F433395

General Info

Members Datasets Scaffolds Average Seq Length
396 209 396 96

Family's Representative Sequence

Representative Sequence 3300004798|Ga0058859_11807771|Ga0058859_118077714
Length 100
Sequence MTSIYEVLRRPLITEKSNYQSSKLNQYAFEVADVATKTLVKDAIETLFDVKVESVNIINSPAKRGRAARSRRLRVRRPGYKKAIVTLQTGQTLQIFEGVQ

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
69 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
77 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
78 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
93 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
94 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
106 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
107 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
108 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
109 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
110 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
111 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
112 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
118 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
119 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
120 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
121 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
122 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
123 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
124 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
125 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
126 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
127 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
128 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
131 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
154 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
170 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
171 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
172 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
173 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
174 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
175 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
176 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
177 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
178 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
181 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
182 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
183 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
190 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
191 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
192 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
193 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
194 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
195 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
196 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
201 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
202 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 64.14
Metatranscriptomes 35.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 0
Rhizoplane 5.81
Rhizosphere 75.76
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10010612 3300003316 Bacteria 9244
2 rootH2_10003970 3300003320 Bacteria 33753
3 rootH2_10294855 3300003320 Bacteria 1010
4 rootL2_10010167 3300003322 Bacteria 22542
5 rootL2_10011247 3300003322 Bacteria 9421
6 rootL2_10069174 3300003322 Bacteria 1487
7 rootH1_10012094 3300003323 Bacteria 18730
8 rootH1_10096008 3300003323 Bacteria 1417
9 rootH1_10108515 3300003323 Bacteria 1780
10 rootH1_10109910 3300003323 Bacteria 1897
11 rootH1_10189698 3300003323 Bacteria 1404
12 Ga0007417J51691_1063811 3300003544 Bacteria 1562
13 Ga0007417J51691_1119812 3300003544 Bacteria 554
14 Ga0007410J51695_1190805 3300003574 Unclassified 646
15 Ga0055531_10000409 3300003794 Bacteria 41322
16 Ga0058858_1304125 3300004785 Bacteria 1083
17 Ga0058859_11772199 3300004798 Bacteria 861
18 Ga0058859_11782699 3300004798 Bacteria 2040
19 Ga0058859_11807771 3300004798 Bacteria 2457
20 Ga0058861_10639398 3300004800 Bacteria 527
21 Ga0058860_12155377 3300004801 Bacteria 1355
22 Ga0065165_1000831 3300005262 Bacteria 40595
23 Ga0070670_101446776 3300005331 Bacteria 630
24 Ga0068869_101636620 3300005334 Bacteria 574
25 Ga0070682_100379340 3300005337 Bacteria 1063
26 Ga0070671_100694505 3300005355 Bacteria 882
27 Ga0070674_100196180 3300005356 Bacteria 1556
28 Ga0070673_101043047 3300005364 Unclassified 762
29 Ga0070694_100716938 3300005444 Unclassified 814
30 Ga0070663_100772965 3300005455 Bacteria 822
31 Ga0070706_101671029 3300005467 Bacteria 580
32 Ga0070707_100864849 3300005468 Bacteria 868
33 Ga0070665_101545894 3300005548 Bacteria 672
34 Ga0068855_100289382 3300005563 Bacteria 1817
35 Ga0068855_100819560 3300005563 Bacteria 988
36 Ga0068852_100481522 3300005616 Bacteria 1233
37 Ga0068859_102024150 3300005617 Bacteria 636
38 Ga0068864_100623000 3300005618 Bacteria 1049
39 Ga0068863_100436656 3300005841 Bacteria 1283
40 Ga0068863_101462392 3300005841 Bacteria 691
41 Ga0070716_100039818 3300006173 Bacteria 2611
42 Ga0075366_10113400 3300006195 Bacteria 1632
43 Ga0075366_10117598 3300006195 Bacteria 1601
44 Ga0075366_10214393 3300006195 Bacteria 1172
45 Ga0075366_10254670 3300006195 Bacteria 1071
46 Ga0097621_100552590 3300006237 Bacteria 1048
47 Ga0068871_100804088 3300006358 Bacteria 867
48 Ga0068871_101346776 3300006358 Bacteria 672
49 Ga0075428_100013576 3300006844 Bacteria 9071
50 Ga0075428_100182361 3300006844 Bacteria 2272
51 Ga0075428_101838215 3300006844 Bacteria 630
52 Ga0075430_100076161 3300006846 Bacteria 2812
53 Ga0075430_100947121 3300006846 Bacteria 709
54 Ga0075431_100328003 3300006847 Bacteria 1542
55 Ga0075429_100406578 3300006880 Unclassified 1192
56 Ga0097620_102023253 3300006931 Bacteria 636
57 Ga0099795_10227244 3300007788 Bacteria 796
58 Ga0105240_11213135 3300009093 Bacteria 798
59 Ga0111539_10013971 3300009094 Bacteria 10037
60 Ga0111539_10015243 3300009094 Bacteria 9574
61 Ga0111539_11044356 3300009094 Bacteria 950
62 Ga0105245_12950596 3300009098 Bacteria 527
63 Ga0114129_10992865 3300009147 Bacteria 1058
64 Ga0105242_11828151 3300009176 Unclassified 646
65 Ga0105237_11943133 3300009545 Bacteria 597
66 Ga0105239_12832649 3300010375 Bacteria 566
67 Ga0157370_11835706 3300013104 Bacteria 544
68 Ga0157374_11836875 3300013296 Bacteria 631
69 Ga0157380_10006042 3300014326 Bacteria 8483
70 Ga0157380_10367721 3300014326 Bacteria 1352
71 Ga0157380_10371628 3300014326 Bacteria 1346
72 Ga0209050_1005534 3300025298 Bacteria 7892
73 Ga0209257_1000007 3300025304 Bacteria 1564415
74 Ga0209257_1024055 3300025304 Bacteria 2120
75 Ga0207685_10655897 3300025905 Bacteria 568
76 Ga0207660_10540154 3300025917 Bacteria 948
77 Ga0207646_10708493 3300025922 Bacteria 900
78 Ga0207650_10997248 3300025925 Bacteria 712
79 Ga0207670_11896455 3300025936 Bacteria 507
80 Ga0207669_10789503 3300025937 Bacteria 787
81 Ga0207665_10050775 3300025939 Bacteria 2790
82 Ga0207689_11395806 3300025942 Bacteria 587
83 Ga0207667_10182531 3300025949 Bacteria 2154
84 Ga0207639_10470787 3300026041 Bacteria 1144
85 Ga0207678_10258902 3300026067 Bacteria 1491
86 Ga0207641_10450750 3300026088 Bacteria 1243
87 Ga0207641_11066808 3300026088 Bacteria 806
88 Ga0207675_102008401 3300026118 Bacteria 596
89 Ga0209974_10056787 3300027876 Bacteria 1321
90 Ga0207428_10076578 3300027907 Bacteria 2619
91 Ga0268266_11739762 3300028379 Bacteria 598
92 Ga0265334_10059688 3300028573 Bacteria 1441
93 Ga0265322_10037791 3300028654 Bacteria 1375
94 Ga0265336_10095884 3300028666 Bacteria 884
95 Ga0307515_10000009 3300028794 Bacteria 653206
96 Ga0307515_10223509 3300028794 Bacteria 1694
97 Ga0265320_10166534 3300031240 Bacteria 991
98 Ga0265327_10012244 3300031251 Bacteria 5812
99 Ga0265327_10177642 3300031251 Unclassified 975
100 Ga0307513_10127710 3300031456 Bacteria 2494
101 Ga0307513_10345615 3300031456 Bacteria 1237
102 Ga0307513_10947434 3300031456 Unclassified 569
103 Ga0307509_10007469 3300031507 Bacteria 14263
104 Ga0307509_10244733 3300031507 Bacteria 1583
105 Ga0307408_100038382 3300031548 Bacteria 3379
106 Ga0307514_10127372 3300031649 Bacteria 1761
107 Ga0316575_10005259 3300031665 Bacteria 4608
108 Ga0316575_10188196 3300031665 Bacteria 858
109 Ga0316579_10034892 3300031691 Bacteria 2316
110 Ga0316579_10181577 3300031691 Bacteria 1017
111 Ga0316576_10305712 3300031727 Bacteria 1188
112 Ga0316578_10165582 3300031728 Unclassified 1332
113 Ga0316578_10401279 3300031728 Unclassified 813
114 Ga0307516_10090261 3300031730 Bacteria 2893
115 Ga0307516_10379585 3300031730 Unclassified 1075
116 Ga0307405_10182283 3300031731 Bacteria 1509
117 Ga0316577_10000831 3300031733 Bacteria 13456
118 Ga0316577_10012140 3300031733 Bacteria 4686
119 Ga0316577_10162713 3300031733 Bacteria 1259
120 Ga0307413_10081698 3300031824 Bacteria 2073
121 Ga0307413_10272992 3300031824 Bacteria 1267
122 Ga0307410_11258732 3300031852 Bacteria 646
123 Ga0307406_10310540 3300031901 Unclassified 1215
124 Ga0307412_10010885 3300031911 Bacteria 5251
125 Ga0307412_10276740 3300031911 Bacteria 1316
126 Ga0307409_100054022 3300031995 Bacteria 3091
127 Ga0307416_100000249 3300032002 Bacteria 28628
128 Ga0307411_10133368 3300032005 Bacteria 1819
129 Ga0307411_10717102 3300032005 Unclassified 873
130 Ga0307411_11196779 3300032005 Bacteria 689
131 Ga0307411_11782914 3300032005 Unclassified 571
132 Ga0307415_100012733 3300032126 Bacteria 4876
133 Ga0307415_100986883 3300032126 Unclassified 782
134 Ga0316585_10037098 3300032137 Bacteria 1547
135 Ga0316580_10078224 3300032139 Unclassified 1012
136 Ga0316593_10000074 3300032168 Bacteria 12104
137 Ga0316593_10000617 3300032168 Bacteria 6770
138 Ga0316593_10002633 3300032168 Bacteria 4303
139 Ga0316593_10015000 3300032168 Unclassified 2323
140 Ga0316593_10020329 3300032168 Unclassified 2063
141 Ga0316593_10068358 3300032168 Bacteria 1225
142 Ga0316592_1005919 3300033524 Bacteria 2341
143 Ga0316592_1037481 3300033524 Unclassified 1067
144 Ga0316592_1073354 3300033524 Unclassified 775
145 Ga0316592_1087897 3300033524 Unclassified 710
146 Ga0316596_1000338 3300033541 Bacteria 7624
147 Ga0316596_1003031 3300033541 Bacteria 3648
148 Ga0316596_1006644 3300033541 Bacteria 2700
149 Ga0316596_1012263 3300033541 Bacteria 2107
150 Ga0373955_0444201 3300035172 Bacteria 790
151 Ga0316574_0000443 3300035398 Bacteria 16514
152 Ga0316574_0008742 3300035398 Bacteria 5639
153 Ga0373931_0139815 3300035691 Bacteria 1401
154 Ga0373935_1167536 3300035692 Bacteria 574
155 Ga0373927_0006959 3300035695 Bacteria 7677
156 Ga0373933_0603477 3300035724 Bacteria 721
157 Ga0316582_0100082 3300036647 Bacteria 1919
158 Ga0316582_0211386 3300036647 Bacteria 1325
159 Ga0316584_0001621 3300036712 Bacteria 13714
160 Ga0316584_0021133 3300036712 Bacteria 4726
161 Ga0316584_0025525 3300036712 Bacteria 4336
162 Ga0316584_0071021 3300036712 Bacteria 2609
163 Ga0316584_0086663 3300036712 Bacteria 2344
164 Ga0316581_0005413 3300037588 Bacteria 3323
165 Ga0316581_0272147 3300037588 Bacteria 520
166 Ga0400484_31877 3300038725 Bacteria 1706
167 Ga0400490_32638 3300038726 Bacteria 2107
168 Ga0400487_25297 3300039110 Bacteria 1769
169 Ga0439438_159150 3300041405 Bacteria 538
170 Ga0439465_0299975 3300041413 Unclassified 601
171 Ga0451790_41984 3300041444 Bacteria 669
172 Ga0451790_43499 3300041444 Unclassified 812
173 Ga0451794_05299 3300041446 Bacteria 1663
174 Ga0451794_18318 3300041446 Bacteria 1199
175 Ga0451794_23749 3300041446 Unclassified 745
176 Ga0451794_48682 3300041446 Unclassified 882
177 Ga0451794_51005 3300041446 Bacteria 977
178 Ga0451791_0640383 3300041451 Bacteria 576
179 Ga0451791_0860646 3300041451 Bacteria 512
180 Ga0451793_0446357 3300041452 Bacteria 655
181 Ga0451797_1160083 3300041453 Bacteria 1129
182 Ga0451795_1389476 3300041456 Bacteria 506
183 Ga0451800_0013115 3300041459 Bacteria 920
184 Ga0451800_0888815 3300041459 Unclassified 709
185 Ga0451800_1586709 3300041459 Bacteria 510
186 Ga0451802_1832385 3300041460 Unclassified 508
187 Ga0451805_026295 3300041461 Bacteria 742
188 Ga0451805_091713 3300041461 Bacteria 3245
189 Ga0451805_101343 3300041461 Bacteria 667
190 Ga0451808_16930 3300041464 Bacteria 2421
191 Ga0451808_21573 3300041464 Unclassified 530
192 Ga0451808_30446 3300041464 Bacteria 549
193 Ga0451807_0764503 3300041486 Bacteria 525
194 Ga0451833_0183465 3300041491 Bacteria 534
195 Ga0451835_0046527 3300041492 Bacteria 743
196 Ga0451837_0864681 3300041494 Bacteria 547
197 Ga0451846_59758 3300041502 Bacteria 1119
198 Ga0451847_0041855 3300041503 Bacteria 555
199 Ga0451849_0601886 3300041505 Bacteria 931
200 Ga0451851_0696536 3300041507 Bacteria 968
201 Ga0451851_1231407 3300041507 Bacteria 517
202 Ga0451853_0035416 3300041512 Unclassified 507
203 Ga0451853_0061073 3300041512 Bacteria 851
204 Ga0451853_1755951 3300041512 Bacteria 537
205 Ga0451853_1932283 3300041512 Bacteria 898
206 Ga0452268_37534 3300041907 Unclassified 566
207 Ga0452271_55409 3300041916 Bacteria 1788
208 Ga0452271_66790 3300041916 Bacteria 1058
209 Ga0439445_0190247 3300042004 Unclassified 604
210 Ga0450893_0012030 3300042532 Bacteria 1434
211 Ga0450893_0080095 3300042532 Bacteria 644
212 Ga0451577_0011704 3300042876 Bacteria 8283
213 Ga0453683_0010659 3300044673 Bacteria 6086
214 Ga0453683_0031233 3300044673 Bacteria 3365
215 Ga0453683_0049521 3300044673 Bacteria 2634
216 Ga0453683_0283448 3300044673 Bacteria 1058
217 Ga0453683_0713571 3300044673 Unclassified 657
218 Ga0466964_0136930 3300044706 Bacteria 1121
219 Ga0453684_0000055 3300044712 Bacteria 532014
220 Ga0453684_0000171 3300044712 Bacteria 286600
221 Ga0453684_0005528 3300044712 Bacteria 24941
222 Ga0453684_0005611 3300044712 Bacteria 24695
223 Ga0453684_0058940 3300044712 Bacteria 4955
224 Ga0453684_0100042 3300044712 Bacteria 3550
225 Ga0453684_0147594 3300044712 Bacteria 2799
226 Ga0453684_0199678 3300044712 Bacteria 2332
227 Ga0453684_0246746 3300044712 Bacteria 2053
228 Ga0453684_0422724 3300044712 Bacteria 1488
229 Ga0453684_1086041 3300044712 Bacteria 846
230 Ga0453684_1536448 3300044712 Unclassified 685
231 Ga0453684_1828506 3300044712 Unclassified 617
232 Ga0451576_0000454 3300045051 Bacteria 93047
233 Ga0451576_0010522 3300045051 Bacteria 10601
234 Ga0451576_0018019 3300045051 Bacteria 7749
235 Ga0451576_0019853 3300045051 Bacteria 7328
236 Ga0451576_0051376 3300045051 Bacteria 4322
237 Ga0451576_0063555 3300045051 Bacteria 3848
238 Ga0451576_0360124 3300045051 Bacteria 1523
239 Ga0495592_0240269 3300046454 Bacteria 1202
240 Ga0495638_0000040 3300046460 Bacteria 241883
241 Ga0495632_0118138 3300046519 Bacteria 1241
242 Ga0495625_0247105 3300046660 Bacteria 1159
243 Ga0495660_0172100 3300046810 Bacteria 1054
244 Ga0495672_0450723 3300047320 Unclassified 580
245 Ga0495680_0805636 3300047322 Bacteria 613
246 Ga0501306_000385 3300049127 Bacteria 3273
247 Ga0501306_011488 3300049127 Unclassified 1130
248 Ga0501306_037943 3300049127 Bacteria 738
249 Ga0501308_000775 3300049128 Bacteria 2277
250 Ga0501308_008363 3300049128 Bacteria 1106
251 Ga0501308_015749 3300049128 Unclassified 899
252 Ga0501308_017193 3300049128 Bacteria 873
253 Ga0501308_033292 3300049128 Unclassified 700
254 Ga0501308_042040 3300049128 Unclassified 646
255 Ga0501308_073222 3300049128 Unclassified 535
256 Ga0501309_001746 3300049129 Bacteria 2213
257 Ga0501309_004788 3300049129 Bacteria 1588
258 Ga0501309_025351 3300049129 Bacteria 852
259 Ga0501309_086870 3300049129 Unclassified 530
260 Ga0501310_001315 3300049130 Bacteria 2236
261 Ga0501310_003146 3300049130 Bacteria 1605
262 Ga0501310_014079 3300049130 Bacteria 935
263 Ga0501310_037272 3300049130 Unclassified 666
264 Ga0501310_050415 3300049130 Bacteria 601
265 Ga0501310_054871 3300049130 Unclassified 583
266 Ga0501304_000312 3300049160 Bacteria 2329
267 Ga0501305_000824 3300049161 Bacteria 2756
268 Ga0501305_002286 3300049161 Bacteria 2044
269 Ga0501305_016933 3300049161 Bacteria 1044
270 Ga0501305_018881 3300049161 Bacteria 1002
271 Ga0501305_020281 3300049161 Bacteria 976
272 Ga0501305_022020 3300049161 Bacteria 945
273 Ga0501305_024446 3300049161 Bacteria 910
274 Ga0501305_034174 3300049161 Bacteria 805
275 Ga0501305_061401 3300049161 Bacteria 647
276 Ga0501305_069494 3300049161 Unclassified 618
277 Ga0501307_000849 3300049162 Bacteria 2333
278 Ga0501307_009133 3300049162 Bacteria 1128
279 Ga0501307_014211 3300049162 Bacteria 970
280 Ga0501307_022400 3300049162 Bacteria 830
281 Ga0501307_033698 3300049162 Unclassified 720
282 Ga0501307_036366 3300049162 Bacteria 702
283 Ga0501300_028704 3300049523 Bacteria 819
284 Ga0501311_018342 3300049527 Bacteria 929
285 Ga0501311_022171 3300049527 Bacteria 871
286 Ga0501311_042116 3300049527 Unclassified 695
287 Ga0501311_047387 3300049527 Bacteria 666
288 Ga0501311_073051 3300049527 Bacteria 572
289 Ga0501312_001574 3300049528 Bacteria 2277
290 Ga0501312_001811 3300049528 Bacteria 2194
291 Ga0501312_010172 3300049528 Bacteria 1254
292 Ga0501312_011487 3300049528 Unclassified 1204
293 Ga0501312_012187 3300049528 Bacteria 1180
294 Ga0501312_023380 3300049528 Bacteria 931
295 Ga0501312_024838 3300049528 Bacteria 910
296 Ga0501312_027231 3300049528 Bacteria 880
297 Ga0501312_031808 3300049528 Bacteria 831
298 Ga0501312_036750 3300049528 Unclassified 787
299 Ga0501312_039430 3300049528 Bacteria 767
300 Ga0501312_057848 3300049528 Bacteria 666
301 Ga0501313_000962 3300049529 Bacteria 2282
302 Ga0501313_004709 3300049529 Bacteria 1414
303 Ga0501313_013578 3300049529 Bacteria 958
304 Ga0501313_014344 3300049529 Bacteria 937
305 Ga0501313_038402 3300049529 Bacteria 638
306 Ga0501313_049537 3300049529 Bacteria 578
307 Ga0501313_054822 3300049529 Bacteria 557
308 Ga0501314_039342 3300049530 Unclassified 548
309 Ga0501315_001052 3300049531 Bacteria 2214
310 Ga0501315_003624 3300049531 Bacteria 1557
311 Ga0501315_019234 3300049531 Bacteria 907
312 Ga0501315_021075 3300049531 Bacteria 880
313 Ga0501315_031193 3300049531 Bacteria 769
314 Ga0501315_035941 3300049531 Bacteria 733
315 Ga0501315_048513 3300049531 Bacteria 661
316 Ga0501315_099107 3300049531 Unclassified 513
317 Ga0501315_101434 3300049531 Bacteria 509
318 Ga0501316_000510 3300049532 Bacteria 2722
319 Ga0501316_001063 3300049532 Bacteria 2214
320 Ga0501316_013241 3300049532 Bacteria 973
321 Ga0501316_018506 3300049532 Bacteria 862
322 Ga0501316_029792 3300049532 Bacteria 726
323 Ga0501316_052497 3300049532 Bacteria 590
324 Ga0501317_001012 3300049533 Bacteria 2282
325 Ga0501317_001377 3300049533 Bacteria 2090
326 Ga0501317_014410 3300049533 Bacteria 1001
327 Ga0501317_063841 3300049533 Bacteria 609
328 Ga0501318_082252 3300049534 Bacteria 523
329 Ga0501319_006755 3300049535 Bacteria 855
330 Ga0501319_026844 3300049535 Bacteria 540
331 Ga0501320_011767 3300049536 Bacteria 911
332 Ga0501320_021938 3300049536 Bacteria 745
333 Ga0501320_029226 3300049536 Bacteria 679
334 Ga0501321_025141 3300049537 Bacteria 766
335 Ga0501321_083111 3300049537 Bacteria 513
336 Ga0501322_002247 3300049538 Bacteria 1171
337 Ga0501323_001214 3300049539 Bacteria 2216
338 Ga0501323_001344 3300049539 Bacteria 2153
339 Ga0501323_024646 3300049539 Bacteria 815
340 Ga0501325_015618 3300049541 Bacteria 751
341 Ga0501073_0572109 3300049589 Unclassified 780
342 Ga0501202_007720 3300049652 Bacteria 1949
343 Ga0501217_019788 3300049661 Bacteria 1575
344 Ga0501217_258055 3300049661 Bacteria 564
345 Ga0501222_007248 3300049662 Bacteria 1481
346 Ga0501222_016654 3300049662 Bacteria 973
347 Ga0501227_150816 3300049665 Unclassified 642
348 Ga0501233_263148 3300049668 Bacteria 522
349 Ga0501236_000758 3300049670 Bacteria 3614
350 Ga0501238_002886 3300049671 Bacteria 2089
351 Ga0501257_003554 3300049686 Bacteria 3354
352 Ga0501257_006334 3300049686 Bacteria 2626
353 Ga0501257_010822 3300049686 Bacteria 2075
354 Ga0501257_034459 3300049686 Bacteria 1229
355 Ga0501257_160109 3300049686 Unclassified 626
356 Ga0501259_006914 3300049688 Bacteria 1810
357 Ga0501261_065136 3300049690 Bacteria 628
358 Ga0501225_0063875 3300049705 Bacteria 1039
359 Ga0501245_051298 3300049708 Bacteria 732
360 Ga0501264_000532 3300049761 Bacteria 5587
361 Ga0501268_090266 3300049765 Unclassified 644
362 Ga0501271_008888 3300049768 Bacteria 1038
363 nmdc:mga0k408_109494_c1 3300050493 Bacteria 1632
364 nmdc:mga0k408_111057_c1 3300050493 Bacteria 1620
365 nmdc:mga0k408_243871_c1 3300050493 Bacteria 1073
366 nmdc:mga0k408_296364_c1 3300050493 Bacteria 965
367 nmdc:mga0k408_466446_c1 3300050493 Bacteria 749
368 nmdc:mga09592_378445_c1 3300050508 Unclassified 1224
369 nmdc:mga0qj67_876568_c1 3300050509 Bacteria 708
370 nmdc:mga06r32_1385550_c1 3300050510 Unclassified 645
371 nmdc:mga08y16_10401_c1 3300050511 Bacteria 9761
372 nmdc:mga08y16_342131_c1 3300050511 Bacteria 1538
373 Ga0500644_0037696 3300053088 Bacteria 1582
374 Ga0500646_0346644 3300053090 Bacteria 541
375 Ga0500556_0011703 3300053104 Bacteria 2603
376 Ga0500557_129904 3300053105 Bacteria 834
377 Ga0500562_046999 3300053108 Bacteria 1151
378 Ga0500642_0154246 3300053130 Bacteria 1078
379 Ga0500652_076474 3300053131 Bacteria 1392
380 Ga0500655_013596 3300053133 Bacteria 1486
381 Ga0500568_0292181 3300053139 Bacteria 592
382 Ga0500604_0040359 3300053151 Bacteria 1407
383 Ga0500616_0000013 3300053153 Bacteria 674172
384 Ga0500622_0000113 3300053156 Bacteria 83196
385 Ga0500622_0000133 3300053156 Bacteria 78532
386 Ga0500622_0007455 3300053156 Bacteria 6212
387 Ga0500627_0157166 3300053158 Bacteria 1026
388 Ga0590075_147093 3300059424 Unclassified 620
389 Ga0587084_094416 3300059477 Bacteria 598
390 Ga0587106_069016 3300059605 Bacteria 666
391 Ga0587125_017999 3300059607 Bacteria 808
392 Ga0587115_007130 3300059626 Bacteria 1311
393 Ga0587068_006340 3300059641 Bacteria 1653
394 Ga0587068_006852 3300059641 Bacteria 1608
395 Ga0587069_022084 3300059642 Bacteria 964
396 Ga0587076_007530 3300059645 Bacteria 1490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0058940 Ga0453684_0058940_187_489 75
2 3300028573 Ga0265334_10059688 Ga0265334_100596883 80
3 3300049536 Ga0501320_011767 Ga0501320_011767_31_273 80
4 3300041492 Ga0451835_0046527 Ga0451835_0046527_466_732 88
5 3300049128 Ga0501308_015749 Ga0501308_015749_621_887 88
6 3300049161 Ga0501305_061401 Ga0501305_061401_21_287 88
7 3300049527 Ga0501311_073051 Ga0501311_073051_294_560 88
8 3300049531 Ga0501315_101434 Ga0501315_101434_16_282 88
9 3300049537 Ga0501321_083111 Ga0501321_083111_11_277 88
10 3300005364 Ga0070673_101043047 Ga0070673_1010430472 93
11 3300044712 Ga0453684_0005528 Ga0453684_0005528_2009_2308 93
12 3300004798 Ga0058859_11807771 Ga0058859_118077714 94
13 3300005444 Ga0070694_100716938 Ga0070694_1007169382 94
14 3300028654 Ga0265322_10037791 Ga0265322_100377912 94
15 3300028666 Ga0265336_10095884 Ga0265336_100958842 94
16 3300031240 Ga0265320_10166534 Ga0265320_101665342 94
17 3300031251 Ga0265327_10012244 Ga0265327_1001224411 94
18 3300031665 Ga0316575_10005259 Ga0316575_100052592 94
19 3300031665 Ga0316575_10188196 Ga0316575_101881962 94
20 3300031691 Ga0316579_10034892 Ga0316579_100348923 94
21 3300031691 Ga0316579_10181577 Ga0316579_101815772 94
22 3300031727 Ga0316576_10305712 Ga0316576_103057122 94
23 3300031728 Ga0316578_10165582 Ga0316578_101655822 94
24 3300031728 Ga0316578_10401279 Ga0316578_104012792 94
25 3300031733 Ga0316577_10000831 Ga0316577_1000083124 94
26 3300031733 Ga0316577_10012140 Ga0316577_100121405 94
27 3300031733 Ga0316577_10162713 Ga0316577_101627132 94
28 3300032137 Ga0316585_10037098 Ga0316585_100370982 94
29 3300032139 Ga0316580_10078224 Ga0316580_100782242 94
30 3300032168 Ga0316593_10000074 Ga0316593_100000745 94
31 3300032168 Ga0316593_10000617 Ga0316593_100006172 94
32 3300032168 Ga0316593_10002633 Ga0316593_100026335 94
33 3300032168 Ga0316593_10015000 Ga0316593_100150002 94
34 3300032168 Ga0316593_10020329 Ga0316593_100203292 94
35 3300032168 Ga0316593_10068358 Ga0316593_100683582 94
36 3300033524 Ga0316592_1005919 Ga0316592_10059192 94
37 3300033524 Ga0316592_1037481 Ga0316592_10374812 94
38 3300033524 Ga0316592_1073354 Ga0316592_10733541 94
39 3300033541 Ga0316596_1000338 Ga0316596_10003384 94
40 3300033541 Ga0316596_1003031 Ga0316596_10030313 94
41 3300033541 Ga0316596_1012263 Ga0316596_10122632 94
42 3300035398 Ga0316574_0000443 Ga0316574_0000443_11319_11621 94
43 3300035398 Ga0316574_0008742 Ga0316574_0008742_2427_2729 94
44 3300036647 Ga0316582_0100082 Ga0316582_0100082_87_389 94
45 3300036647 Ga0316582_0211386 Ga0316582_0211386_330_632 94
46 3300036712 Ga0316584_0001621 Ga0316584_0001621_1938_2240 94
47 3300036712 Ga0316584_0021133 Ga0316584_0021133_3081_3383 94
48 3300036712 Ga0316584_0025525 Ga0316584_0025525_2149_2451 94
49 3300036712 Ga0316584_0071021 Ga0316584_0071021_877_1179 94
50 3300036712 Ga0316584_0086663 Ga0316584_0086663_1581_1883 94
51 3300037588 Ga0316581_0005413 Ga0316581_0005413_1107_1409 94
52 3300037588 Ga0316581_0272147 Ga0316581_0272147_127_429 94
53 3300038725 Ga0400484_31877 Ga0400484_31877_467_769 94
54 3300038726 Ga0400490_32638 Ga0400490_32638_372_674 94
55 3300039110 Ga0400487_25297 Ga0400487_25297_593_895 94
56 3300042876 Ga0451577_0011704 Ga0451577_0011704_547_849 94
57 3300044673 Ga0453683_0010659 Ga0453683_0010659_1346_1648 94
58 3300044673 Ga0453683_0031233 Ga0453683_0031233_811_1113 94
59 3300044673 Ga0453683_0283448 Ga0453683_0283448_347_649 94
60 3300044712 Ga0453684_0000055 Ga0453684_0000055_529753_530055 94
61 3300044712 Ga0453684_0000171 Ga0453684_0000171_2056_2358 94
62 3300044712 Ga0453684_0100042 Ga0453684_0100042_3195_3497 94
63 3300044712 Ga0453684_0147594 Ga0453684_0147594_1975_2277 94
64 3300044712 Ga0453684_0199678 Ga0453684_0199678_1447_1752 94
65 3300044712 Ga0453684_0246746 Ga0453684_0246746_855_1157 94
66 3300044712 Ga0453684_1086041 Ga0453684_1086041_48_350 94
67 3300044712 Ga0453684_1536448 Ga0453684_1536448_333_635 94
68 3300044712 Ga0453684_1828506 Ga0453684_1828506_125_427 94
69 3300045051 Ga0451576_0000454 Ga0451576_0000454_90153_90455 94
70 3300045051 Ga0451576_0019853 Ga0451576_0019853_4993_5295 94
71 3300049129 Ga0501309_086870 Ga0501309_086870_134_418 94
72 3300049589 Ga0501073_0572109 Ga0501073_0572109_231_533 94
73 3300003316 rootH1_10010612 rootH1_1001061213 95
74 3300003320 rootH2_10003970 rootH2_1000397024 95
75 3300003320 rootH2_10294855 rootH2_102948551 95
76 3300003322 rootL2_10010167 rootL2_1001016725 95
77 3300003322 rootL2_10011247 rootL2_100112475 95
78 3300003322 rootL2_10069174 rootL2_100691742 95
79 3300003323 rootH1_10012094 rootH1_1001209420 95
80 3300003323 rootH1_10096008 rootH1_100960082 95
81 3300003323 rootH1_10108515 rootH1_101085152 95
82 3300003323 rootH1_10109910 rootH1_101099103 95
83 3300003323 rootH1_10189698 rootH1_101896982 95
84 3300003544 Ga0007417J51691_1063811 Ga0007417J51691_10638113 95
85 3300003544 Ga0007417J51691_1119812 Ga0007417J51691_11198122 95
86 3300003574 Ga0007410J51695_1190805 Ga0007410J51695_11908051 95
87 3300003794 Ga0055531_10000409 Ga0055531_1000040913 95
88 3300004785 Ga0058858_1304125 Ga0058858_13041252 95
89 3300004798 Ga0058859_11772199 Ga0058859_117721992 95
90 3300004798 Ga0058859_11782699 Ga0058859_117826994 95
91 3300004800 Ga0058861_10639398 Ga0058861_106393982 95
92 3300004801 Ga0058860_12155377 Ga0058860_121553772 95
93 3300005262 Ga0065165_1000831 Ga0065165_100083148 95
94 3300005331 Ga0070670_101446776 Ga0070670_1014467762 95
95 3300005334 Ga0068869_101636620 Ga0068869_1016366201 95
96 3300005337 Ga0070682_100379340 Ga0070682_1003793402 95
97 3300005355 Ga0070671_100694505 Ga0070671_1006945052 95
98 3300005356 Ga0070674_100196180 Ga0070674_1001961803 95
99 3300005455 Ga0070663_100772965 Ga0070663_1007729652 95
100 3300005467 Ga0070706_101671029 Ga0070706_1016710292 95
101 3300005468 Ga0070707_100864849 Ga0070707_1008648491 95
102 3300005548 Ga0070665_101545894 Ga0070665_1015458942 95
103 3300005563 Ga0068855_100289382 Ga0068855_1002893823 95
104 3300005563 Ga0068855_100819560 Ga0068855_1008195602 95
105 3300005616 Ga0068852_100481522 Ga0068852_1004815222 95
106 3300005617 Ga0068859_102024150 Ga0068859_1020241502 95
107 3300005618 Ga0068864_100623000 Ga0068864_1006230002 95
108 3300005841 Ga0068863_100436656 Ga0068863_1004366562 95
109 3300005841 Ga0068863_101462392 Ga0068863_1014623922 95
110 3300006173 Ga0070716_100039818 Ga0070716_1000398184 95
111 3300006195 Ga0075366_10113400 Ga0075366_101134002 95
112 3300006195 Ga0075366_10117598 Ga0075366_101175982 95
113 3300006195 Ga0075366_10214393 Ga0075366_102143932 95
114 3300006195 Ga0075366_10254670 Ga0075366_102546702 95
115 3300006237 Ga0097621_100552590 Ga0097621_1005525902 95
116 3300006358 Ga0068871_100804088 Ga0068871_1008040881 95
117 3300006358 Ga0068871_101346776 Ga0068871_1013467762 95
118 3300006844 Ga0075428_100013576 Ga0075428_1000135763 95
119 3300006844 Ga0075428_100182361 Ga0075428_1001823614 95
120 3300006844 Ga0075428_101838215 Ga0075428_1018382151 95
121 3300006846 Ga0075430_100076161 Ga0075430_1000761611 95
122 3300006846 Ga0075430_100947121 Ga0075430_1009471212 95
123 3300006847 Ga0075431_100328003 Ga0075431_1003280031 95
124 3300006880 Ga0075429_100406578 Ga0075429_1004065782 95
125 3300006931 Ga0097620_102023253 Ga0097620_1020232532 95
126 3300007788 Ga0099795_10227244 Ga0099795_102272442 95
127 3300009093 Ga0105240_11213135 Ga0105240_112131352 95
128 3300009094 Ga0111539_10013971 Ga0111539_100139719 95
129 3300009094 Ga0111539_10015243 Ga0111539_1001524311 95
130 3300009094 Ga0111539_11044356 Ga0111539_110443562 95
131 3300009098 Ga0105245_12950596 Ga0105245_129505962 95
132 3300009147 Ga0114129_10992865 Ga0114129_109928651 95
133 3300009176 Ga0105242_11828151 Ga0105242_118281512 95
134 3300009545 Ga0105237_11943133 Ga0105237_119431332 95
135 3300010375 Ga0105239_12832649 Ga0105239_128326492 95
136 3300013104 Ga0157370_11835706 Ga0157370_118357062 95
137 3300013296 Ga0157374_11836875 Ga0157374_118368752 95
138 3300014326 Ga0157380_10006042 Ga0157380_1000604210 95
139 3300014326 Ga0157380_10367721 Ga0157380_103677212 95
140 3300014326 Ga0157380_10371628 Ga0157380_103716282 95
141 3300025298 Ga0209050_1005534 Ga0209050_10055347 95
142 3300025304 Ga0209257_1000007 Ga0209257_1000007339 95
143 3300025304 Ga0209257_1024055 Ga0209257_10240554 95
144 3300025905 Ga0207685_10655897 Ga0207685_106558972 95
145 3300025917 Ga0207660_10540154 Ga0207660_105401542 95
146 3300025922 Ga0207646_10708493 Ga0207646_107084932 95
147 3300025925 Ga0207650_10997248 Ga0207650_109972482 95
148 3300025936 Ga0207670_11896455 Ga0207670_118964552 95
149 3300025937 Ga0207669_10789503 Ga0207669_107895032 95
150 3300025939 Ga0207665_10050775 Ga0207665_100507752 95
151 3300025942 Ga0207689_11395806 Ga0207689_113958061 95
152 3300025949 Ga0207667_10182531 Ga0207667_101825313 95
153 3300026041 Ga0207639_10470787 Ga0207639_104707871 95
154 3300026067 Ga0207678_10258902 Ga0207678_102589022 95
155 3300026088 Ga0207641_10450750 Ga0207641_104507503 95
156 3300026088 Ga0207641_11066808 Ga0207641_110668082 95
157 3300026118 Ga0207675_102008401 Ga0207675_1020084011 95
158 3300027876 Ga0209974_10056787 Ga0209974_100567872 95
159 3300027907 Ga0207428_10076578 Ga0207428_100765782 95
160 3300028379 Ga0268266_11739762 Ga0268266_117397622 95
161 3300028794 Ga0307515_10000009 Ga0307515_10000009359 95
162 3300028794 Ga0307515_10223509 Ga0307515_102235093 95
163 3300031251 Ga0265327_10177642 Ga0265327_101776422 95
164 3300031456 Ga0307513_10127710 Ga0307513_101277102 95
165 3300031456 Ga0307513_10345615 Ga0307513_103456152 95
166 3300031456 Ga0307513_10947434 Ga0307513_109474342 95
167 3300031507 Ga0307509_10007469 Ga0307509_1000746913 95
168 3300031507 Ga0307509_10244733 Ga0307509_102447332 95
169 3300031548 Ga0307408_100038382 Ga0307408_1000383825 95
170 3300031649 Ga0307514_10127372 Ga0307514_101273721 95
171 3300031730 Ga0307516_10090261 Ga0307516_100902615 95
172 3300031730 Ga0307516_10379585 Ga0307516_103795852 95
173 3300031731 Ga0307405_10182283 Ga0307405_101822833 95
174 3300031824 Ga0307413_10081698 Ga0307413_100816983 95
175 3300031824 Ga0307413_10272992 Ga0307413_102729922 95
176 3300031852 Ga0307410_11258732 Ga0307410_112587322 95
177 3300031901 Ga0307406_10310540 Ga0307406_103105402 95
178 3300031911 Ga0307412_10010885 Ga0307412_100108857 95
179 3300031911 Ga0307412_10276740 Ga0307412_102767402 95
180 3300031995 Ga0307409_100054022 Ga0307409_1000540225 95
181 3300032002 Ga0307416_100000249 Ga0307416_10000024929 95
182 3300032005 Ga0307411_10133368 Ga0307411_101333683 95
183 3300032005 Ga0307411_10717102 Ga0307411_107171021 95
184 3300032005 Ga0307411_11196779 Ga0307411_111967792 95
185 3300032005 Ga0307411_11782914 Ga0307411_117829142 95
186 3300032126 Ga0307415_100012733 Ga0307415_10001273311 95
187 3300032126 Ga0307415_100986883 Ga0307415_1009868832 95
188 3300033524 Ga0316592_1087897 Ga0316592_10878972 95
189 3300033541 Ga0316596_1006644 Ga0316596_10066442 95
190 3300035172 Ga0373955_0444201 Ga0373955_0444201_173_460 95
191 3300035691 Ga0373931_0139815 Ga0373931_0139815_682_969 95
192 3300035692 Ga0373935_1167536 Ga0373935_1167536_132_419 95
193 3300035695 Ga0373927_0006959 Ga0373927_0006959_5616_5903 95
194 3300035724 Ga0373933_0603477 Ga0373933_0603477_125_412 95
195 3300041405 Ga0439438_159150 Ga0439438_159150_186_473 95
196 3300041413 Ga0439465_0299975 Ga0439465_0299975_228_515 95
197 3300041444 Ga0451790_41984 Ga0451790_41984_301_588 95
198 3300041444 Ga0451790_43499 Ga0451790_43499_375_662 95
199 3300041446 Ga0451794_05299 Ga0451794_05299_535_822 95
200 3300041446 Ga0451794_18318 Ga0451794_18318_508_795 95
201 3300041446 Ga0451794_23749 Ga0451794_23749_177_464 95
202 3300041446 Ga0451794_48682 Ga0451794_48682_70_357 95
203 3300041446 Ga0451794_51005 Ga0451794_51005_473_760 95
204 3300041451 Ga0451791_0640383 Ga0451791_0640383_234_521 95
205 3300041451 Ga0451791_0860646 Ga0451791_0860646_167_454 95
206 3300041452 Ga0451793_0446357 Ga0451793_0446357_134_421 95
207 3300041453 Ga0451797_1160083 Ga0451797_1160083_87_374 95
208 3300041456 Ga0451795_1389476 Ga0451795_1389476_182_469 95
209 3300041459 Ga0451800_0013115 Ga0451800_0013115_107_394 95
210 3300041459 Ga0451800_0888815 Ga0451800_0888815_112_399 95
211 3300041459 Ga0451800_1586709 Ga0451800_1586709_171_458 95
212 3300041460 Ga0451802_1832385 Ga0451802_1832385_177_464 95
213 3300041461 Ga0451805_026295 Ga0451805_026295_322_609 95
214 3300041461 Ga0451805_091713 Ga0451805_091713_1351_1638 95
215 3300041461 Ga0451805_101343 Ga0451805_101343_219_506 95
216 3300041464 Ga0451808_16930 Ga0451808_16930_1349_1636 95
217 3300041464 Ga0451808_21573 Ga0451808_21573_179_466 95
218 3300041464 Ga0451808_30446 Ga0451808_30446_168_455 95
219 3300041486 Ga0451807_0764503 Ga0451807_0764503_173_460 95
220 3300041491 Ga0451833_0183465 Ga0451833_0183465_46_333 95
221 3300041494 Ga0451837_0864681 Ga0451837_0864681_197_484 95
222 3300041502 Ga0451846_59758 Ga0451846_59758_450_737 95
223 3300041503 Ga0451847_0041855 Ga0451847_0041855_36_323 95
224 3300041505 Ga0451849_0601886 Ga0451849_0601886_213_500 95
225 3300041507 Ga0451851_0696536 Ga0451851_0696536_264_551 95
226 3300041507 Ga0451851_1231407 Ga0451851_1231407_33_320 95
227 3300041512 Ga0451853_0035416 Ga0451853_0035416_138_425 95
228 3300041512 Ga0451853_0061073 Ga0451853_0061073_309_596 95
229 3300041512 Ga0451853_1755951 Ga0451853_1755951_125_412 95
230 3300041512 Ga0451853_1932283 Ga0451853_1932283_323_610 95
231 3300041907 Ga0452268_37534 Ga0452268_37534_249_536 95
232 3300041916 Ga0452271_55409 Ga0452271_55409_1356_1643 95
233 3300041916 Ga0452271_66790 Ga0452271_66790_319_606 95
234 3300042004 Ga0439445_0190247 Ga0439445_0190247_217_504 95
235 3300042532 Ga0450893_0012030 Ga0450893_0012030_736_1023 95
236 3300042532 Ga0450893_0080095 Ga0450893_0080095_171_458 95
237 3300044673 Ga0453683_0049521 Ga0453683_0049521_1735_2022 95
238 3300044673 Ga0453683_0713571 Ga0453683_0713571_57_344 95
239 3300044706 Ga0466964_0136930 Ga0466964_0136930_783_1070 95
240 3300044712 Ga0453684_0005611 Ga0453684_0005611_3703_3990 95
241 3300044712 Ga0453684_0422724 Ga0453684_0422724_772_1059 95
242 3300045051 Ga0451576_0010522 Ga0451576_0010522_4618_4905 95
243 3300045051 Ga0451576_0018019 Ga0451576_0018019_5139_5426 95
244 3300045051 Ga0451576_0051376 Ga0451576_0051376_1140_1427 95
245 3300045051 Ga0451576_0063555 Ga0451576_0063555_974_1261 95
246 3300045051 Ga0451576_0360124 Ga0451576_0360124_359_646 95
247 3300046454 Ga0495592_0240269 Ga0495592_0240269_173_460 95
248 3300046460 Ga0495638_0000040 Ga0495638_0000040_137776_138063 95
249 3300046519 Ga0495632_0118138 Ga0495632_0118138_632_919 95
250 3300046660 Ga0495625_0247105 Ga0495625_0247105_701_988 95
251 3300046810 Ga0495660_0172100 Ga0495660_0172100_193_480 95
252 3300047320 Ga0495672_0450723 Ga0495672_0450723_69_356 95
253 3300047322 Ga0495680_0805636 Ga0495680_0805636_130_417 95
254 3300049127 Ga0501306_000385 Ga0501306_000385_2298_2585 95
255 3300049127 Ga0501306_011488 Ga0501306_011488_469_756 95
256 3300049127 Ga0501306_037943 Ga0501306_037943_395_682 95
257 3300049128 Ga0501308_000775 Ga0501308_000775_1354_1641 95
258 3300049128 Ga0501308_008363 Ga0501308_008363_492_779 95
259 3300049128 Ga0501308_017193 Ga0501308_017193_74_361 95
260 3300049128 Ga0501308_033292 Ga0501308_033292_389_676 95
261 3300049128 Ga0501308_042040 Ga0501308_042040_87_374 95
262 3300049128 Ga0501308_073222 Ga0501308_073222_184_471 95
263 3300049129 Ga0501309_001746 Ga0501309_001746_608_895 95
264 3300049129 Ga0501309_004788 Ga0501309_004788_694_981 95
265 3300049129 Ga0501309_025351 Ga0501309_025351_56_343 95
266 3300049130 Ga0501310_001315 Ga0501310_001315_1311_1598 95
267 3300049130 Ga0501310_003146 Ga0501310_003146_680_967 95
268 3300049130 Ga0501310_014079 Ga0501310_014079_622_909 95
269 3300049130 Ga0501310_037272 Ga0501310_037272_123_410 95
270 3300049130 Ga0501310_050415 Ga0501310_050415_179_466 95
271 3300049130 Ga0501310_054871 Ga0501310_054871_47_334 95
272 3300049160 Ga0501304_000312 Ga0501304_000312_1354_1641 95
273 3300049161 Ga0501305_000824 Ga0501305_000824_378_665 95
274 3300049161 Ga0501305_002286 Ga0501305_002286_1325_1612 95
275 3300049161 Ga0501305_016933 Ga0501305_016933_450_737 95
276 3300049161 Ga0501305_018881 Ga0501305_018881_172_459 95
277 3300049161 Ga0501305_020281 Ga0501305_020281_396_683 95
278 3300049161 Ga0501305_022020 Ga0501305_022020_21_308 95
279 3300049161 Ga0501305_024446 Ga0501305_024446_32_319 95
280 3300049161 Ga0501305_034174 Ga0501305_034174_429_716 95
281 3300049161 Ga0501305_069494 Ga0501305_069494_216_503 95
282 3300049162 Ga0501307_000849 Ga0501307_000849_1354_1641 95
283 3300049162 Ga0501307_009133 Ga0501307_009133_435_722 95
284 3300049162 Ga0501307_014211 Ga0501307_014211_268_555 95
285 3300049162 Ga0501307_022400 Ga0501307_022400_466_753 95
286 3300049162 Ga0501307_033698 Ga0501307_033698_382_669 95
287 3300049162 Ga0501307_036366 Ga0501307_036366_52_339 95
288 3300049523 Ga0501300_028704 Ga0501300_028704_48_335 95
289 3300049527 Ga0501311_018342 Ga0501311_018342_522_809 95
290 3300049527 Ga0501311_022171 Ga0501311_022171_279_566 95
291 3300049527 Ga0501311_042116 Ga0501311_042116_331_618 95
292 3300049527 Ga0501311_047387 Ga0501311_047387_304_591 95
293 3300049528 Ga0501312_001574 Ga0501312_001574_1354_1641 95
294 3300049528 Ga0501312_001811 Ga0501312_001811_1320_1607 95
295 3300049528 Ga0501312_010172 Ga0501312_010172_576_863 95
296 3300049528 Ga0501312_011487 Ga0501312_011487_400_687 95
297 3300049528 Ga0501312_012187 Ga0501312_012187_486_773 95
298 3300049528 Ga0501312_023380 Ga0501312_023380_67_354 95
299 3300049528 Ga0501312_024838 Ga0501312_024838_257_544 95
300 3300049528 Ga0501312_027231 Ga0501312_027231_406_693 95
301 3300049528 Ga0501312_031808 Ga0501312_031808_424_711 95
302 3300049528 Ga0501312_036750 Ga0501312_036750_437_724 95
303 3300049528 Ga0501312_039430 Ga0501312_039430_46_333 95
304 3300049528 Ga0501312_057848 Ga0501312_057848_151_438 95
305 3300049529 Ga0501313_000962 Ga0501313_000962_1390_1677 95
306 3300049529 Ga0501313_004709 Ga0501313_004709_520_807 95
307 3300049529 Ga0501313_013578 Ga0501313_013578_280_567 95
308 3300049529 Ga0501313_014344 Ga0501313_014344_480_767 95
309 3300049529 Ga0501313_038402 Ga0501313_038402_182_469 95
310 3300049529 Ga0501313_049537 Ga0501313_049537_90_377 95
311 3300049529 Ga0501313_054822 Ga0501313_054822_231_518 95
312 3300049530 Ga0501314_039342 Ga0501314_039342_46_333 95
313 3300049531 Ga0501315_001052 Ga0501315_001052_608_895 95
314 3300049531 Ga0501315_003624 Ga0501315_003624_675_962 95
315 3300049531 Ga0501315_019234 Ga0501315_019234_500_787 95
316 3300049531 Ga0501315_021075 Ga0501315_021075_171_458 95
317 3300049531 Ga0501315_031193 Ga0501315_031193_79_366 95
318 3300049531 Ga0501315_035941 Ga0501315_035941_394_681 95
319 3300049531 Ga0501315_048513 Ga0501315_048513_275_562 95
320 3300049531 Ga0501315_099107 Ga0501315_099107_66_353 95
321 3300049532 Ga0501316_000510 Ga0501316_000510_1349_1636 95
322 3300049532 Ga0501316_001063 Ga0501316_001063_608_895 95
323 3300049532 Ga0501316_013241 Ga0501316_013241_310_597 95
324 3300049532 Ga0501316_018506 Ga0501316_018506_63_350 95
325 3300049532 Ga0501316_029792 Ga0501316_029792_372_659 95
326 3300049532 Ga0501316_052497 Ga0501316_052497_171_458 95
327 3300049533 Ga0501317_001012 Ga0501317_001012_1358_1645 95
328 3300049533 Ga0501317_001377 Ga0501317_001377_485_772 95
329 3300049533 Ga0501317_014410 Ga0501317_014410_429_716 95
330 3300049533 Ga0501317_063841 Ga0501317_063841_21_308 95
331 3300049534 Ga0501318_082252 Ga0501318_082252_94_381 95
332 3300049535 Ga0501319_006755 Ga0501319_006755_181_468 95
333 3300049535 Ga0501319_026844 Ga0501319_026844_121_408 95
334 3300049536 Ga0501320_021938 Ga0501320_021938_414_701 95
335 3300049536 Ga0501320_029226 Ga0501320_029226_123_410 95
336 3300049537 Ga0501321_025141 Ga0501321_025141_423_710 95
337 3300049538 Ga0501322_002247 Ga0501322_002247_505_792 95
338 3300049539 Ga0501323_001214 Ga0501323_001214_1324_1611 95
339 3300049539 Ga0501323_001344 Ga0501323_001344_1231_1518 95
340 3300049539 Ga0501323_024646 Ga0501323_024646_464_751 95
341 3300049541 Ga0501325_015618 Ga0501325_015618_43_330 95
342 3300049652 Ga0501202_007720 Ga0501202_007720_466_753 95
343 3300049661 Ga0501217_019788 Ga0501217_019788_51_338 95
344 3300049661 Ga0501217_258055 Ga0501217_258055_196_483 95
345 3300049662 Ga0501222_007248 Ga0501222_007248_477_764 95
346 3300049662 Ga0501222_016654 Ga0501222_016654_148_435 95
347 3300049665 Ga0501227_150816 Ga0501227_150816_118_405 95
348 3300049668 Ga0501233_263148 Ga0501233_263148_146_433 95
349 3300049670 Ga0501236_000758 Ga0501236_000758_159_446 95
350 3300049671 Ga0501238_002886 Ga0501238_002886_1266_1553 95
351 3300049686 Ga0501257_003554 Ga0501257_003554_1766_2053 95
352 3300049686 Ga0501257_006334 Ga0501257_006334_1855_2142 95
353 3300049686 Ga0501257_010822 Ga0501257_010822_778_1065 95
354 3300049686 Ga0501257_034459 Ga0501257_034459_761_1048 95
355 3300049686 Ga0501257_160109 Ga0501257_160109_294_581 95
356 3300049688 Ga0501259_006914 Ga0501259_006914_769_1056 95
357 3300049690 Ga0501261_065136 Ga0501261_065136_188_475 95
358 3300049705 Ga0501225_0063875 Ga0501225_0063875_192_479 95
359 3300049708 Ga0501245_051298 Ga0501245_051298_183_470 95
360 3300049761 Ga0501264_000532 Ga0501264_000532_3773_4060 95
361 3300049765 Ga0501268_090266 Ga0501268_090266_140_427 95
362 3300049768 Ga0501271_008888 Ga0501271_008888_323_610 95
363 3300050493 nmdc:mga0k408_109494_c1 nmdc:mga0k408_109494_c1_1049_1336 95
364 3300050493 nmdc:mga0k408_111057_c1 nmdc:mga0k408_111057_c1_434_721 95
365 3300050493 nmdc:mga0k408_243871_c1 nmdc:mga0k408_243871_c1_634_921 95
366 3300050493 nmdc:mga0k408_296364_c1 nmdc:mga0k408_296364_c1_86_373 95
367 3300050493 nmdc:mga0k408_466446_c1 nmdc:mga0k408_466446_c1_250_537 95
368 3300050508 nmdc:mga09592_378445_c1 nmdc:mga09592_378445_c1_705_992 95
369 3300050509 nmdc:mga0qj67_876568_c1 nmdc:mga0qj67_876568_c1_316_603 95
370 3300050510 nmdc:mga06r32_1385550_c1 nmdc:mga06r32_1385550_c1_58_345 95
371 3300050511 nmdc:mga08y16_10401_c1 nmdc:mga08y16_10401_c1_6603_6890 95
372 3300050511 nmdc:mga08y16_342131_c1 nmdc:mga08y16_342131_c1_256_543 95
373 3300053088 Ga0500644_0037696 Ga0500644_0037696_905_1192 95
374 3300053090 Ga0500646_0346644 Ga0500646_0346644_118_405 95
375 3300053104 Ga0500556_0011703 Ga0500556_0011703_845_1132 95
376 3300053105 Ga0500557_129904 Ga0500557_129904_37_324 95
377 3300053108 Ga0500562_046999 Ga0500562_046999_699_986 95
378 3300053130 Ga0500642_0154246 Ga0500642_0154246_38_325 95
379 3300053131 Ga0500652_076474 Ga0500652_076474_669_956 95
380 3300053133 Ga0500655_013596 Ga0500655_013596_779_1066 95
381 3300053139 Ga0500568_0292181 Ga0500568_0292181_238_525 95
382 3300053151 Ga0500604_0040359 Ga0500604_0040359_464_751 95
383 3300053153 Ga0500616_0000013 Ga0500616_0000013_174562_174849 95
384 3300053156 Ga0500622_0000113 Ga0500622_0000113_81986_82273 95
385 3300053156 Ga0500622_0000133 Ga0500622_0000133_76195_76482 95
386 3300053156 Ga0500622_0007455 Ga0500622_0007455_4970_5257 95
387 3300053158 Ga0500627_0157166 Ga0500627_0157166_463_750 95
388 3300059424 Ga0590075_147093 Ga0590075_147093_134_421 95
389 3300059477 Ga0587084_094416 Ga0587084_094416_251_538 95
390 3300059605 Ga0587106_069016 Ga0587106_069016_364_651 95
391 3300059607 Ga0587125_017999 Ga0587125_017999_151_438 95
392 3300059626 Ga0587115_007130 Ga0587115_007130_407_694 95
393 3300059641 Ga0587068_006340 Ga0587068_006340_445_732 95
394 3300059641 Ga0587068_006852 Ga0587068_006852_860_1147 95
395 3300059642 Ga0587069_022084 Ga0587069_022084_280_567 95
396 3300059645 Ga0587076_007530 Ga0587076_007530_813_1100 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

6

95

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9038 3 91
7nhm-assembly1.cif.gz_W 70s ribosome from staphylococcus aureus 0.896 3 92
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.8947 3 84
7jil-assembly1.cif.gz_T 70s ribosome flavobacterium johnsoniae 0.8933 3 91
6fu8-assembly1.cif.gz_C ul23 beta hairpin loop deletion of e.coli ribosome 0.8895 3 89
ID Description Score Start End Superfamily
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8895 3 89 3.30.70.330
5x8tU01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.867 3 88 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8494 3 89 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8429 3 91 3.30.70.330
af_D3ZFK7_36_158_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8409 3 88 3.30.70.330
ID Description Score Start End GO Terms
AF-A9B414-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9544 3 95 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A433WCS1-F1-model_v4 Large ribosomal subunit protein uL23 0.9538 3 95 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2W2AFG9-F1-model_v4 Large ribosomal subunit protein uL23 0.9508 3 93 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A4Q2ZJT4-F1-model_v4 deleted 0.9507 3 94
AF-A0A7Y5FJR9-F1-model_v4 Large ribosomal subunit protein uL23 0.9501 3 94 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
87.86 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map