F433450

General Info

Members Datasets Scaffolds Average Seq Length
396 266 792 160

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100107441|Ga0068853_1001074415
Length 176
Sequence MRNVAAMDPSFRWDDGVRTMTNFAKAHLLALLLPLALMAGALGSQFIGGLYPCEMCHWQRWPHYTAITLVLLSFFLPQRGARRVLVLLAALAIAASGAIGVFHAGVEYGWWEGLTQCSTGLGSGGSGDTLADIWATPAIRCDVAQWTLFGISLAGFNAIFSLGGAVLILALWLKSR

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
185 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
188 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
238 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
239 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
244 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
245 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
246 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
254 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
257 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
258 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
261 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
262 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
263 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
264 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
265 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
266 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.23
Metatranscriptomes 0
Isolates 1.77

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 4.8
Nodule 0
Rhizoplane 5.56
Rhizosphere 84.6
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100107441 3300005539 Bacteria 2474
2 JGI24736J21556_1000052 3300001904 Bacteria 19247
3 JGI24741J21665_1007715 3300001915 Bacteria 2074
4 JGI24740J21852_10003160 3300001979 Bacteria 7268
5 JGI24739J22299_10005509 3300001989 Bacteria 4803
6 JGI24737J22298_10001775 3300001990 Bacteria 7726
7 JGI24735J21928_10001993 3300002067 Bacteria 7183
8 JGI24750J21931_1000230 3300002070 Bacteria 9530
9 JGI24748J21848_1000034 3300002074 Bacteria 74812
10 JGI24738J21930_10000375 3300002075 Bacteria 12439
11 JGI24749J21850_1000652 3300002076 Bacteria 5031
12 JGI24034J26672_10000018 3300002239 Bacteria 130180
13 JGI24742J22300_10000919 3300002244 Bacteria 4492
14 JGI24751J29686_10003746 3300002459 Bacteria 3068
15 Ga0055536_1010706 3300003781 Bacteria 3602
16 Ga0065165_1040526 3300005262 Bacteria 1388
17 Ga0065707_10082427 3300005295 Bacteria 15304
18 Ga0070658_10023949 3300005327 Bacteria 4898
19 Ga0070676_10449750 3300005328 Bacteria 906
20 Ga0070690_100000008 3300005330 Bacteria 118441
21 Ga0070690_100028084 3300005330 Bacteria 3482
22 Ga0070670_100064015 3300005331 Bacteria 3155
23 Ga0070666_10000032 3300005335 Bacteria 129142
24 Ga0070666_10410314 3300005335 Bacteria 974
25 Ga0070680_100806345 3300005336 Bacteria 809
26 Ga0070682_100034306 3300005337 Bacteria 3090
27 Ga0068868_100000162 3300005338 Bacteria 43570
28 Ga0070660_100001623 3300005339 Bacteria 15463
29 Ga0070689_100003709 3300005340 Bacteria 10213
30 Ga0070689_100161168 3300005340 Bacteria 1813
31 Ga0070691_10000082 3300005341 Bacteria 26541
32 Ga0070661_100149774 3300005344 Bacteria 1763
33 Ga0070661_100306108 3300005344 Bacteria 1238
34 Ga0070669_100000211 3300005353 Bacteria 48717
35 Ga0070675_100022520 3300005354 Bacteria 5036
36 Ga0070675_100377853 3300005354 Bacteria 1261
37 Ga0070671_100007827 3300005355 Bacteria 8540
38 Ga0070671_100010137 3300005355 Bacteria 7568
39 Ga0070674_100027278 3300005356 Bacteria 3742
40 Ga0070673_100014748 3300005364 Bacteria 5460
41 Ga0070673_100670426 3300005364 Bacteria 950
42 Ga0070688_100029160 3300005365 Bacteria 3302
43 Ga0070659_100000022 3300005366 Bacteria 154091
44 Ga0070659_100075727 3300005366 Bacteria 2682
45 Ga0070659_100193173 3300005366 Bacteria 1674
46 Ga0070667_100000174 3300005367 Bacteria 79730
47 Ga0070667_100013233 3300005367 Bacteria 6817
48 Ga0070709_10000238 3300005434 Bacteria 35500
49 Ga0070709_10062345 3300005434 Bacteria 2377
50 Ga0070714_100031391 3300005435 Bacteria 4432
51 Ga0070713_100000011 3300005436 Bacteria 146314
52 Ga0070710_10160155 3300005437 Bacteria 1395
53 Ga0070711_100103191 3300005439 Bacteria 2078
54 Ga0070711_100414096 3300005439 Bacteria 1097
55 Ga0070705_100386918 3300005440 Bacteria 1031
56 Ga0070700_100344220 3300005441 Bacteria 1103
57 Ga0070663_100045783 3300005455 Bacteria 3092
58 Ga0070663_100518954 3300005455 Bacteria 992
59 Ga0070678_100059215 3300005456 Bacteria 2814
60 Ga0070662_100065344 3300005457 Bacteria 2666
61 Ga0070662_100159125 3300005457 Bacteria 1765
62 Ga0070681_10324873 3300005458 Bacteria 1448
63 Ga0070685_10000046 3300005466 Bacteria 73999
64 Ga0070699_100660773 3300005518 Bacteria 954
65 Ga0070679_100912222 3300005530 Bacteria 822
66 Ga0068853_100007449 3300005539 Bacteria 8758
67 Ga0070672_100009120 3300005543 Bacteria 6825
68 Ga0070686_100000030 3300005544 Bacteria 118308
69 Ga0070686_100038761 3300005544 Bacteria 2964
70 Ga0070695_100155517 3300005545 Bacteria 1600
71 Ga0070693_100155792 3300005547 Bacteria 1451
72 Ga0070665_100000056 3300005548 Bacteria 242622
73 Ga0068855_100026889 3300005563 Bacteria 6884
74 Ga0068855_100348908 3300005563 Bacteria 1630
75 Ga0068855_100455943 3300005563 Bacteria 1395
76 Ga0070664_100123448 3300005564 Bacteria 2269
77 Ga0070664_100855998 3300005564 Bacteria 851
78 Ga0068857_100005182 3300005577 Bacteria 11087
79 Ga0068857_100073890 3300005577 Bacteria 3038
80 Ga0068857_101702385 3300005577 Bacteria 616
81 Ga0068854_100350332 3300005578 Bacteria 1208
82 Ga0068854_100447106 3300005578 Bacteria 1078
83 Ga0068856_100000964 3300005614 Bacteria 30705
84 Ga0068856_100003424 3300005614 Bacteria 16037
85 Ga0068852_100005817 3300005616 Bacteria 8853
86 Ga0068852_100006345 3300005616 Bacteria 8535
87 Ga0068852_101103897 3300005616 Bacteria 813
88 Ga0068859_100003975 3300005617 Bacteria 15087
89 Ga0068859_101601715 3300005617 Bacteria 719
90 Ga0068864_100002649 3300005618 Bacteria 14782
91 Ga0068866_10004832 3300005718 Bacteria 5533
92 Ga0068851_10283834 3300005834 Bacteria 947
93 Ga0068863_100000065 3300005841 Bacteria 117925
94 Ga0068863_100005004 3300005841 Bacteria 13068
95 Ga0068863_100186877 3300005841 Bacteria 1990
96 Ga0068858_100004454 3300005842 Bacteria 13729
97 Ga0068858_100082795 3300005842 Bacteria 2983
98 Ga0068858_100138308 3300005842 Bacteria 2286
99 Ga0068860_100000125 3300005843 Bacteria 123363
100 Ga0068860_100000132 3300005843 Bacteria 120657
101 Ga0068860_100069822 3300005843 Bacteria 3340
102 Ga0068862_100000356 3300005844 Bacteria 49670
103 Ga0081455_10000100 3300005937 Bacteria 95033
104 Ga0081539_10006046 3300005985 Bacteria 11858
105 Ga0081539_10072820 3300005985 Bacteria 1835
106 Ga0070716_100025826 3300006173 Bacteria 3140
107 Ga0070712_100000014 3300006175 Bacteria 108668
108 Ga0068871_100060412 3300006358 Bacteria 3092
109 Ga0068871_100559984 3300006358 Unclassified 1036
110 Ga0075434_100069363 3300006871 Bacteria 3515
111 Ga0075429_100839356 3300006880 Bacteria 804
112 Ga0068865_100852338 3300006881 Bacteria 789
113 Ga0075436_100000047 3300006914 Bacteria 72907
114 Ga0075436_100031385 3300006914 Bacteria 3658
115 Ga0097620_100003975 3300006931 Bacteria 15087
116 Ga0097620_101601691 3300006931 Bacteria 719
117 Ga0105251_10334723 3300009011 Bacteria 689
118 Ga0105240_10000355 3300009093 Bacteria 86025
119 Ga0105245_10072879 3300009098 Bacteria 3121
120 Ga0105245_10265011 3300009098 Bacteria 1673
121 Ga0105245_11484915 3300009098 Bacteria 728
122 Ga0105243_10310432 3300009148 Bacteria 1433
123 Ga0105241_10028509 3300009174 Bacteria 4162
124 Ga0105241_10134107 3300009174 Bacteria 2008
125 Ga0105242_10025554 3300009176 Bacteria 4675
126 Ga0105237_10008237 3300009545 Bacteria 11319
127 Ga0105237_10169571 3300009545 Bacteria 2182
128 Ga0105238_10011985 3300009551 Bacteria 8733
129 Ga0105238_10048182 3300009551 Bacteria 4295
130 Ga0105238_10174577 3300009551 Bacteria 2125
131 Ga0105249_10000109 3300009553 Bacteria 112308
132 Ga0105239_10072584 3300010375 Bacteria 3784
133 Ga0157373_10003903 3300013100 Bacteria 11264
134 Ga0157373_10031878 3300013100 Bacteria 3796
135 Ga0157371_10118561 3300013102 Bacteria 1882
136 Ga0157370_10000280 3300013104 Bacteria 64677
137 Ga0157370_10043038 3300013104 Bacteria 4348
138 Ga0157369_10004867 3300013105 Bacteria 15757
139 Ga0157369_10054572 3300013105 Bacteria 4315
140 Ga0157369_10131948 3300013105 Bacteria 2646
141 Ga0157374_10028010 3300013296 Bacteria 5088
142 Ga0157378_10369347 3300013297 Bacteria 1406
143 Ga0157378_10985069 3300013297 Bacteria 877
144 Ga0163162_10205121 3300013306 Bacteria 2100
145 Ga0157372_10008076 3300013307 Bacteria 11194
146 Ga0157372_10334299 3300013307 Bacteria 1764
147 Ga0157375_12004981 3300013308 Bacteria 688
148 Ga0163163_10007312 3300014325 Bacteria 9740
149 Ga0163163_10077061 3300014325 Bacteria 3329
150 Ga0157380_10000599 3300014326 Bacteria 22227
151 Ga0157380_10002112 3300014326 Bacteria 13330
152 Ga0157379_10001288 3300014968 Bacteria 20426
153 Ga0157376_11644970 3300014969 Bacteria 677
154 Ga0163161_10000084 3300017792 Bacteria 93742
155 Ga0207672_1000884 3300025223 Bacteria 3044
156 Ga0209257_1001814 3300025304 Bacteria 23373
157 Ga0209257_1019121 3300025304 Bacteria 2596
158 Ga0207656_10128972 3300025321 Bacteria 1183
159 Ga0207642_10095611 3300025899 Bacteria 1479
160 Ga0207680_10000009 3300025903 Bacteria 464571
161 Ga0207680_10013590 3300025903 Bacteria 4188
162 Ga0207680_10013885 3300025903 Bacteria 4151
163 Ga0207647_10003328 3300025904 Bacteria 12072
164 Ga0207699_10000233 3300025906 Bacteria 31418
165 Ga0207699_10050030 3300025906 Bacteria 2463
166 Ga0207645_10102290 3300025907 Bacteria 1849
167 Ga0207645_10495365 3300025907 Bacteria 827
168 Ga0207705_10102930 3300025909 Bacteria 2102
169 Ga0207705_10695683 3300025909 Bacteria 790
170 Ga0207654_10008410 3300025911 Bacteria 5215
171 Ga0207654_10028143 3300025911 Bacteria 3062
172 Ga0207695_10012890 3300025913 Bacteria 10005
173 Ga0207695_10016906 3300025913 Bacteria 8513
174 Ga0207671_10007095 3300025914 Bacteria 9796
175 Ga0207671_10074643 3300025914 Bacteria 2535
176 Ga0207693_10000018 3300025915 Bacteria 138365
177 Ga0207663_10075064 3300025916 Bacteria 2193
178 Ga0207660_10594779 3300025917 Bacteria 901
179 Ga0207657_10000790 3300025919 Bacteria 33637
180 Ga0207657_10009096 3300025919 Bacteria 10021
181 Ga0207657_10073681 3300025919 Bacteria 2885
182 Ga0207649_10049434 3300025920 Bacteria 2597
183 Ga0207649_10171134 3300025920 Bacteria 1513
184 Ga0207681_10000965 3300025923 Bacteria 18765
185 Ga0207694_10015428 3300025924 Bacteria 5761
186 Ga0207694_10021944 3300025924 Bacteria 4841
187 Ga0207694_10136219 3300025924 Bacteria 1972
188 Ga0207694_10429361 3300025924 Bacteria 1101
189 Ga0207650_10016957 3300025925 Bacteria 5095
190 Ga0207659_10201581 3300025926 Bacteria 1590
191 Ga0207687_10092778 3300025927 Bacteria 2206
192 Ga0207687_10498378 3300025927 Bacteria 1016
193 Ga0207700_10000005 3300025928 Bacteria 394836
194 Ga0207664_10014515 3300025929 Bacteria 5692
195 Ga0207644_10003132 3300025931 Bacteria 10653
196 Ga0207644_10003709 3300025931 Bacteria 9897
197 Ga0207690_10000003 3300025932 Bacteria 783011
198 Ga0207706_10003953 3300025933 Bacteria 14044
199 Ga0207706_10006178 3300025933 Bacteria 11123
200 Ga0207686_10255067 3300025934 Bacteria 1283
201 Ga0207709_10124670 3300025935 Bacteria 1745
202 Ga0207669_10256862 3300025937 Bacteria 1304
203 Ga0207704_10007995 3300025938 Bacteria 5030
204 Ga0207665_10187854 3300025939 Unclassified 1500
205 Ga0207691_10007876 3300025940 Bacteria 10263
206 Ga0207711_10004290 3300025941 Bacteria 12184
207 Ga0207711_10015796 3300025941 Bacteria 6263
208 Ga0207711_10095398 3300025941 Bacteria 2623
209 Ga0207667_10007703 3300025949 Bacteria 12887
210 Ga0207667_10033129 3300025949 Bacteria 5558
211 Ga0207667_10044656 3300025949 Bacteria 4695
212 Ga0207651_10001472 3300025960 Bacteria 10708
213 Ga0207712_10000046 3300025961 Bacteria 162468
214 Ga0207640_10005766 3300025981 Bacteria 6752
215 Ga0207640_10077463 3300025981 Bacteria 2260
216 Ga0207640_10543904 3300025981 Bacteria 974
217 Ga0207658_10000122 3300025986 Bacteria 84415
218 Ga0207658_10000784 3300025986 Bacteria 27123
219 Ga0207677_10000154 3300026023 Bacteria 54637
220 Ga0207677_10045368 3300026023 Bacteria 2935
221 Ga0207703_10006409 3300026035 Bacteria 9405
222 Ga0207703_10069636 3300026035 Bacteria 2902
223 Ga0207703_10142848 3300026035 Bacteria 2079
224 Ga0207639_10034142 3300026041 Bacteria 3757
225 Ga0207639_10053943 3300026041 Bacteria 3070
226 Ga0207678_10043007 3300026067 Bacteria 3910
227 Ga0207702_10000173 3300026078 Bacteria 77458
228 Ga0207702_10001080 3300026078 Bacteria 27929
229 Ga0207702_10008430 3300026078 Bacteria 8695
230 Ga0207702_10019757 3300026078 Bacteria 5578
231 Ga0207641_10000063 3300026088 Bacteria 159283
232 Ga0207641_10000956 3300026088 Bacteria 29693
233 Ga0207641_10023493 3300026088 Bacteria 5078
234 Ga0207648_10007110 3300026089 Bacteria 11043
235 Ga0207676_10008003 3300026095 Bacteria 7514
236 Ga0207676_10442561 3300026095 Bacteria 1223
237 Ga0207676_11798346 3300026095 Bacteria 611
238 Ga0207674_10000112 3300026116 Bacteria 94220
239 Ga0207674_10005308 3300026116 Bacteria 15329
240 Ga0207674_10351836 3300026116 Bacteria 1424
241 Ga0207675_100000167 3300026118 Bacteria 58637
242 Ga0207683_10005286 3300026121 Bacteria 11078
243 Ga0207698_10007028 3300026142 Bacteria 7050
244 Ga0207698_10056097 3300026142 Bacteria 3040
245 Ga0207698_10113714 3300026142 Bacteria 2275
246 Ga0207698_10412971 3300026142 Bacteria 1293
247 Ga0209974_10024148 3300027876 Bacteria 2012
248 Ga0268266_10000066 3300028379 Bacteria 242637
249 Ga0268265_10000129 3300028380 Bacteria 96060
250 Ga0268264_10000130 3300028381 Bacteria 181732
251 Ga0268264_10000166 3300028381 Bacteria 146960
252 Ga0268264_10421459 3300028381 Bacteria 1287
253 Ga0307517_10150311 3300028786 Bacteria 1600
254 Ga0307405_10064076 3300031731 Bacteria 2334
255 Ga0307413_10329982 3300031824 Bacteria 1169
256 Ga0307406_10028951 3300031901 Bacteria 3349
257 Ga0307406_10923357 3300031901 Bacteria 744
258 Ga0307406_11195193 3300031901 Bacteria 660
259 Ga0307412_10000433 3300031911 Bacteria 25242
260 Ga0307412_10347511 3300031911 Bacteria 1189
261 Ga0307416_100021407 3300032002 Bacteria 4641
262 Ga0307416_101230752 3300032002 Bacteria 854
263 Ga0307414_10000107 3300032004 Bacteria 58717
264 Ga0307414_10006362 3300032004 Bacteria 6579
265 Ga0307414_10050595 3300032004 Bacteria 2879
266 Ga0307414_10132154 3300032004 Bacteria 1939
267 Ga0373948_0032511 3300034817 Bacteria 1059
268 Ga0373944_0153296 3300035089 Bacteria 813
269 Ga0373923_0026149 3300035111 Bacteria 2320
270 Ga0373932_0286404 3300035112 Bacteria 611
271 Ga0373939_0022647 3300035114 Bacteria 1733
272 Ga0373960_0064719 3300035121 Bacteria 1117
273 Ga0373960_0167451 3300035121 Bacteria 760
274 Ga0373943_0027114 3300035170 Bacteria 2689
275 Ga0373946_0065754 3300035171 Bacteria 1553
276 Ga0373955_0118921 3300035172 Bacteria 1534
277 Ga0373961_0052734 3300035241 Bacteria 1212
278 Ga0373931_0004731 3300035691 Bacteria 6238
279 Ga0373931_0025071 3300035691 Bacteria 3028
280 Ga0373931_0525813 3300035691 Bacteria 766
281 Ga0373935_0018767 3300035692 Bacteria 4213
282 Ga0373927_0071028 3300035695 Bacteria 2253
283 Ga0373947_0042524 3300035725 Bacteria 2712
284 Ga0373937_0006814 3300036401 Bacteria 9858
285 Ga0373925_0004938 3300037068 Bacteria 10027
286 Ga0373925_0050470 3300037068 Bacteria 3103
287 Ga0395898_1904410 3300037466 Bacteria 515
288 Ga0237819_00490 3300038705 Bacteria 13388
289 Ga0439436_0051358 3300041404 Bacteria 1164
290 Ga0439465_0002948 3300041413 Bacteria 5571
291 Ga0451793_0043240 3300041452 Bacteria 639
292 Ga0450920_051270 3300042122 Bacteria 828
293 Ga0439446_0026382 3300042156 Bacteria 1664
294 Ga0466969_0222273 3300044656 Bacteria 859
295 Ga0466972_0033466 3300044658 Bacteria 2521
296 Ga0466972_0087207 3300044658 Bacteria 1483
297 Ga0466965_0209449 3300044683 Bacteria 1036
298 Ga0466968_0008164 3300044735 Bacteria 4003
299 Ga0466970_0030289 3300044765 Bacteria 2853
300 Ga0466957_0038061 3300044842 Bacteria 2897
301 Ga0466960_0028712 3300044901 Bacteria 2547
302 Ga0466958_0242830 3300045836 Bacteria 1151
303 Ga0466967_0282019 3300045976 Bacteria 1594
304 Ga0495617_028742 3300046452 Bacteria 1869
305 Ga0495638_0000097 3300046460 Bacteria 141017
306 Ga0495638_0000388 3300046460 Bacteria 54286
307 Ga0495583_0000252 3300046506 Bacteria 88617
308 Ga0495632_0036482 3300046519 Bacteria 2500
309 Ga0495648_0000308 3300046524 Bacteria 54286
310 Ga0495663_0267116 3300046525 Bacteria 610
311 Ga0495654_0002162 3300046530 Bacteria 12812
312 Ga0495654_0204774 3300046530 Bacteria 842
313 Ga0495622_0071665 3300046557 Bacteria 1599
314 Ga0495633_0013089 3300046558 Bacteria 4386
315 Ga0495668_0004479 3300046616 Bacteria 9899
316 Ga0495668_0054988 3300046616 Bacteria 2198
317 Ga0495623_0097454 3300046679 Bacteria 1796
318 Ga0495670_0001796 3300046691 Bacteria 10535
319 Ga0495671_0000011 3300046692 Bacteria 365582
320 Ga0495673_0000013 3300047469 Bacteria 612902
321 Ga0495686_0000600 3300047472 Bacteria 50240
322 Ga0495686_0001038 3300047472 Bacteria 33340
323 Ga0495686_0478189 3300047472 Bacteria 659
324 Ga0496100_0004354 3300048903 Bacteria 7497
325 Ga0496101_0003296 3300048904 Bacteria 10044
326 Ga0496102_0022699 3300048905 Bacteria 5561
327 Ga0496102_0052927 3300048905 Bacteria 3700
328 Ga0496103_0000788 3300048906 Bacteria 23326
329 Ga0496103_0010484 3300048906 Bacteria 5485
330 Ga0496103_0915416 3300048906 Bacteria 549
331 Ga0496104_0077669 3300048907 Bacteria 3163
332 Ga0496105_0007221 3300048908 Bacteria 8579
333 Ga0496105_0065920 3300048908 Bacteria 2989
334 Ga0496107_0001984 3300048910 Bacteria 13030
335 Ga0496107_0034230 3300048910 Bacteria 3638
336 Ga0496108_0009981 3300048911 Bacteria 7695
337 Ga0496109_0049473 3300048912 Bacteria 3826
338 Ga0496110_0003761 3300048913 Bacteria 11691
339 Ga0496110_0175203 3300048913 Bacteria 1947
340 Ga0496111_0002605 3300048914 Bacteria 10918
341 Ga0496111_0176978 3300048914 Bacteria 1586
342 Ga0496112_0383313 3300048915 Bacteria 1347
343 Ga0496113_0001095 3300048916 Bacteria 14658
344 Ga0496113_0649400 3300048916 Bacteria 844
345 Ga0496116_0033612 3300048919 Bacteria 3636
346 Ga0496117_0032474 3300048920 Bacteria 3965
347 Ga0496118_0033498 3300048921 Bacteria 4213
348 Ga0496118_0313063 3300048921 Bacteria 855
349 Ga0496119_0051965 3300048922 Bacteria 2514
350 Ga0496121_0151451 3300048924 Bacteria 1706
351 Ga0496123_0036795 3300048926 Bacteria 3463
352 Ga0496123_0197463 3300048926 Bacteria 1035
353 Ga0496124_0000354 3300048927 Bacteria 83817
354 Ga0496124_0001620 3300048927 Bacteria 32262
355 Ga0496125_0023673 3300048928 Bacteria 5663
356 Ga0496126_0108609 3300048929 Bacteria 2419
357 Ga0495678_113016 3300049459 Bacteria 923
358 Ga0501290_002714 3300049513 Bacteria 2270
359 Ga0501293_005651 3300049516 Bacteria 1006
360 Ga0501300_010242 3300049523 Bacteria 1367
361 Ga0501034_0001454 3300049571 Bacteria 31350
362 Ga0501037_0488306 3300049573 Bacteria 836
363 Ga0501039_0946047 3300049575 Bacteria 670
364 Ga0501223_006424 3300049663 Bacteria 2431
365 Ga0501257_000041 3300049686 Bacteria 36608
366 Ga0501262_056082 3300049759 Bacteria 620
367 Ga0501280_002333 3300049776 Bacteria 3201
368 Ga0501035_0673937 3300049822 Bacteria 836
369 nmdc:mga09592_581981_c1 3300050508 Bacteria 960
370 nmdc:mga0n895_49358_c1 3300050512 Bacteria 4122
371 nmdc:mga0rr50_32040_c1 3300050513 Bacteria 3740
372 nmdc:mga08x19_121884_c1 3300050514 Bacteria 1749
373 nmdc:mga08x19_62_c1 3300050514 Bacteria 114601
374 Ga0500643_001588 3300053087 Bacteria 12854
375 Ga0500643_001702 3300053087 Bacteria 12217
376 Ga0500643_001704 3300053087 Bacteria 12216
377 Ga0500592_000806 3300053116 Bacteria 5139
378 Ga0500592_001986 3300053116 Bacteria 3292
379 Ga0500594_0002307 3300053118 Bacteria 4138
380 Ga0500658_0001454 3300053134 Bacteria 9468
381 Ga0500658_0074738 3300053134 Bacteria 1437
382 Ga0500604_0011955 3300053151 Bacteria 2339
383 Ga0500604_0043677 3300053151 Bacteria 1362
384 Ga0500627_0000115 3300053158 Bacteria 25685
385 Ga0500627_0008572 3300053158 Bacteria 3640
386 Ga0500627_0020635 3300053158 Bacteria 2645
387 Ga0500627_0261935 3300053158 Bacteria 763
388 Ga0500596_024779 3300053735 Bacteria 914
389 Ga0466962_0204719 3300061719 Bacteria 965
390 2643833074 2643221563 Bacteria 4726935
391 2644053131 2643221608 Bacteria 4724829
392 2819715603 2818991466 Bacteria 4748179
393 2879163728 2879163058 Bacteria 4223965
394 2928970889 2928968154 Bacteria 4633371
395 2990267870 2990265787 Bacteria 3943888
396 2993697112 2993693658 Bacteria 4040749
397 Ga0068853_100107441
398 JGI24736J21556_1000052
399 JGI24741J21665_1007715
400 JGI24740J21852_10003160
401 JGI24739J22299_10005509
402 JGI24737J22298_10001775
403 JGI24735J21928_10001993
404 JGI24750J21931_1000230
405 JGI24748J21848_1000034
406 JGI24738J21930_10000375
407 JGI24749J21850_1000652
408 JGI24034J26672_10000018
409 JGI24742J22300_10000919
410 JGI24751J29686_10003746
411 Ga0055536_1010706
412 Ga0065165_1040526
413 Ga0065707_10082427
414 Ga0070658_10023949
415 Ga0070676_10449750
416 Ga0070690_100000008
417 Ga0070690_100028084
418 Ga0070670_100064015
419 Ga0070666_10000032
420 Ga0070666_10410314
421 Ga0070680_100806345
422 Ga0070682_100034306
423 Ga0068868_100000162
424 Ga0070660_100001623
425 Ga0070689_100003709
426 Ga0070689_100161168
427 Ga0070691_10000082
428 Ga0070661_100149774
429 Ga0070661_100306108
430 Ga0070669_100000211
431 Ga0070675_100022520
432 Ga0070675_100377853
433 Ga0070671_100007827
434 Ga0070671_100010137
435 Ga0070674_100027278
436 Ga0070673_100014748
437 Ga0070673_100670426
438 Ga0070688_100029160
439 Ga0070659_100000022
440 Ga0070659_100075727
441 Ga0070659_100193173
442 Ga0070667_100000174
443 Ga0070667_100013233
444 Ga0070709_10000238
445 Ga0070709_10062345
446 Ga0070714_100031391
447 Ga0070713_100000011
448 Ga0070710_10160155
449 Ga0070711_100103191
450 Ga0070711_100414096
451 Ga0070705_100386918
452 Ga0070700_100344220
453 Ga0070663_100045783
454 Ga0070663_100518954
455 Ga0070678_100059215
456 Ga0070662_100065344
457 Ga0070662_100159125
458 Ga0070681_10324873
459 Ga0070685_10000046
460 Ga0070699_100660773
461 Ga0070679_100912222
462 Ga0068853_100007449
463 Ga0070672_100009120
464 Ga0070686_100000030
465 Ga0070686_100038761
466 Ga0070695_100155517
467 Ga0070693_100155792
468 Ga0070665_100000056
469 Ga0068855_100026889
470 Ga0068855_100348908
471 Ga0068855_100455943
472 Ga0070664_100123448
473 Ga0070664_100855998
474 Ga0068857_100005182
475 Ga0068857_100073890
476 Ga0068857_101702385
477 Ga0068854_100350332
478 Ga0068854_100447106
479 Ga0068856_100000964
480 Ga0068856_100003424
481 Ga0068852_100005817
482 Ga0068852_100006345
483 Ga0068852_101103897
484 Ga0068859_100003975
485 Ga0068859_101601715
486 Ga0068864_100002649
487 Ga0068866_10004832
488 Ga0068851_10283834
489 Ga0068863_100000065
490 Ga0068863_100005004
491 Ga0068863_100186877
492 Ga0068858_100004454
493 Ga0068858_100082795
494 Ga0068858_100138308
495 Ga0068860_100000125
496 Ga0068860_100000132
497 Ga0068860_100069822
498 Ga0068862_100000356
499 Ga0081455_10000100
500 Ga0081539_10006046
501 Ga0081539_10072820
502 Ga0070716_100025826
503 Ga0070712_100000014
504 Ga0068871_100060412
505 Ga0068871_100559984
506 Ga0075434_100069363
507 Ga0075429_100839356
508 Ga0068865_100852338
509 Ga0075436_100000047
510 Ga0075436_100031385
511 Ga0097620_100003975
512 Ga0097620_101601691
513 Ga0105251_10334723
514 Ga0105240_10000355
515 Ga0105245_10072879
516 Ga0105245_10265011
517 Ga0105245_11484915
518 Ga0105243_10310432
519 Ga0105241_10028509
520 Ga0105241_10134107
521 Ga0105242_10025554
522 Ga0105237_10008237
523 Ga0105237_10169571
524 Ga0105238_10011985
525 Ga0105238_10048182
526 Ga0105238_10174577
527 Ga0105249_10000109
528 Ga0105239_10072584
529 Ga0157373_10003903
530 Ga0157373_10031878
531 Ga0157371_10118561
532 Ga0157370_10000280
533 Ga0157370_10043038
534 Ga0157369_10004867
535 Ga0157369_10054572
536 Ga0157369_10131948
537 Ga0157374_10028010
538 Ga0157378_10369347
539 Ga0157378_10985069
540 Ga0163162_10205121
541 Ga0157372_10008076
542 Ga0157372_10334299
543 Ga0157375_12004981
544 Ga0163163_10007312
545 Ga0163163_10077061
546 Ga0157380_10000599
547 Ga0157380_10002112
548 Ga0157379_10001288
549 Ga0157376_11644970
550 Ga0163161_10000084
551 Ga0207672_1000884
552 Ga0209257_1001814
553 Ga0209257_1019121
554 Ga0207656_10128972
555 Ga0207642_10095611
556 Ga0207680_10000009
557 Ga0207680_10013590
558 Ga0207680_10013885
559 Ga0207647_10003328
560 Ga0207699_10000233
561 Ga0207699_10050030
562 Ga0207645_10102290
563 Ga0207645_10495365
564 Ga0207705_10102930
565 Ga0207705_10695683
566 Ga0207654_10008410
567 Ga0207654_10028143
568 Ga0207695_10012890
569 Ga0207695_10016906
570 Ga0207671_10007095
571 Ga0207671_10074643
572 Ga0207693_10000018
573 Ga0207663_10075064
574 Ga0207660_10594779
575 Ga0207657_10000790
576 Ga0207657_10009096
577 Ga0207657_10073681
578 Ga0207649_10049434
579 Ga0207649_10171134
580 Ga0207681_10000965
581 Ga0207694_10015428
582 Ga0207694_10021944
583 Ga0207694_10136219
584 Ga0207694_10429361
585 Ga0207650_10016957
586 Ga0207659_10201581
587 Ga0207687_10092778
588 Ga0207687_10498378
589 Ga0207700_10000005
590 Ga0207664_10014515
591 Ga0207644_10003132
592 Ga0207644_10003709
593 Ga0207690_10000003
594 Ga0207706_10003953
595 Ga0207706_10006178
596 Ga0207686_10255067
597 Ga0207709_10124670
598 Ga0207669_10256862
599 Ga0207704_10007995
600 Ga0207665_10187854
601 Ga0207691_10007876
602 Ga0207711_10004290
603 Ga0207711_10015796
604 Ga0207711_10095398
605 Ga0207667_10007703
606 Ga0207667_10033129
607 Ga0207667_10044656
608 Ga0207651_10001472
609 Ga0207712_10000046
610 Ga0207640_10005766
611 Ga0207640_10077463
612 Ga0207640_10543904
613 Ga0207658_10000122
614 Ga0207658_10000784
615 Ga0207677_10000154
616 Ga0207677_10045368
617 Ga0207703_10006409
618 Ga0207703_10069636
619 Ga0207703_10142848
620 Ga0207639_10034142
621 Ga0207639_10053943
622 Ga0207678_10043007
623 Ga0207702_10000173
624 Ga0207702_10001080
625 Ga0207702_10008430
626 Ga0207702_10019757
627 Ga0207641_10000063
628 Ga0207641_10000956
629 Ga0207641_10023493
630 Ga0207648_10007110
631 Ga0207676_10008003
632 Ga0207676_10442561
633 Ga0207676_11798346
634 Ga0207674_10000112
635 Ga0207674_10005308
636 Ga0207674_10351836
637 Ga0207675_100000167
638 Ga0207683_10005286
639 Ga0207698_10007028
640 Ga0207698_10056097
641 Ga0207698_10113714
642 Ga0207698_10412971
643 Ga0209974_10024148
644 Ga0268266_10000066
645 Ga0268265_10000129
646 Ga0268264_10000130
647 Ga0268264_10000166
648 Ga0268264_10421459
649 Ga0307517_10150311
650 Ga0307405_10064076
651 Ga0307413_10329982
652 Ga0307406_10028951
653 Ga0307406_10923357
654 Ga0307406_11195193
655 Ga0307412_10000433
656 Ga0307412_10347511
657 Ga0307416_100021407
658 Ga0307416_101230752
659 Ga0307414_10000107
660 Ga0307414_10006362
661 Ga0307414_10050595
662 Ga0307414_10132154
663 Ga0373948_0032511
664 Ga0373944_0153296
665 Ga0373923_0026149
666 Ga0373932_0286404
667 Ga0373939_0022647
668 Ga0373960_0064719
669 Ga0373960_0167451
670 Ga0373943_0027114
671 Ga0373946_0065754
672 Ga0373955_0118921
673 Ga0373961_0052734
674 Ga0373931_0004731
675 Ga0373931_0025071
676 Ga0373931_0525813
677 Ga0373935_0018767
678 Ga0373927_0071028
679 Ga0373947_0042524
680 Ga0373937_0006814
681 Ga0373925_0004938
682 Ga0373925_0050470
683 Ga0395898_1904410
684 Ga0237819_00490
685 Ga0439436_0051358
686 Ga0439465_0002948
687 Ga0451793_0043240
688 Ga0450920_051270
689 Ga0439446_0026382
690 Ga0466969_0222273
691 Ga0466972_0033466
692 Ga0466972_0087207
693 Ga0466965_0209449
694 Ga0466968_0008164
695 Ga0466970_0030289
696 Ga0466957_0038061
697 Ga0466960_0028712
698 Ga0466958_0242830
699 Ga0466967_0282019
700 Ga0495617_028742
701 Ga0495638_0000097
702 Ga0495638_0000388
703 Ga0495583_0000252
704 Ga0495632_0036482
705 Ga0495648_0000308
706 Ga0495663_0267116
707 Ga0495654_0002162
708 Ga0495654_0204774
709 Ga0495622_0071665
710 Ga0495633_0013089
711 Ga0495668_0004479
712 Ga0495668_0054988
713 Ga0495623_0097454
714 Ga0495670_0001796
715 Ga0495671_0000011
716 Ga0495673_0000013
717 Ga0495686_0000600
718 Ga0495686_0001038
719 Ga0495686_0478189
720 Ga0496100_0004354
721 Ga0496101_0003296
722 Ga0496102_0022699
723 Ga0496102_0052927
724 Ga0496103_0000788
725 Ga0496103_0010484
726 Ga0496103_0915416
727 Ga0496104_0077669
728 Ga0496105_0007221
729 Ga0496105_0065920
730 Ga0496107_0001984
731 Ga0496107_0034230
732 Ga0496108_0009981
733 Ga0496109_0049473
734 Ga0496110_0003761
735 Ga0496110_0175203
736 Ga0496111_0002605
737 Ga0496111_0176978
738 Ga0496112_0383313
739 Ga0496113_0001095
740 Ga0496113_0649400
741 Ga0496116_0033612
742 Ga0496117_0032474
743 Ga0496118_0033498
744 Ga0496118_0313063
745 Ga0496119_0051965
746 Ga0496121_0151451
747 Ga0496123_0036795
748 Ga0496123_0197463
749 Ga0496124_0000354
750 Ga0496124_0001620
751 Ga0496125_0023673
752 Ga0496126_0108609
753 Ga0495678_113016
754 Ga0501290_002714
755 Ga0501293_005651
756 Ga0501300_010242
757 Ga0501034_0001454
758 Ga0501037_0488306
759 Ga0501039_0946047
760 Ga0501223_006424
761 Ga0501257_000041
762 Ga0501262_056082
763 Ga0501280_002333
764 Ga0501035_0673937
765 nmdc:mga09592_581981_c1
766 nmdc:mga0n895_49358_c1
767 nmdc:mga0rr50_32040_c1
768 nmdc:mga08x19_121884_c1
769 nmdc:mga08x19_62_c1
770 Ga0500643_001588
771 Ga0500643_001702
772 Ga0500643_001704
773 Ga0500592_000806
774 Ga0500592_001986
775 Ga0500594_0002307
776 Ga0500658_0001454
777 Ga0500658_0074738
778 Ga0500604_0011955
779 Ga0500604_0043677
780 Ga0500627_0000115
781 Ga0500627_0008572
782 Ga0500627_0020635
783 Ga0500627_0261935
784 Ga0500596_024779
785 Ga0466962_0204719
786 2643833074
787 2644053131
788 2819715603
789 2879163728
790 2928970889
791 2990267870
792 2993697112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02600

DsbB

Disulfide bond formation protein DsbB

24

171

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p3u-assembly1.cif.gz_F homomeric glua1 in tandem with tarp gamma-3, desensitized conformation 2 0.7402 36 154
6qkz-assembly1.cif.gz_J full length glua1/2-gamma8 complex 0.7162 36 154
8c1p-assembly1.cif.gz_H active state homomeric glua1 ampa receptor in complex with tarp gamma 3 0.7079 36 154
8c2h-assembly1.cif.gz_F transmembrane domain of active state homomeric glua1 ampa receptor in tandem with tarp gamma 3 0.7073 36 154
2rld-assembly1.cif.gz_D crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.7047 5 89
ID Description Score Start End Superfamily
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.729 1 150 1.20.1550.10
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7117 1 150 1.20.1550.10
2rldD00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.7049 5 89 1.20.1440.60
af_A0A0B4LHK8_82_258_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6774 36 154 1.20.140.150
2zuqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.6758 1 150 1.20.1550.10
ID Description Score Start End GO Terms
AF-A0A521T1B5-F1-model_v4 deleted 0.973 1 97
AF-A0A521T1B5-F1-model_v4 deleted 0.9632 1 97
AF-A0A7G6XZX5-F1-model_v4 Disulfide bond formation protein B 0.9573 1 156 GO:0006457
GO:0015035
GO:0016020
AF-A0A1E3LWW8-F1-model_v4 Disulfide bond formation protein 0.9572 20 154 GO:0006457
GO:0015035
GO:0016020
AF-A0A6N0X0Z7-F1-model_v4 Disulfide bond formation protein B 0.9535 3 152 GO:0006457
GO:0015035
GO:0016020

Map