F433444

General Info

Members Datasets Scaffolds Average Seq Length
396 252 792 257

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10110679|Ga0070681_101106791
Length 286
Sequence MPMRRLTWDHPRMNRITFAMAGLLLPGLTMAASIPVQGYTVVHAFPHDPKAYTEGLFYLDGYLYEATGTVGASSVRKVDLASGKVLQQSATPWPDYGEGIVAWKDRLVQLTWQDHEGFVYDLATLTPHAKFAYPGEGWSLTTDGTHLLMSDGTPTIRILDPDSLQQVGRIDVTADGKPLANLNELEWVQGELYANVWLTDRIARIDPASGRVIGWIDLAGLGPAPETLEDPANDVLNGIAYDAAHDRLFVTGKRWPRVYEIRLVPAHRDTAAGPAAAKAGSPPASR

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
83 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
130 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
154 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
155 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
191 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
211 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
219 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
226 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
227 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
228 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
229 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
234 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
235 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
236 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
237 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
238 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
239 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
240 2643221638 Duganella sp. Root336D2 Isolate Unclassified
241 2643221640 Caulobacter sp. Root342 Isolate Unclassified
242 2643221642 Caulobacter sp. Root343 Isolate Unclassified
243 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
244 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
245 2734482264 Dyella sp. AD052 Isolate Unclassified
246 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
247 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
248 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
249 2919404418 Luteibacter sp. 3190 Isolate Unclassified
250 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
251 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
252 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.95
Metatranscriptomes 0
Isolates 5.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.8
Nodule 0.51
Rhizoplane 2.78
Rhizosphere 54.55
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10110679 3300005458 Bacteria 2686
2 JGI24738J21930_10000218 3300002075 Bacteria 15528
3 JGI25156J39149_1005586 3300002705 Bacteria 3595
4 JGI25162J39368_1001784 3300002737 Bacteria 10199
5 JGI25162J39368_1006425 3300002737 Bacteria 2035
6 JGI25157J39369_1001283 3300002741 Bacteria 10098
7 JGI25157J39369_1002282 3300002741 Bacteria 5081
8 JGI25163J39215_1001844 3300002771 Bacteria 2813
9 JGI25164J39214_1000571 3300002772 Bacteria 16629
10 JGI25164J39214_1000878 3300002772 Bacteria 10199
11 JGI25150J39212_1000581 3300002774 Bacteria 14438
12 JGI25150J39212_1004366 3300002774 Bacteria 3155
13 JGI25159J45721_1000536 3300002987 Bacteria 17286
14 JGI25159J45721_1001543 3300002987 Bacteria 9433
15 JGI25159J45721_1005094 3300002987 Bacteria 4177
16 JGI25165J46597_1001141 3300003214 Bacteria 16629
17 JGI25165J46597_1001659 3300003214 Bacteria 10199
18 JGI25153J46596_10006703 3300003215 Bacteria 5788
19 rootL2_10052119 3300003322 Bacteria 1008
20 rootH1_10176962 3300003323 Bacteria 1513
21 JGI25160J50197_1001804 3300003354 Bacteria 10336
22 JGI25161J50226_1000545 3300003374 Bacteria 16078
23 JGI25161J50226_1000554 3300003374 Bacteria 15937
24 Ga0055525_1000004 3300003759 Bacteria 888039
25 Ga0055535_1001671 3300003761 Bacteria 10199
26 Ga0055542_1001621 3300003762 Bacteria 10199
27 Ga0055529_1001205 3300003763 Bacteria 10199
28 Ga0055526_1001198 3300003771 Bacteria 18704
29 Ga0055526_1003637 3300003771 Bacteria 9656
30 Ga0055526_1008545 3300003771 Bacteria 5083
31 Ga0055537_1000040 3300003773 Bacteria 92014
32 Ga0055537_1002331 3300003773 Bacteria 6460
33 Ga0055537_1020205 3300003773 Bacteria 1016
34 Ga0055524_1000022 3300003775 Bacteria 224103
35 Ga0055524_1000587 3300003775 Bacteria 26365
36 Ga0055524_1002230 3300003775 Bacteria 10152
37 Ga0055524_1003954 3300003775 Bacteria 7013
38 Ga0055536_1000678 3300003781 Bacteria 22920
39 Ga0055536_1000767 3300003781 Bacteria 21385
40 Ga0055534_1000396 3300003784 Bacteria 26966
41 Ga0055534_1001613 3300003784 Bacteria 8751
42 Ga0055528_1000181 3300003790 Bacteria 53479
43 Ga0055528_1005260 3300003790 Bacteria 6069
44 Ga0055530_10001297 3300003791 Bacteria 18865
45 Ga0055530_10002649 3300003791 Bacteria 11194
46 Ga0055530_10004384 3300003791 Bacteria 7301
47 Ga0055530_10009888 3300003791 Bacteria 3597
48 Ga0055530_10017995 3300003791 Bacteria 2194
49 Ga0055531_10001084 3300003794 Bacteria 21385
50 Ga0055531_10011115 3300003794 Bacteria 4387
51 Ga0055531_10027583 3300003794 Bacteria 1986
52 Ga0055543_1000692 3300004625 Bacteria 17340
53 Ga0065165_1000201 3300005262 Bacteria 103327
54 Ga0065165_1000321 3300005262 Bacteria 78264
55 Ga0065165_1009400 3300005262 Bacteria 4387
56 Ga0068868_100455813 3300005338 Unclassified 1113
57 Ga0070661_100064794 3300005344 Bacteria 2686
58 Ga0070669_100182427 3300005353 Bacteria 1643
59 Ga0070671_100004730 3300005355 Bacteria 10811
60 Ga0070667_100018764 3300005367 Bacteria 5736
61 Ga0070714_100048242 3300005435 Bacteria 3621
62 Ga0070708_100144039 3300005445 Bacteria 2212
63 Ga0070662_100432503 3300005457 Bacteria 1090
64 Ga0070662_100640515 3300005457 Bacteria 896
65 Ga0070707_100191145 3300005468 Bacteria 1996
66 Ga0070698_100056745 3300005471 Bacteria 3966
67 Ga0070679_100591190 3300005530 Bacteria 1053
68 Ga0070684_100323712 3300005535 Bacteria 1416
69 Ga0070697_100255492 3300005536 Bacteria 1499
70 Ga0070665_100016383 3300005548 Bacteria 7433
71 Ga0070665_100063418 3300005548 Bacteria 3705
72 Ga0068856_100096166 3300005614 Bacteria 2950
73 Ga0068856_100190065 3300005614 Bacteria 2067
74 Ga0070702_100224920 3300005615 Unclassified 1257
75 Ga0068863_100009616 3300005841 Bacteria 9429
76 Ga0068858_100002701 3300005842 Bacteria 17882
77 Ga0068862_100010772 3300005844 Bacteria 7549
78 Ga0068862_100314176 3300005844 Bacteria 1445
79 Ga0070717_10065154 3300006028 Bacteria 3028
80 Ga0075431_100123587 3300006847 Bacteria 2670
81 Ga0075434_100018566 3300006871 Bacteria 6720
82 Ga0068865_100445080 3300006881 Bacteria 1070
83 Ga0099826_10000006 3300006948 Bacteria 432260
84 Ga0075435_100000017 3300007076 Bacteria 99666
85 Ga0105250_10017037 3300009092 Unclassified 2954
86 Ga0105240_10004572 3300009093 Bacteria 20981
87 Ga0105240_10039934 3300009093 Bacteria 6006
88 Ga0105240_10064478 3300009093 Bacteria 4552
89 Ga0111539_10005216 3300009094 Bacteria 16826
90 Ga0105245_10023887 3300009098 Bacteria 5365
91 Ga0105247_10000248 3300009101 Bacteria 50108
92 Ga0105241_10202588 3300009174 Bacteria 1658
93 Ga0105242_10146814 3300009176 Bacteria 2052
94 Ga0105248_10018666 3300009177 Bacteria 7667
95 Ga0105248_10061659 3300009177 Bacteria 4211
96 Ga0105248_10373721 3300009177 Bacteria 1605
97 Ga0105237_10518760 3300009545 Unclassified 1198
98 Ga0105238_10113652 3300009551 Bacteria 2687
99 Ga0105238_10388326 3300009551 Bacteria 1388
100 Ga0105249_10029334 3300009553 Bacteria 4968
101 Ga0105249_10118921 3300009553 Bacteria 2509
102 Ga0099796_10021120 3300010159 Bacteria 2001
103 Ga0157370_10090187 3300013104 Bacteria 2879
104 Ga0157369_10470185 3300013105 Bacteria 1301
105 Ga0157378_10002118 3300013297 Bacteria 17654
106 Ga0163162_10045642 3300013306 Bacteria 4389
107 Ga0157372_10179529 3300013307 Bacteria 2450
108 Ga0163163_10026043 3300014325 Bacteria 5585
109 Ga0163163_10079919 3300014325 Bacteria 3269
110 Ga0182008_10000926 3300014497 Bacteria 20426
111 Ga0157379_10051360 3300014968 Unclassified 3683
112 Ga0157379_10080973 3300014968 Bacteria 2909
113 Ga0157379_10196895 3300014968 Bacteria 1821
114 Ga0182006_1000066 3300015261 Bacteria 151095
115 Ga0182006_1000188 3300015261 Bacteria 64237
116 Ga0182007_10045991 3300015262 Bacteria 1446
117 Ga0182005_1001641 3300015265 Bacteria 8699
118 Ga0182005_1010571 3300015265 Bacteria 2651
119 Ga0182005_1048102 3300015265 Bacteria 1159
120 Ga0182005_1071020 3300015265 Bacteria 956
121 Ga0183363_1010 3300015690 Bacteria 108191
122 Ga0163161_10529878 3300017792 Bacteria 963
123 Ga0213872_10002790 3300021361 Bacteria 9998
124 Ga0213876_10179286 3300021384 Bacteria 1127
125 Ga0209435_103648 3300025206 Bacteria 1748
126 Ga0209760_100584 3300025207 Bacteria 6404
127 Ga0209436_100123 3300025208 Bacteria 37941
128 Ga0209436_100307 3300025208 Bacteria 22491
129 Ga0209436_100548 3300025208 Bacteria 16269
130 Ga0209784_100094 3300025224 Bacteria 113434
131 Ga0209566_102564 3300025225 Bacteria 3263
132 Ga0209672_107084 3300025228 Bacteria 1760
133 Ga0209563_100013 3300025230 Bacteria 941463
134 Ga0207427_100100 3300025231 Bacteria 121264
135 Ga0207427_100194 3300025231 Bacteria 58375
136 Ga0209437_100059 3300025233 Bacteria 355048
137 Ga0209437_100121 3300025233 Bacteria 202531
138 Ga0209258_100034 3300025242 Bacteria 437372
139 Ga0209258_100584 3300025242 Bacteria 30530
140 Ga0207425_1000013 3300025245 Bacteria 497384
141 Ga0207425_1000371 3300025245 Bacteria 30946
142 Ga0209646_1001749 3300025246 Bacteria 5480
143 Ga0209646_1002605 3300025246 Bacteria 3889
144 Ga0209026_1001373 3300025250 Bacteria 10867
145 Ga0209148_1000001 3300025254 Bacteria 2545271
146 Ga0209759_1001936 3300025256 Bacteria 10080
147 Ga0209759_1005307 3300025256 Bacteria 4554
148 Ga0209129_1000102 3300025258 Bacteria 161712
149 Ga0209129_1004293 3300025258 Bacteria 5663
150 Ga0209233_1000002 3300025261 Bacteria 2501366
151 Ga0209233_1000112 3300025261 Bacteria 258251
152 Ga0209565_1000035 3300025263 Bacteria 298125
153 Ga0209565_1000881 3300025263 Bacteria 16505
154 Ga0209565_1003091 3300025263 Bacteria 5588
155 Ga0209565_1007104 3300025263 Bacteria 3057
156 Ga0209565_1013006 3300025263 Bacteria 1963
157 Ga0209455_1000054 3300025272 Bacteria 358936
158 Ga0209673_1000006 3300025273 Bacteria 650600
159 Ga0209673_1049331 3300025273 Bacteria 1126
160 Ga0209130_1000149 3300025284 Bacteria 108821
161 Ga0209130_1001115 3300025284 Bacteria 19753
162 Ga0209130_1002691 3300025284 Bacteria 8466
163 Ga0209675_1000005 3300025291 Bacteria 849192
164 Ga0209675_1000709 3300025291 Bacteria 22778
165 Ga0209675_1001028 3300025291 Bacteria 17414
166 Ga0209676_1000207 3300025292 Bacteria 130882
167 Ga0209676_1000233 3300025292 Bacteria 120247
168 Ga0209564_1000088 3300025295 Bacteria 250268
169 Ga0209564_1000902 3300025295 Bacteria 38919
170 Ga0209564_1004909 3300025295 Bacteria 7922
171 Ga0209758_1000031 3300025297 Bacteria 497252
172 Ga0209050_1000056 3300025298 Bacteria 338703
173 Ga0209050_1000430 3300025298 Bacteria 77008
174 Ga0209050_1000624 3300025298 Bacteria 55344
175 Ga0209050_1001488 3300025298 Bacteria 24908
176 Ga0209050_1005206 3300025298 Bacteria 8315
177 Ga0209256_1000035 3300025299 Bacteria 386754
178 Ga0209256_1000141 3300025299 Bacteria 152280
179 Ga0209256_1000560 3300025299 Bacteria 53201
180 Ga0209256_1003306 3300025299 Bacteria 11473
181 Ga0209256_1004338 3300025299 Bacteria 9006
182 Ga0209256_1005324 3300025299 Bacteria 7482
183 Ga0209256_1010201 3300025299 Bacteria 3972
184 Ga0207426_1007971 3300025302 Bacteria 4355
185 Ga0207426_1009541 3300025302 Bacteria 3830
186 Ga0209051_1003749 3300025303 Bacteria 9771
187 Ga0209051_1009925 3300025303 Bacteria 4858
188 Ga0209257_1000157 3300025304 Bacteria 181004
189 Ga0209257_1000265 3300025304 Bacteria 120247
190 Ga0209257_1008031 3300025304 Bacteria 6148
191 Ga0209257_1025972 3300025304 Bacteria 1987
192 Ga0207710_10000333 3300025900 Bacteria 35381
193 Ga0207710_10025590 3300025900 Bacteria 2547
194 Ga0207647_10039378 3300025904 Bacteria 2982
195 Ga0207699_10167168 3300025906 Bacteria 1469
196 Ga0207705_10017770 3300025909 Bacteria 5086
197 Ga0207695_10003231 3300025913 Bacteria 23190
198 Ga0207695_10049844 3300025913 Bacteria 4409
199 Ga0207695_10058513 3300025913 Bacteria 4000
200 Ga0207694_10210496 3300025924 Bacteria 1584
201 Ga0207659_10627681 3300025926 Bacteria 917
202 Ga0207664_10000102 3300025929 Bacteria 77855
203 Ga0207644_10019276 3300025931 Bacteria 4625
204 Ga0207690_10001850 3300025932 Bacteria 13005
205 Ga0207706_10018677 3300025933 Bacteria 6239
206 Ga0207711_10317473 3300025941 Bacteria 1439
207 Ga0207711_10335347 3300025941 Unclassified 1399
208 Ga0207667_10025499 3300025949 Bacteria 6469
209 Ga0207668_10008796 3300025972 Bacteria 6034
210 Ga0207668_10194596 3300025972 Bacteria 1610
211 Ga0207658_10002111 3300025986 Bacteria 14799
212 Ga0207703_10004984 3300026035 Bacteria 10776
213 Ga0207702_10074029 3300026078 Bacteria 2938
214 Ga0209282_1000003 3300027666 Bacteria 856377
215 Ga0265354_1000406 3300028016 Bacteria 7575
216 Ga0268266_10005072 3300028379 Bacteria 12422
217 Ga0268266_10012137 3300028379 Bacteria 7456
218 Ga0268265_10008772 3300028380 Bacteria 6832
219 Ga0268264_10164825 3300028381 Bacteria 2000
220 Ga0265338_10030476 3300028800 Bacteria 5313
221 Ga0307511_10000077 3300030521 Bacteria 82357
222 Ga0307511_10064112 3300030521 Bacteria 2767
223 Ga0265327_10001259 3300031251 Bacteria 33543
224 Ga0265316_10063684 3300031344 Bacteria 2858
225 Ga0307408_100001475 3300031548 Bacteria 17461
226 Ga0307408_100028124 3300031548 Bacteria 3882
227 Ga0307408_100036627 3300031548 Bacteria 3450
228 Ga0265342_10033005 3300031712 Bacteria 3187
229 Ga0307516_10003240 3300031730 Bacteria 21117
230 Ga0307412_10001033 3300031911 Bacteria 15898
231 Ga0307510_10000009 3300033180 Bacteria 409702
232 Ga0307510_10026241 3300033180 Bacteria 6702
233 Ga0373936_0001755 3300035113 Bacteria 7956
234 Ga0373936_0035093 3300035113 Unclassified 1996
235 Ga0395900_0046285 3300037418 Bacteria 4480
236 Ga0395905_0205113 3300037471 Bacteria 1848
237 Ga0436364_1244178 3300037853 Bacteria 1586
238 Ga0395901_0000413 3300038443 Bacteria 50350
239 Ga0395901_0068071 3300038443 Bacteria 3709
240 Ga0395901_0099093 3300038443 Bacteria 3056
241 Ga0395901_0112009 3300038443 Bacteria 2866
242 Ga0436365_0365417 3300039437 Bacteria 1545
243 Ga0436365_1284784 3300039437 Bacteria 2323
244 Ga0436361_0505866 3300039447 Bacteria 12664
245 Ga0439436_0000004 3300041404 Bacteria 175137
246 Ga0439465_0001164 3300041413 Bacteria 8448
247 Ga0451793_1539854 3300041452 Bacteria 2342
248 Ga0439445_0013144 3300042004 Bacteria 2001
249 Ga0450908_000029 3300042184 Bacteria 32225
250 Ga0439459_0008636 3300042438 Bacteria 1746
251 Ga0451577_0005793 3300042876 Bacteria 12520
252 Ga0466966_0095183 3300044684 Bacteria 1845
253 Ga0466961_0150741 3300044693 Bacteria 1452
254 Ga0466968_0007387 3300044735 Bacteria 4177
255 Ga0466959_0000553 3300045049 Bacteria 21758
256 Ga0466959_0077927 3300045049 Bacteria 2391
257 Ga0466967_0068620 3300045976 Bacteria 3167
258 Ga0495617_000024 3300046452 Bacteria 174402
259 Ga0495638_0000060 3300046460 Bacteria 190580
260 Ga0495638_0080614 3300046460 Bacteria 1977
261 Ga0495638_0170450 3300046460 Bacteria 1249
262 Ga0495638_0250549 3300046460 Bacteria 976
263 Ga0495650_0026259 3300046471 Bacteria 2712
264 Ga0495584_0001718 3300046491 Bacteria 12800
265 Ga0495584_0023792 3300046491 Bacteria 3105
266 Ga0495585_0000143 3300046492 Bacteria 78365
267 Ga0495585_0000360 3300046492 Bacteria 44156
268 Ga0495607_0012186 3300046501 Bacteria 5684
269 Ga0495583_0007933 3300046506 Bacteria 6573
270 Ga0495606_0000136 3300046507 Bacteria 125611
271 Ga0495606_0001286 3300046507 Bacteria 34779
272 Ga0495606_0126732 3300046507 Bacteria 1522
273 Ga0495606_0166288 3300046507 Bacteria 1283
274 Ga0495610_0000542 3300046512 Bacteria 37767
275 Ga0495616_0000003 3300046513 Bacteria 290178
276 Ga0495616_0004267 3300046513 Bacteria 9035
277 Ga0495620_0000102 3300046515 Bacteria 68028
278 Ga0495631_0000022 3300046518 Bacteria 91377
279 Ga0495632_0000020 3300046519 Bacteria 210606
280 Ga0495632_0033031 3300046519 Bacteria 2660
281 Ga0495632_0149379 3300046519 Unclassified 1081
282 Ga0495648_0000184 3300046524 Bacteria 72048
283 Ga0495648_0001155 3300046524 Bacteria 26690
284 Ga0495642_0017187 3300046528 Bacteria 2825
285 Ga0495609_0000173 3300046538 Bacteria 66125
286 Ga0495597_0017014 3300046542 Bacteria 3428
287 Ga0495597_0105909 3300046542 Bacteria 1182
288 Ga0495633_0217859 3300046558 Bacteria 874
289 Ga0495668_0000458 3300046616 Bacteria 52227
290 Ga0495668_0000511 3300046616 Bacteria 48358
291 Ga0495668_0007758 3300046616 Bacteria 6809
292 Ga0495668_0100119 3300046616 Bacteria 1585
293 Ga0495625_0000578 3300046660 Bacteria 53326
294 Ga0495625_0027414 3300046660 Bacteria 4289
295 Ga0495659_0002366 3300046664 Bacteria 6089
296 Ga0495659_0004798 3300046664 Bacteria 4255
297 Ga0495661_0002830 3300046665 Bacteria 13138
298 Ga0495661_0082212 3300046665 Bacteria 1854
299 Ga0495669_0000485 3300046684 Bacteria 18399
300 Ga0495670_0001364 3300046691 Bacteria 11929
301 Ga0495649_0011172 3300046694 Bacteria 5280
302 Ga0495649_0059228 3300046694 Bacteria 2062
303 Ga0495660_0000052 3300046810 Bacteria 137821
304 Ga0495683_0000699 3300047323 Bacteria 24522
305 Ga0495677_0068125 3300047445 Bacteria 1324
306 Ga0495679_016244 3300047446 Bacteria 2697
307 Ga0495685_000552 3300047447 Bacteria 11584
308 Ga0495673_0000036 3300047469 Bacteria 311035
309 Ga0495681_0005927 3300047470 Bacteria 8107
310 Ga0495681_0077950 3300047470 Bacteria 1486
311 Ga0495684_0136731 3300047471 Bacteria 1839
312 Ga0495686_0000180 3300047472 Bacteria 121204
313 Ga0495686_0007095 3300047472 Bacteria 8445
314 Ga0495686_0034773 3300047472 Bacteria 3242
315 Ga0495686_0144822 3300047472 Bacteria 1399
316 Ga0496100_0661585 3300048903 Bacteria 814
317 Ga0496102_0003223 3300048905 Bacteria 13847
318 Ga0496102_0095069 3300048905 Bacteria 2762
319 Ga0496103_0145258 3300048906 Bacteria 1518
320 Ga0496106_0000904 3300048909 Bacteria 21668
321 Ga0496108_0074215 3300048911 Bacteria 2872
322 Ga0496112_0071282 3300048915 Bacteria 3435
323 Ga0496112_0198504 3300048915 Bacteria 1966
324 Ga0496115_0303533 3300048918 Bacteria 1308
325 Ga0496115_0454646 3300048918 Bacteria 1034
326 Ga0496117_0000151 3300048920 Bacteria 148304
327 Ga0496118_0000105 3300048921 Bacteria 156739
328 Ga0496118_0160672 3300048921 Bacteria 1390
329 Ga0496119_0002419 3300048922 Bacteria 20492
330 Ga0496119_0003839 3300048922 Bacteria 15350
331 Ga0496119_0027477 3300048922 Bacteria 3909
332 Ga0496120_0001210 3300048923 Bacteria 32605
333 Ga0496121_0000782 3300048924 Bacteria 58365
334 Ga0496121_0001227 3300048924 Bacteria 44616
335 Ga0496121_0003041 3300048924 Bacteria 24337
336 Ga0496121_0036714 3300048924 Bacteria 4362
337 Ga0496121_0070452 3300048924 Bacteria 2816
338 Ga0496124_0056351 3300048927 Bacteria 3315
339 Ga0496124_0170273 3300048927 Bacteria 1688
340 Ga0496125_0018647 3300048928 Bacteria 6584
341 Ga0496125_0019132 3300048928 Bacteria 6473
342 Ga0495678_000400 3300049459 Bacteria 43762
343 Ga0495682_0002506 3300049460 Bacteria 8684
344 Ga0501032_0076039 3300049569 Bacteria 2236
345 Ga0501034_0095430 3300049571 Bacteria 2971
346 Ga0501034_0154755 3300049571 Bacteria 2267
347 Ga0501038_0114734 3300049574 Bacteria 2227
348 Ga0501043_0146403 3300049579 Bacteria 1849
349 Ga0501043_0532676 3300049579 Bacteria 874
350 Ga0501046_0012790 3300049580 Bacteria 7139
351 Ga0501046_0186079 3300049580 Bacteria 1551
352 Ga0501047_0036131 3300049581 Bacteria 4773
353 Ga0501047_0308415 3300049581 Bacteria 1424
354 Ga0501263_003419 3300049760 Bacteria 1694
355 Ga0501279_002123 3300049775 Bacteria 2618
356 Ga0501279_013208 3300049775 Bacteria 1129
357 Ga0501035_0003253 3300049822 Bacteria 15565
358 Ga0501035_0386526 3300049822 Bacteria 1166
359 Ga0501035_0484364 3300049822 Bacteria 1020
360 nmdc:mga06r32_113336_c1 3300050510 Bacteria 2669
361 nmdc:mga0n895_295374_c1 3300050512 Bacteria 1643
362 nmdc:mga0n895_37_c1 3300050512 Bacteria 77167
363 nmdc:mga0n895_721935_c1 3300050512 Bacteria 991
364 nmdc:mga0rr50_14_c1 3300050513 Bacteria 196574
365 nmdc:mga0rr50_89874_c1 3300050513 Bacteria 2389
366 nmdc:mga08x19_63156_c1 3300050514 Bacteria 2403
367 nmdc:mga08x19_925_c1 3300050514 Bacteria 18506
368 Ga0500644_0000116 3300053088 Bacteria 49989
369 Ga0500572_000257 3300053111 Bacteria 19086
370 Ga0500594_0000016 3300053118 Bacteria 64151
371 Ga0500608_000063 3300053122 Bacteria 46532
372 Ga0500617_075677 3300053124 Bacteria 1467
373 Ga0500559_0002976 3300053136 Bacteria 8513
374 Ga0500622_0003151 3300053156 Bacteria 11293
375 Ga0500622_0037253 3300053156 Bacteria 2541
376 Ga0500645_001886 3300053730 Bacteria 10017
377 2538833390 2537561836 Bacteria 3910579
378 2585147450 2582581279 Bacteria 4980720
379 2587918207 2585428106 Bacteria 5179711
380 2595450707 2593339239 Bacteria 4124669
381 2643789952 2643221554 Bacteria 6603920
382 2643831878 2643221562 Bacteria 4048635
383 2643896613 2643221577 Bacteria 3710843
384 2644214320 2643221638 Bacteria 6579467
385 2644224683 2643221640 Bacteria 5258820
386 2644234382 2643221642 Bacteria 5357871
387 2644478636 2643221685 Bacteria 3673288
388 2721028902 2718218334 Bacteria 4765486
389 2735835511 2734482264 Unclassified 5014763
390 2842921064 2842918807 Bacteria 4289178
391 2857508178 2857504554 Bacteria 5369913
392 2884962159 2884960567 Bacteria 5437054
393 2919407143 2919404418 Bacteria 4232372
394 2928535816 2928531327 Bacteria 5101314
395 2939613895 2939611941 Bacteria 3892017
396 2953996338 2953994433 Bacteria 4303959
397 Ga0070681_10110679
398 JGI24738J21930_10000218
399 JGI25156J39149_1005586
400 JGI25162J39368_1001784
401 JGI25162J39368_1006425
402 JGI25157J39369_1001283
403 JGI25157J39369_1002282
404 JGI25163J39215_1001844
405 JGI25164J39214_1000571
406 JGI25164J39214_1000878
407 JGI25150J39212_1000581
408 JGI25150J39212_1004366
409 JGI25159J45721_1000536
410 JGI25159J45721_1001543
411 JGI25159J45721_1005094
412 JGI25165J46597_1001141
413 JGI25165J46597_1001659
414 JGI25153J46596_10006703
415 rootL2_10052119
416 rootH1_10176962
417 JGI25160J50197_1001804
418 JGI25161J50226_1000545
419 JGI25161J50226_1000554
420 Ga0055525_1000004
421 Ga0055535_1001671
422 Ga0055542_1001621
423 Ga0055529_1001205
424 Ga0055526_1001198
425 Ga0055526_1003637
426 Ga0055526_1008545
427 Ga0055537_1000040
428 Ga0055537_1002331
429 Ga0055537_1020205
430 Ga0055524_1000022
431 Ga0055524_1000587
432 Ga0055524_1002230
433 Ga0055524_1003954
434 Ga0055536_1000678
435 Ga0055536_1000767
436 Ga0055534_1000396
437 Ga0055534_1001613
438 Ga0055528_1000181
439 Ga0055528_1005260
440 Ga0055530_10001297
441 Ga0055530_10002649
442 Ga0055530_10004384
443 Ga0055530_10009888
444 Ga0055530_10017995
445 Ga0055531_10001084
446 Ga0055531_10011115
447 Ga0055531_10027583
448 Ga0055543_1000692
449 Ga0065165_1000201
450 Ga0065165_1000321
451 Ga0065165_1009400
452 Ga0068868_100455813
453 Ga0070661_100064794
454 Ga0070669_100182427
455 Ga0070671_100004730
456 Ga0070667_100018764
457 Ga0070714_100048242
458 Ga0070708_100144039
459 Ga0070662_100432503
460 Ga0070662_100640515
461 Ga0070707_100191145
462 Ga0070698_100056745
463 Ga0070679_100591190
464 Ga0070684_100323712
465 Ga0070697_100255492
466 Ga0070665_100016383
467 Ga0070665_100063418
468 Ga0068856_100096166
469 Ga0068856_100190065
470 Ga0070702_100224920
471 Ga0068863_100009616
472 Ga0068858_100002701
473 Ga0068862_100010772
474 Ga0068862_100314176
475 Ga0070717_10065154
476 Ga0075431_100123587
477 Ga0075434_100018566
478 Ga0068865_100445080
479 Ga0099826_10000006
480 Ga0075435_100000017
481 Ga0105250_10017037
482 Ga0105240_10004572
483 Ga0105240_10039934
484 Ga0105240_10064478
485 Ga0111539_10005216
486 Ga0105245_10023887
487 Ga0105247_10000248
488 Ga0105241_10202588
489 Ga0105242_10146814
490 Ga0105248_10018666
491 Ga0105248_10061659
492 Ga0105248_10373721
493 Ga0105237_10518760
494 Ga0105238_10113652
495 Ga0105238_10388326
496 Ga0105249_10029334
497 Ga0105249_10118921
498 Ga0099796_10021120
499 Ga0157370_10090187
500 Ga0157369_10470185
501 Ga0157378_10002118
502 Ga0163162_10045642
503 Ga0157372_10179529
504 Ga0163163_10026043
505 Ga0163163_10079919
506 Ga0182008_10000926
507 Ga0157379_10051360
508 Ga0157379_10080973
509 Ga0157379_10196895
510 Ga0182006_1000066
511 Ga0182006_1000188
512 Ga0182007_10045991
513 Ga0182005_1001641
514 Ga0182005_1010571
515 Ga0182005_1048102
516 Ga0182005_1071020
517 Ga0183363_1010
518 Ga0163161_10529878
519 Ga0213872_10002790
520 Ga0213876_10179286
521 Ga0209435_103648
522 Ga0209760_100584
523 Ga0209436_100123
524 Ga0209436_100307
525 Ga0209436_100548
526 Ga0209784_100094
527 Ga0209566_102564
528 Ga0209672_107084
529 Ga0209563_100013
530 Ga0207427_100100
531 Ga0207427_100194
532 Ga0209437_100059
533 Ga0209437_100121
534 Ga0209258_100034
535 Ga0209258_100584
536 Ga0207425_1000013
537 Ga0207425_1000371
538 Ga0209646_1001749
539 Ga0209646_1002605
540 Ga0209026_1001373
541 Ga0209148_1000001
542 Ga0209759_1001936
543 Ga0209759_1005307
544 Ga0209129_1000102
545 Ga0209129_1004293
546 Ga0209233_1000002
547 Ga0209233_1000112
548 Ga0209565_1000035
549 Ga0209565_1000881
550 Ga0209565_1003091
551 Ga0209565_1007104
552 Ga0209565_1013006
553 Ga0209455_1000054
554 Ga0209673_1000006
555 Ga0209673_1049331
556 Ga0209130_1000149
557 Ga0209130_1001115
558 Ga0209130_1002691
559 Ga0209675_1000005
560 Ga0209675_1000709
561 Ga0209675_1001028
562 Ga0209676_1000207
563 Ga0209676_1000233
564 Ga0209564_1000088
565 Ga0209564_1000902
566 Ga0209564_1004909
567 Ga0209758_1000031
568 Ga0209050_1000056
569 Ga0209050_1000430
570 Ga0209050_1000624
571 Ga0209050_1001488
572 Ga0209050_1005206
573 Ga0209256_1000035
574 Ga0209256_1000141
575 Ga0209256_1000560
576 Ga0209256_1003306
577 Ga0209256_1004338
578 Ga0209256_1005324
579 Ga0209256_1010201
580 Ga0207426_1007971
581 Ga0207426_1009541
582 Ga0209051_1003749
583 Ga0209051_1009925
584 Ga0209257_1000157
585 Ga0209257_1000265
586 Ga0209257_1008031
587 Ga0209257_1025972
588 Ga0207710_10000333
589 Ga0207710_10025590
590 Ga0207647_10039378
591 Ga0207699_10167168
592 Ga0207705_10017770
593 Ga0207695_10003231
594 Ga0207695_10049844
595 Ga0207695_10058513
596 Ga0207694_10210496
597 Ga0207659_10627681
598 Ga0207664_10000102
599 Ga0207644_10019276
600 Ga0207690_10001850
601 Ga0207706_10018677
602 Ga0207711_10317473
603 Ga0207711_10335347
604 Ga0207667_10025499
605 Ga0207668_10008796
606 Ga0207668_10194596
607 Ga0207658_10002111
608 Ga0207703_10004984
609 Ga0207702_10074029
610 Ga0209282_1000003
611 Ga0265354_1000406
612 Ga0268266_10005072
613 Ga0268266_10012137
614 Ga0268265_10008772
615 Ga0268264_10164825
616 Ga0265338_10030476
617 Ga0307511_10000077
618 Ga0307511_10064112
619 Ga0265327_10001259
620 Ga0265316_10063684
621 Ga0307408_100001475
622 Ga0307408_100028124
623 Ga0307408_100036627
624 Ga0265342_10033005
625 Ga0307516_10003240
626 Ga0307412_10001033
627 Ga0307510_10000009
628 Ga0307510_10026241
629 Ga0373936_0001755
630 Ga0373936_0035093
631 Ga0395900_0046285
632 Ga0395905_0205113
633 Ga0436364_1244178
634 Ga0395901_0000413
635 Ga0395901_0068071
636 Ga0395901_0099093
637 Ga0395901_0112009
638 Ga0436365_0365417
639 Ga0436365_1284784
640 Ga0436361_0505866
641 Ga0439436_0000004
642 Ga0439465_0001164
643 Ga0451793_1539854
644 Ga0439445_0013144
645 Ga0450908_000029
646 Ga0439459_0008636
647 Ga0451577_0005793
648 Ga0466966_0095183
649 Ga0466961_0150741
650 Ga0466968_0007387
651 Ga0466959_0000553
652 Ga0466959_0077927
653 Ga0466967_0068620
654 Ga0495617_000024
655 Ga0495638_0000060
656 Ga0495638_0080614
657 Ga0495638_0170450
658 Ga0495638_0250549
659 Ga0495650_0026259
660 Ga0495584_0001718
661 Ga0495584_0023792
662 Ga0495585_0000143
663 Ga0495585_0000360
664 Ga0495607_0012186
665 Ga0495583_0007933
666 Ga0495606_0000136
667 Ga0495606_0001286
668 Ga0495606_0126732
669 Ga0495606_0166288
670 Ga0495610_0000542
671 Ga0495616_0000003
672 Ga0495616_0004267
673 Ga0495620_0000102
674 Ga0495631_0000022
675 Ga0495632_0000020
676 Ga0495632_0033031
677 Ga0495632_0149379
678 Ga0495648_0000184
679 Ga0495648_0001155
680 Ga0495642_0017187
681 Ga0495609_0000173
682 Ga0495597_0017014
683 Ga0495597_0105909
684 Ga0495633_0217859
685 Ga0495668_0000458
686 Ga0495668_0000511
687 Ga0495668_0007758
688 Ga0495668_0100119
689 Ga0495625_0000578
690 Ga0495625_0027414
691 Ga0495659_0002366
692 Ga0495659_0004798
693 Ga0495661_0002830
694 Ga0495661_0082212
695 Ga0495669_0000485
696 Ga0495670_0001364
697 Ga0495649_0011172
698 Ga0495649_0059228
699 Ga0495660_0000052
700 Ga0495683_0000699
701 Ga0495677_0068125
702 Ga0495679_016244
703 Ga0495685_000552
704 Ga0495673_0000036
705 Ga0495681_0005927
706 Ga0495681_0077950
707 Ga0495684_0136731
708 Ga0495686_0000180
709 Ga0495686_0007095
710 Ga0495686_0034773
711 Ga0495686_0144822
712 Ga0496100_0661585
713 Ga0496102_0003223
714 Ga0496102_0095069
715 Ga0496103_0145258
716 Ga0496106_0000904
717 Ga0496108_0074215
718 Ga0496112_0071282
719 Ga0496112_0198504
720 Ga0496115_0303533
721 Ga0496115_0454646
722 Ga0496117_0000151
723 Ga0496118_0000105
724 Ga0496118_0160672
725 Ga0496119_0002419
726 Ga0496119_0003839
727 Ga0496119_0027477
728 Ga0496120_0001210
729 Ga0496121_0000782
730 Ga0496121_0001227
731 Ga0496121_0003041
732 Ga0496121_0036714
733 Ga0496121_0070452
734 Ga0496124_0056351
735 Ga0496124_0170273
736 Ga0496125_0018647
737 Ga0496125_0019132
738 Ga0495678_000400
739 Ga0495682_0002506
740 Ga0501032_0076039
741 Ga0501034_0095430
742 Ga0501034_0154755
743 Ga0501038_0114734
744 Ga0501043_0146403
745 Ga0501043_0532676
746 Ga0501046_0012790
747 Ga0501046_0186079
748 Ga0501047_0036131
749 Ga0501047_0308415
750 Ga0501263_003419
751 Ga0501279_002123
752 Ga0501279_013208
753 Ga0501035_0003253
754 Ga0501035_0386526
755 Ga0501035_0484364
756 nmdc:mga06r32_113336_c1
757 nmdc:mga0n895_295374_c1
758 nmdc:mga0n895_37_c1
759 nmdc:mga0n895_721935_c1
760 nmdc:mga0rr50_14_c1
761 nmdc:mga0rr50_89874_c1
762 nmdc:mga08x19_63156_c1
763 nmdc:mga08x19_925_c1
764 Ga0500644_0000116
765 Ga0500572_000257
766 Ga0500594_0000016
767 Ga0500608_000063
768 Ga0500617_075677
769 Ga0500559_0002976
770 Ga0500622_0003151
771 Ga0500622_0037253
772 Ga0500645_001886
773 2538833390
774 2585147450
775 2587918207
776 2595450707
777 2643789952
778 2643831878
779 2643896613
780 2644214320
781 2644224683
782 2644234382
783 2644478636
784 2721028902
785 2735835511
786 2842921064
787 2857508178
788 2884962159
789 2919407143
790 2928535816
791 2939613895
792 2953996338

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05096

Glu_cyclase_2

Glutamine cyclotransferase

16

263

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nom-assembly2.cif.gz_B crystal structure of zymomonas mobilis glutaminyl cyclase (monoclinic form) 0.9618 25 255
3mbr-assembly1.cif.gz_X crystal structure of the glutaminyl cyclase from xanthomonas campestris 0.95 26 259
3nom-assembly2.cif.gz_B crystal structure of zymomonas mobilis glutaminyl cyclase (monoclinic form) 0.9457 25 255
3mbr-assembly1.cif.gz_X crystal structure of the glutaminyl cyclase from xanthomonas campestris 0.9382 26 259
3nok-assembly2.cif.gz_B crystal structure of myxococcus xanthus glutaminyl cyclase 0.9258 27 255
ID Description Score Start End Superfamily
af_Q5VRH1_75_319_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8922 11 253 2.130.10.10
af_A0A144A3U7_117_356_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8879 54 251 2.130.10.10
af_Q5VRH1_75_319_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8817 11 253 2.130.10.10
af_F1M8Z5_136_280_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8136 42 124 2.40.128.630
af_E9QIR4_212_349_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8094 43 131 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7X5QXG6-F1-model_v4 Glutaminyl-peptide cyclotransferase 0.9864 23 255 GO:0016603
AF-A0A2E5GTY6-F1-model_v4 Glutamine cyclotransferase 0.9836 32 125 GO:0016603
AF-A0A356T8H6-F1-model_v4 Glutamine cyclotransferase 0.9832 32 148 GO:0016603
AF-A0A7X7RNT1-F1-model_v4 Glutaminyl-peptide cyclotransferase 0.9818 32 253 GO:0016603
AF-A0A7C2TPQ4-F1-model_v4 Glutaminyl-peptide cyclotransferase 0.9816 21 257 GO:0016603

Map