_0334373
716 Ga0439434_0103486
717 Ga0439434_0158958
718 Ga0439435_0007316
719 Ga0439435_0172370
720 Ga0439435_0181772
721 Ga0439444_0069312
722 Ga0439460_0110595
723 Ga0450918_070689
724 Ga0439440_0263278
725 Ga0451576_1415356
726 Ga0495666_0516016
727 Ga0495586_0215405
728 Ga0495598_0023370
729 Ga0495598_0072293
730 Ga0495621_0286816
731 Ga0495633_0021446
732 Ga0495659_0432640
733 Ga0495658_0209304
734 Ga0495674_0597207
735 Ga0495674_1310908
736 Ga0495681_0217040
737 Ga0496101_0767954
738 Ga0496102_0392073
739 Ga0496103_0228537
740 Ga0496103_0622506
741 Ga0496106_0103383
742 Ga0496106_0832788
743 Ga0496109_0154384
744 Ga0496112_0242199
745 Ga0496112_0946218
746 Ga0496112_0977004
747 Ga0496113_0451158
748 Ga0501297_044387
749 Ga0501040_0488150
750 Ga0501046_0897983
751 Ga0501067_0317714
752 Ga0501068_0559092
753 Ga0501068_0849587
754 Ga0501072_0531812
755 Ga0501075_1179899
756 Ga0501076_0346983
757 Ga0501253_099233
758 Ga0501234_052656
759 Ga0501079_0036393
760 Ga0501079_1325696
761 Ga0501080_1118382
762 Ga0501080_1336613
763 Ga0501081_0469930
764 Ga0501270_111474
765 Ga0501045_0796578
766 Ga0501045_1225471
767 nmdc:mga03683_558934_c1
768 nmdc:mga00v17_121847_c1
769 nmdc:mga0yw44_19137_c1
770 nmdc:mga0k408_297854_c1
771 nmdc:mga06z11_190113_c1
772 nmdc:mga06z11_458953_c1
773 nmdc:mga09592_207282_c1
774 nmdc:mga0qj67_670552_c1
775 nmdc:mga06r32_244889_c1
776 nmdc:mga06r32_327719_c1
777 nmdc:mga06r32_85488_c1
778 nmdc:mga06r32_932947_c1
779 nmdc:mga08y16_128304_c1
780 nmdc:mga08y16_866376_c1
781 nmdc:mga0n895_699372_c1
782 nmdc:mga0rr50_710864_c1
783 nmdc:mga08x19_132890_c1
784 nmdc:mga0a205_159708_c1
785 Ga0495619_0096332
786 Ga0501084_1429377
787 Ga0590071_042185
788 Ga0590075_197560
789 Ga0590075_203459
790 Ga0501082_0133739
791 Ga0501082_1137392
792 Ga0530510_0671923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

18

68

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhn-assembly1.cif.gz_3 vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9315 18 72
7msh-assembly1.cif.gz_Z mtb 70sic in complex with mtbetta at pre_r1 state 0.9278 16 72
6fxc-assembly1.cif.gz_AX the cryo-em structure of hibernating 100s ribosome dimer from pathogenic staphylococcus aureus 0.9269 16 72
5xym-assembly1.cif.gz_Z large subunit of mycobacterium smegmatis 0.9243 16 72
5hl7-assembly1.cif.gz_W the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin 0.9238 16 72
ID Description Score Start End Superfamily
af_P9WHA3_1_65_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9363 17 71 3.30.1390.20
af_B6SIL2_19_102_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.933 16 72 3.30.1390.20
af_P40693_141_300_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9328 18 72 3.30.1390.20
af_C0H5I4_95_195_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9304 19 72 3.30.1390.20
af_Q54GH8_53_110_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9252 18 72 3.30.1390.20
ID Description Score Start End GO Terms
AF-A0A3D0FPQ4-F1-model_v4 Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL15; Large ribosomal subunit protein uL30] 0.9891 17 72 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-C7LKI6-F1-model_v4 Multifunctional fusion protein [Includes: Small ribosomal subunit protein uS5; Large ribosomal subunit protein uL30] 0.9792 17 72 GO:0003735
GO:0006412
GO:0015934
GO:0015935
GO:0019843
AF-A0A6L7YVA9-F1-model_v4 50S ribosomal protein L30 0.9444 16 72 GO:0003735
GO:0006412
GO:0022625
AF-A0A2T2U8X1-F1-model_v4 Large ribosomal subunit protein uL30 0.9444 17 72 GO:0003735
GO:0006412
GO:0015934
AF-A0A7V6TJD6-F1-model_v4 Large ribosomal subunit protein uL30 0.9434 17 71 GO:0003735
GO:0006412
GO:0022625

Map