F433478

General Info

Members Datasets Scaffolds Average Seq Length
396 181 792 266

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10075128|Ga0075433_100751283
Length 311
Sequence MSLLPARLLPEIGHTGPGHPVPSHRQEAARPMTRRHFSLAALTLLLAVGSAAAQTPGPRTLILSTTTSTQDSGLLEVLVPMFEQATGYSVKTISVGTGQALALAARGEADVTLAHAPALEKKYVEEGKMLNRRLVMYNDFVVIGPADDPARVKGLPAAAALQRIAAASARFVSRGDKSGTHLLEQALWKQAGLEPRGGWYIESGQGMGQTLLIANERKAYTLTDRGTYLAFQKRVDLPILVERDRPLLNIYSVMEVNPANGPRVNAAAGKAFADFMLLPAVQAVIKTFGVDKYGQALFVPIVGQREEEVGG

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
134 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
135 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.01
Rhizosphere 98.99
Stem 0
Stem Tuber 0
Unclassified 5.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10075128 3300006852 Bacteria 2974
2 Ga0065715_10026501 3300005293 Unclassified 1959
3 Ga0065707_10145257 3300005295 Bacteria 1722
4 Ga0070676_10000126 3300005328 Bacteria 28490
5 Ga0070683_100480673 3300005329 Bacteria 1186
6 Ga0070670_100001200 3300005331 Bacteria 20555
7 Ga0070677_10007352 3300005333 Bacteria 3673
8 Ga0068869_100000238 3300005334 Bacteria 29008
9 Ga0070680_100365885 3300005336 Bacteria 1227
10 Ga0070682_100000182 3300005337 Bacteria 47152
11 Ga0070660_100001568 3300005339 Bacteria 15721
12 Ga0070661_100004797 3300005344 Bacteria 9314
13 Ga0070692_10000190 3300005345 Bacteria 16282
14 Ga0070669_100150454 3300005353 Bacteria 1801
15 Ga0070659_100002824 3300005366 Bacteria 12359
16 Ga0070667_100067287 3300005367 Bacteria 3045
17 Ga0070703_10010515 3300005406 Bacteria 2610
18 Ga0070701_10011201 3300005438 Bacteria 3999
19 Ga0070711_100008551 3300005439 Bacteria 6275
20 Ga0070711_100169694 3300005439 Bacteria 1662
21 Ga0070705_100000328 3300005440 Bacteria 28122
22 Ga0070705_100034506 3300005440 Bacteria 2829
23 Ga0070705_100043435 3300005440 Bacteria 2576
24 Ga0070705_100065380 3300005440 Bacteria 2177
25 Ga0070700_100043496 3300005441 Bacteria 2763
26 Ga0070694_100000209 3300005444 Bacteria 30924
27 Ga0070694_100004892 3300005444 Bacteria 8071
28 Ga0070694_100006391 3300005444 Bacteria 7148
29 Ga0070694_100174570 3300005444 Bacteria 1585
30 Ga0070708_100005693 3300005445 Bacteria 9886
31 Ga0070708_100048187 3300005445 Bacteria 3766
32 Ga0070708_100112067 3300005445 Bacteria 2508
33 Ga0070708_100187324 3300005445 Bacteria 1935
34 Ga0070708_100321178 3300005445 Bacteria 1458
35 Ga0070663_100004982 3300005455 Bacteria 7843
36 Ga0070662_100006041 3300005457 Bacteria 7773
37 Ga0070662_100192192 3300005457 Unclassified 1615
38 Ga0068867_100002020 3300005459 Bacteria 14184
39 Ga0068867_100039731 3300005459 Bacteria 3431
40 Ga0070706_100002098 3300005467 Bacteria 20324
41 Ga0070706_100016925 3300005467 Bacteria 6736
42 Ga0070706_100038751 3300005467 Bacteria 4398
43 Ga0070706_100107074 3300005467 Bacteria 2601
44 Ga0070706_100249178 3300005467 Bacteria 1658
45 Ga0070707_100010438 3300005468 Bacteria 8650
46 Ga0070707_100027429 3300005468 Bacteria 5419
47 Ga0070707_100174109 3300005468 Bacteria 2097
48 Ga0070707_100186344 3300005468 Bacteria 2023
49 Ga0070707_100265731 3300005468 Bacteria 1669
50 Ga0070707_100364216 3300005468 Unclassified 1404
51 Ga0070698_100015851 3300005471 Bacteria 7960
52 Ga0070698_100019836 3300005471 Bacteria 7052
53 Ga0070698_100152300 3300005471 Bacteria 2260
54 Ga0070699_100052059 3300005518 Bacteria 3544
55 Ga0070697_100101729 3300005536 Bacteria 2387
56 Ga0070697_100111271 3300005536 Bacteria 2283
57 Ga0068853_100000088 3300005539 Bacteria 63120
58 Ga0070672_100021627 3300005543 Bacteria 4711
59 Ga0070672_100145516 3300005543 Unclassified 1958
60 Ga0070695_100007057 3300005545 Bacteria 6657
61 Ga0070695_100013760 3300005545 Bacteria 4863
62 Ga0070695_100023414 3300005545 Bacteria 3795
63 Ga0070696_100000509 3300005546 Bacteria 24585
64 Ga0070696_100018019 3300005546 Bacteria 4769
65 Ga0070696_100025324 3300005546 Bacteria 4033
66 Ga0070693_100001102 3300005547 Bacteria 12134
67 Ga0070704_100009405 3300005549 Bacteria 5902
68 Ga0070704_100030227 3300005549 Bacteria 3628
69 Ga0070704_100141994 3300005549 Bacteria 1876
70 Ga0070704_100259444 3300005549 Bacteria 1431
71 Ga0070704_100541820 3300005549 Bacteria 1016
72 Ga0068855_100001149 3300005563 Bacteria 32772
73 Ga0070664_100002679 3300005564 Bacteria 14368
74 Ga0068854_100001700 3300005578 Bacteria 13390
75 Ga0068856_100010202 3300005614 Bacteria 9133
76 Ga0068859_100000533 3300005617 Bacteria 37712
77 Ga0068859_100330792 3300005617 Bacteria 1618
78 Ga0068861_100026253 3300005719 Bacteria 4234
79 Ga0068861_100068972 3300005719 Bacteria 2734
80 Ga0068870_10001187 3300005840 Bacteria 10447
81 Ga0068860_100019302 3300005843 Bacteria 6615
82 Ga0068860_100106832 3300005843 Bacteria 2674
83 Ga0068862_100000415 3300005844 Bacteria 46252
84 Ga0068862_100006356 3300005844 Bacteria 9825
85 Ga0068862_100053025 3300005844 Bacteria 3472
86 Ga0068862_100197165 3300005844 Bacteria 1814
87 Ga0081455_10006256 3300005937 Bacteria 12815
88 Ga0081538_10011090 3300005981 Bacteria 7327
89 Ga0070716_100012451 3300006173 Bacteria 4313
90 Ga0075428_100007592 3300006844 Bacteria 12020
91 Ga0075431_100026387 3300006847 Bacteria 5961
92 Ga0075431_100238170 3300006847 Bacteria 1852
93 Ga0075433_10001912 3300006852 Bacteria 15674
94 Ga0075433_10008512 3300006852 Bacteria 8184
95 Ga0075433_10015207 3300006852 Bacteria 6307
96 Ga0075433_10139022 3300006852 Bacteria 2159
97 Ga0075434_100002858 3300006871 Bacteria 15313
98 Ga0075434_100024753 3300006871 Bacteria 5870
99 Ga0075434_100076392 3300006871 Bacteria 3344
100 Ga0075434_100118327 3300006871 Bacteria 2663
101 Ga0075434_100170843 3300006871 Bacteria 2194
102 Ga0075434_100227663 3300006871 Unclassified 1884
103 Ga0075434_100564478 3300006871 Unclassified 1158
104 Ga0075429_100089542 3300006880 Bacteria 2682
105 Ga0075429_100548594 3300006880 Bacteria 1013
106 Ga0068865_100326623 3300006881 Bacteria 1236
107 Ga0075436_100196069 3300006914 Bacteria 1430
108 Ga0075436_100269530 3300006914 Unclassified 1216
109 Ga0097620_100000533 3300006931 Bacteria 37712
110 Ga0097620_100330815 3300006931 Bacteria 1618
111 Ga0075435_100002883 3300007076 Bacteria 11530
112 Ga0075435_100005148 3300007076 Bacteria 9091
113 Ga0075435_100031437 3300007076 Unclassified 4182
114 Ga0075435_100306318 3300007076 Bacteria 1359
115 Ga0111539_10000758 3300009094 Bacteria 42005
116 Ga0111539_10006805 3300009094 Bacteria 14702
117 Ga0114129_10001800 3300009147 Bacteria 29212
118 Ga0114129_10004921 3300009147 Bacteria 18854
119 Ga0114129_10068881 3300009147 Bacteria 4932
120 Ga0114129_10091365 3300009147 Bacteria 4218
121 Ga0114129_10402755 3300009147 Bacteria 1803
122 Ga0114129_10485672 3300009147 Unclassified 1615
123 Ga0105243_10106840 3300009148 Bacteria 2334
124 Ga0105241_10000634 3300009174 Bacteria 26487
125 Ga0105242_10019077 3300009176 Bacteria 5373
126 Ga0105242_10174832 3300009176 Bacteria 1890
127 Ga0105248_10372774 3300009177 Bacteria 1607
128 Ga0105248_10587649 3300009177 Bacteria 1256
129 Ga0105237_10116237 3300009545 Bacteria 2668
130 Ga0105249_10445469 3300009553 Bacteria 1333
131 Ga0105249_10686191 3300009553 Bacteria 1083
132 Ga0157373_10001560 3300013100 Bacteria 17491
133 Ga0157371_10160717 3300013102 Bacteria 1604
134 Ga0157369_10015774 3300013105 Bacteria 8513
135 Ga0163162_10373919 3300013306 Bacteria 1558
136 Ga0157372_10000370 3300013307 Bacteria 49961
137 Ga0157372_10143207 3300013307 Bacteria 2756
138 Ga0157375_10020727 3300013308 Bacteria 6014
139 Ga0207653_10022593 3300025885 Bacteria 1999
140 Ga0207682_10052057 3300025893 Unclassified 1697
141 Ga0207642_10090842 3300025899 Bacteria 1508
142 Ga0207688_10029846 3300025901 Bacteria 3005
143 Ga0207647_10095392 3300025904 Bacteria 1771
144 Ga0207645_10001710 3300025907 Bacteria 17807
145 Ga0207645_10182380 3300025907 Bacteria 1377
146 Ga0207643_10000350 3300025908 Bacteria 31013
147 Ga0207684_10001728 3300025910 Bacteria 23120
148 Ga0207684_10003866 3300025910 Bacteria 14386
149 Ga0207684_10027161 3300025910 Bacteria 4881
150 Ga0207684_10083279 3300025910 Bacteria 2724
151 Ga0207684_10111875 3300025910 Bacteria 2337
152 Ga0207684_10205253 3300025910 Bacteria 1700
153 Ga0207654_10004002 3300025911 Bacteria 7420
154 Ga0207707_10000076 3300025912 Bacteria 100491
155 Ga0207663_10106803 3300025916 Bacteria 1893
156 Ga0207660_10000022 3300025917 Bacteria 72537
157 Ga0207657_10000005 3300025919 Bacteria 213481
158 Ga0207649_10033780 3300025920 Bacteria 3059
159 Ga0207652_10000060 3300025921 Bacteria 113511
160 Ga0207646_10007569 3300025922 Bacteria 11005
161 Ga0207646_10015559 3300025922 Bacteria 7181
162 Ga0207646_10020883 3300025922 Bacteria 6059
163 Ga0207646_10038243 3300025922 Bacteria 4324
164 Ga0207646_10085879 3300025922 Bacteria 2815
165 Ga0207646_10110871 3300025922 Bacteria 2462
166 Ga0207646_10254370 3300025922 Unclassified 1587
167 Ga0207646_10343147 3300025922 Bacteria 1349
168 Ga0207681_10413549 3300025923 Bacteria 1091
169 Ga0207659_10325937 3300025926 Bacteria 1268
170 Ga0207690_10001135 3300025932 Bacteria 16956
171 Ga0207706_10001227 3300025933 Bacteria 25935
172 Ga0207686_10100204 3300025934 Bacteria 1932
173 Ga0207709_10082796 3300025935 Bacteria 2073
174 Ga0207709_10174275 3300025935 Bacteria 1512
175 Ga0207665_10010469 3300025939 Bacteria 6094
176 Ga0207691_10031985 3300025940 Bacteria 4909
177 Ga0207691_10085519 3300025940 Unclassified 2830
178 Ga0207711_10172288 3300025941 Bacteria 1964
179 Ga0207689_10000423 3300025942 Bacteria 39658
180 Ga0207689_10018904 3300025942 Bacteria 5811
181 Ga0207661_10162796 3300025944 Bacteria 1937
182 Ga0207667_10004015 3300025949 Bacteria 18085
183 Ga0207640_10000757 3300025981 Bacteria 18461
184 Ga0207658_10025673 3300025986 Bacteria 4126
185 Ga0207703_10042723 3300026035 Bacteria 3637
186 Ga0207639_10000492 3300026041 Bacteria 27306
187 Ga0207678_10048822 3300026067 Bacteria 3658
188 Ga0207702_10000576 3300026078 Bacteria 40802
189 Ga0207648_10003731 3300026089 Bacteria 15933
190 Ga0207648_10039862 3300026089 Bacteria 4129
191 Ga0207674_10000075 3300026116 Bacteria 105297
192 Ga0207675_100012761 3300026118 Bacteria 7850
193 Ga0207675_100130254 3300026118 Bacteria 2385
194 Ga0209968_1001412 3300027526 Bacteria 3634
195 Ga0209999_1000474 3300027543 Bacteria 6208
196 Ga0209970_1000578 3300027614 Bacteria 6372
197 Ga0209983_1002249 3300027665 Bacteria 4245
198 Ga0209971_1000016 3300027682 Bacteria 65564
199 Ga0209971_1016630 3300027682 Bacteria 1744
200 Ga0209966_1000083 3300027695 Bacteria 41039
201 Ga0209998_10000121 3300027717 Bacteria 30879
202 Ga0209974_10013040 3300027876 Bacteria 2772
203 Ga0209974_10070395 3300027876 Bacteria 1193
204 Ga0207428_10000553 3300027907 Bacteria 44382
205 Ga0207428_10005638 3300027907 Bacteria 11640
206 Ga0268265_10011929 3300028380 Bacteria 5879
207 Ga0268264_10002546 3300028381 Bacteria 15985
208 Ga0268264_10086519 3300028381 Bacteria 2693
209 Ga0307408_100013212 3300031548 Bacteria 5481
210 Ga0307408_100053809 3300031548 Bacteria 2908
211 Ga0307405_10352898 3300031731 Bacteria 1135
212 Ga0307406_10185276 3300031901 Bacteria 1519
213 Ga0307412_10163860 3300031911 Bacteria 1655
214 Ga0307416_100119187 3300032002 Bacteria 2347
215 Ga0307411_10005436 3300032005 Bacteria 6257
216 Ga0307415_100496271 3300032126 Bacteria 1066
217 Ga0373949_0022626 3300035090 Bacteria 1451
218 Ga0373939_0017083 3300035114 Bacteria 1923
219 Ga0373961_0001828 3300035241 Bacteria 5832
220 Ga0439448_0001406 3300042005 Bacteria 6206
221 Ga0439450_004459 3300042008 Bacteria 2391
222 Ga0439455_0002215 3300042012 Bacteria 3483
223 Ga0439459_0000182 3300042438 Bacteria 6765
224 Ga0439464_0022934 3300042439 Bacteria 1722
225 Ga0439460_0002605 3300042461 Bacteria 4357
226 Ga0451577_0004590 3300042876 Bacteria 14514
227 Ga0451577_0063649 3300042876 Bacteria 3289
228 Ga0451577_0215940 3300042876 Bacteria 1733
229 Ga0451577_0330883 3300042876 Bacteria 1382
230 Ga0453683_0007170 3300044673 Bacteria 7595
231 Ga0453683_0029046 3300044673 Bacteria 3499
232 Ga0453683_0039380 3300044673 Bacteria 2971
233 Ga0453684_0043679 3300044712 Bacteria 6019
234 Ga0453684_0098665 3300044712 Bacteria 3580
235 Ga0453684_0247638 3300044712 Unclassified 2048
236 Ga0453684_0297323 3300044712 Bacteria 1836
237 Ga0451576_0000853 3300045051 Bacteria 59154
238 Ga0451576_0025466 3300045051 Bacteria 6373
239 Ga0451576_0029253 3300045051 Bacteria 5896
240 Ga0451576_0030560 3300045051 Bacteria 5755
241 Ga0451576_0077486 3300045051 Bacteria 3459
242 Ga0451576_0245106 3300045051 Bacteria 1872
243 Ga0451576_0642088 3300045051 Bacteria 1115
244 Ga0495580_0121816 3300046472 Bacteria 1810
245 Ga0495580_0289183 3300046472 Bacteria 1117
246 Ga0496107_0038222 3300048910 Bacteria 3445
247 Ga0496108_0350227 3300048911 Unclassified 1289
248 Ga0496109_0253244 3300048912 Unclassified 1658
249 Ga0496110_0198446 3300048913 Unclassified 1823
250 Ga0501032_0485486 3300049569 Bacteria 790
251 Ga0501033_0022791 3300049570 Bacteria 4721
252 Ga0501036_0014230 3300049572 Bacteria 6620
253 Ga0501036_0069752 3300049572 Bacteria 2973
254 Ga0501036_0429756 3300049572 Bacteria 1101
255 Ga0501037_0314563 3300049573 Bacteria 1085
256 Ga0501038_0002163 3300049574 Bacteria 18264
257 Ga0501038_0087092 3300049574 Bacteria 2623
258 Ga0501038_0238848 3300049574 Bacteria 1443
259 Ga0501039_0083144 3300049575 Bacteria 2493
260 Ga0501039_0165932 3300049575 Bacteria 1736
261 Ga0501040_0010773 3300049576 Bacteria 5977
262 Ga0501040_0010904 3300049576 Bacteria 5943
263 Ga0501040_0038600 3300049576 Bacteria 3247
264 Ga0501040_0047991 3300049576 Bacteria 2917
265 Ga0501040_0070486 3300049576 Bacteria 2412
266 Ga0501040_0115854 3300049576 Bacteria 1876
267 Ga0501040_0352544 3300049576 Bacteria 1054
268 Ga0501040_0453168 3300049576 Bacteria 923
269 Ga0501041_0002832 3300049577 Bacteria 9915
270 Ga0501041_0007674 3300049577 Bacteria 6338
271 Ga0501041_0013921 3300049577 Bacteria 4770
272 Ga0501041_0105145 3300049577 Bacteria 1749
273 Ga0501042_0023313 3300049578 Bacteria 4330
274 Ga0501042_0044855 3300049578 Bacteria 3150
275 Ga0501042_0077351 3300049578 Bacteria 2382
276 Ga0501042_0104468 3300049578 Bacteria 2038
277 Ga0501043_0144333 3300049579 Bacteria 1864
278 Ga0501043_0318418 3300049579 Bacteria 1186
279 Ga0501043_0409225 3300049579 Bacteria 1024
280 Ga0501046_0000115 3300049580 Bacteria 84375
281 Ga0501046_0026184 3300049580 Bacteria 4764
282 Ga0501048_0019363 3300049582 Bacteria 4994
283 Ga0501048_0065579 3300049582 Bacteria 2567
284 Ga0501067_0007660 3300049583 Bacteria 6002
285 Ga0501068_0108831 3300049584 Bacteria 1722
286 Ga0501068_0247193 3300049584 Bacteria 1136
287 Ga0501069_0028189 3300049585 Bacteria 3079
288 Ga0501071_0091298 3300049587 Bacteria 2237
289 Ga0501071_0116846 3300049587 Bacteria 1975
290 Ga0501071_0172738 3300049587 Bacteria 1618
291 Ga0501072_0000632 3300049588 Bacteria 25204
292 Ga0501072_0080098 3300049588 Bacteria 2587
293 Ga0501072_0149023 3300049588 Bacteria 1865
294 Ga0501072_0193680 3300049588 Bacteria 1621
295 Ga0501074_0008162 3300049590 Bacteria 7590
296 Ga0501074_0033541 3300049590 Bacteria 3721
297 Ga0501074_0098640 3300049590 Bacteria 2091
298 Ga0501074_0260463 3300049590 Unclassified 1233
299 Ga0501075_0000002 3300049591 Bacteria 202033
300 Ga0501075_0024516 3300049591 Bacteria 4425
301 Ga0501075_0033925 3300049591 Bacteria 3798
302 Ga0501075_0044311 3300049591 Bacteria 3338
303 Ga0501075_0058960 3300049591 Bacteria 2891
304 Ga0501075_0093131 3300049591 Bacteria 2287
305 Ga0501075_0109426 3300049591 Bacteria 2101
306 Ga0501075_0153352 3300049591 Bacteria 1756
307 Ga0501076_0000077 3300049592 Bacteria 50012
308 Ga0501076_0015149 3300049592 Bacteria 5822
309 Ga0501076_0021375 3300049592 Bacteria 4963
310 Ga0501076_0032232 3300049592 Bacteria 4089
311 Ga0501076_0068180 3300049592 Bacteria 2841
312 Ga0501076_0085533 3300049592 Bacteria 2534
313 Ga0501077_0008787 3300049593 Bacteria 6270
314 Ga0501077_0013757 3300049593 Bacteria 5074
315 Ga0501077_0024902 3300049593 Bacteria 3800
316 Ga0501077_0060059 3300049593 Bacteria 2413
317 Ga0501077_0257716 3300049593 Bacteria 1109
318 Ga0501077_0343568 3300049593 Bacteria 952
319 Ga0501079_0002429 3300049741 Bacteria 13528
320 Ga0501079_0002671 3300049741 Bacteria 12960
321 Ga0501079_0006233 3300049741 Bacteria 8955
322 Ga0501079_0011740 3300049741 Bacteria 6690
323 Ga0501079_0024799 3300049741 Bacteria 4601
324 Ga0501079_0034899 3300049741 Bacteria 3871
325 Ga0501079_0042900 3300049741 Bacteria 3492
326 Ga0501079_0475282 3300049741 Bacteria 982
327 Ga0501080_0019588 3300049742 Bacteria 6269
328 Ga0501081_0002048 3300049743 Bacteria 12566
329 Ga0501081_0004046 3300049743 Bacteria 9397
330 Ga0501081_0006281 3300049743 Bacteria 7703
331 Ga0501081_0036044 3300049743 Bacteria 3371
332 Ga0501081_0053655 3300049743 Bacteria 2783
333 Ga0501081_0099148 3300049743 Bacteria 2058
334 Ga0501081_0113986 3300049743 Bacteria 1920
335 Ga0501081_0198595 3300049743 Bacteria 1454
336 Ga0501081_0245824 3300049743 Bacteria 1305
337 Ga0501081_0339164 3300049743 Unclassified 1107
338 Ga0501083_0044190 3300049744 Bacteria 3016
339 Ga0501083_0083518 3300049744 Bacteria 2116
340 Ga0501045_0033325 3300049824 Bacteria 3734
341 Ga0501045_0051912 3300049824 Bacteria 2992
342 Ga0501045_0061489 3300049824 Bacteria 2755
343 Ga0501045_0347173 3300049824 Bacteria 1104
344 nmdc:mga05p37_197613_c1 3300050507 Bacteria 2438
345 nmdc:mga05p37_215670_c1 3300050507 Bacteria 2318
346 nmdc:mga05p37_22422_c1 3300050507 Bacteria 7659
347 nmdc:mga05p37_33367_c1 3300050507 Bacteria 6305
348 nmdc:mga05p37_424176_c1 3300050507 Bacteria 1547
349 nmdc:mga05p37_55915_c1 3300050507 Bacteria 4858
350 nmdc:mga09592_554233_c1 3300050508 Bacteria 987
351 nmdc:mga06r32_244906_c1 3300050510 Bacteria 1780
352 nmdc:mga06r32_272475_c1 3300050510 Bacteria 1680
353 nmdc:mga06r32_79566_c2 3300050510 Bacteria 2130
354 nmdc:mga08y16_253845_c1 3300050511 Bacteria 1817
355 nmdc:mga08y16_7184_c1 3300050511 Bacteria 11688
356 nmdc:mga08y16_977_c1 3300050511 Bacteria 27869
357 nmdc:mga0n895_101685_c1 3300050512 Bacteria 2884
358 nmdc:mga0n895_170535_c1 3300050512 Bacteria 2208
359 nmdc:mga0n895_316386_c1 3300050512 Bacteria 1582
360 nmdc:mga0n895_354585_c1 3300050512 Unclassified 1486
361 nmdc:mga0n895_355525_c1 3300050512 Unclassified 1484
362 nmdc:mga0n895_366569_c1 3300050512 Bacteria 1459
363 nmdc:mga0n895_70272_c1 3300050512 Bacteria 3470
364 nmdc:mga0rr50_114750_c1 3300050513 Bacteria 2137
365 nmdc:mga0rr50_432174_c1 3300050513 Bacteria 1115
366 nmdc:mga0rr50_52599_c1 3300050513 Bacteria 3027
367 nmdc:mga0rr50_86525_c1 3300050513 Bacteria 2431
368 nmdc:mga08x19_141732_c1 3300050514 Bacteria 1624
369 nmdc:mga0a205_10953_c1 3300050515 Bacteria 8343
370 nmdc:mga0a205_18943_c1 3300050515 Bacteria 6485
371 nmdc:mga0a205_39357_c1 3300050515 Bacteria 4551
372 Ga0501084_0023031 3300054114 Bacteria 5200
373 Ga0501084_0024953 3300054114 Bacteria 4988
374 Ga0501084_0029241 3300054114 Bacteria 4609
375 Ga0501084_0033774 3300054114 Bacteria 4279
376 Ga0501084_0081740 3300054114 Bacteria 2710
377 Ga0501084_0122032 3300054114 Bacteria 2191
378 Ga0501084_0263971 3300054114 Unclassified 1454
379 Ga0501082_0001573 3300060353 Bacteria 20126
380 Ga0501082_0010461 3300060353 Bacteria 7983
381 Ga0501082_0014640 3300060353 Bacteria 6757
382 Ga0501082_0026623 3300060353 Bacteria 4985
383 Ga0501082_0045924 3300060353 Bacteria 3766
384 Ga0501082_0086521 3300060353 Bacteria 2704
385 Ga0501082_0227317 3300060353 Bacteria 1624
386 Ga0530510_0000001 3300061734 Bacteria 285623
387 Ga0530510_0000470 3300061734 Bacteria 25860
388 Ga0530510_0006447 3300061734 Bacteria 8173
389 Ga0530510_0009914 3300061734 Bacteria 6684
390 Ga0530510_0011897 3300061734 Bacteria 6106
391 Ga0530510_0028806 3300061734 Bacteria 3982
392 Ga0530510_0048583 3300061734 Bacteria 3067
393 Ga0530510_0061786 3300061734 Bacteria 2712
394 Ga0530510_0123197 3300061734 Bacteria 1904
395 Ga0530510_0238546 3300061734 Bacteria 1353
396 Ga0530510_0390644 3300061734 Bacteria 1048
397 Ga0075433_10075128
398 Ga0065715_10026501
399 Ga0065707_10145257
400 Ga0070676_10000126
401 Ga0070683_100480673
402 Ga0070670_100001200
403 Ga0070677_10007352
404 Ga0068869_100000238
405 Ga0070680_100365885
406 Ga0070682_100000182
407 Ga0070660_100001568
408 Ga0070661_100004797
409 Ga0070692_10000190
410 Ga0070669_100150454
411 Ga0070659_100002824
412 Ga0070667_100067287
413 Ga0070703_10010515
414 Ga0070701_10011201
415 Ga0070711_100008551
416 Ga0070711_100169694
417 Ga0070705_100000328
418 Ga0070705_100034506
419 Ga0070705_100043435
420 Ga0070705_100065380
421 Ga0070700_100043496
422 Ga0070694_100000209
423 Ga0070694_100004892
424 Ga0070694_100006391
425 Ga0070694_100174570
426 Ga0070708_100005693
427 Ga0070708_100048187
428 Ga0070708_100112067
429 Ga0070708_100187324
430 Ga0070708_100321178
431 Ga0070663_100004982
432 Ga0070662_100006041
433 Ga0070662_100192192
434 Ga0068867_100002020
435 Ga0068867_100039731
436 Ga0070706_100002098
437 Ga0070706_100016925
438 Ga0070706_100038751
439 Ga0070706_100107074
440 Ga0070706_100249178
441 Ga0070707_100010438
442 Ga0070707_100027429
443 Ga0070707_100174109
444 Ga0070707_100186344
445 Ga0070707_100265731
446 Ga0070707_100364216
447 Ga0070698_100015851
448 Ga0070698_100019836
449 Ga0070698_100152300
450 Ga0070699_100052059
451 Ga0070697_100101729
452 Ga0070697_100111271
453 Ga0068853_100000088
454 Ga0070672_100021627
455 Ga0070672_100145516
456 Ga0070695_100007057
457 Ga0070695_100013760
458 Ga0070695_100023414
459 Ga0070696_100000509
460 Ga0070696_100018019
461 Ga0070696_100025324
462 Ga0070693_100001102
463 Ga0070704_100009405
464 Ga0070704_100030227
465 Ga0070704_100141994
466 Ga0070704_100259444
467 Ga0070704_100541820
468 Ga0068855_100001149
469 Ga0070664_100002679
470 Ga0068854_100001700
471 Ga0068856_100010202
472 Ga0068859_100000533
473 Ga0068859_100330792
474 Ga0068861_100026253
475 Ga0068861_100068972
476 Ga0068870_10001187
477 Ga0068860_100019302
478 Ga0068860_100106832
479 Ga0068862_100000415
480 Ga0068862_100006356
481 Ga0068862_100053025
482 Ga0068862_100197165
483 Ga0081455_10006256
484 Ga0081538_10011090
485 Ga0070716_100012451
486 Ga0075428_100007592
487 Ga0075431_100026387
488 Ga0075431_100238170
489 Ga0075433_10001912
490 Ga0075433_10008512
491 Ga0075433_10015207
492 Ga0075433_10139022
493 Ga0075434_100002858
494 Ga0075434_100024753
495 Ga0075434_100076392
496 Ga0075434_100118327
497 Ga0075434_100170843
498 Ga0075434_100227663
499 Ga0075434_100564478
500 Ga0075429_100089542
501 Ga0075429_100548594
502 Ga0068865_100326623
503 Ga0075436_100196069
504 Ga0075436_100269530
505 Ga0097620_100000533
506 Ga0097620_100330815
507 Ga0075435_100002883
508 Ga0075435_100005148
509 Ga0075435_100031437
510 Ga0075435_100306318
511 Ga0111539_10000758
512 Ga0111539_10006805
513 Ga0114129_10001800
514 Ga0114129_10004921
515 Ga0114129_10068881
516 Ga0114129_10091365
517 Ga0114129_10402755
518 Ga0114129_10485672
519 Ga0105243_10106840
520 Ga0105241_10000634
521 Ga0105242_10019077
522 Ga0105242_10174832
523 Ga0105248_10372774
524 Ga0105248_10587649
525 Ga0105237_10116237
526 Ga0105249_10445469
527 Ga0105249_10686191
528 Ga0157373_10001560
529 Ga0157371_10160717
530 Ga0157369_10015774
531 Ga0163162_10373919
532 Ga0157372_10000370
533 Ga0157372_10143207
534 Ga0157375_10020727
535 Ga0207653_10022593
536 Ga0207682_10052057
537 Ga0207642_10090842
538 Ga0207688_10029846
539 Ga0207647_10095392
540 Ga0207645_10001710
541 Ga0207645_10182380
542 Ga0207643_10000350
543 Ga0207684_10001728
544 Ga0207684_10003866
545 Ga0207684_10027161
546 Ga0207684_10083279
547 Ga0207684_10111875
548 Ga0207684_10205253
549 Ga0207654_10004002
550 Ga0207707_10000076
551 Ga0207663_10106803
552 Ga0207660_10000022
553 Ga0207657_10000005
554 Ga0207649_10033780
555 Ga0207652_10000060
556 Ga0207646_10007569
557 Ga0207646_10015559
558 Ga0207646_10020883
559 Ga0207646_10038243
560 Ga0207646_10085879
561 Ga0207646_10110871
562 Ga0207646_10254370
563 Ga0207646_10343147
564 Ga0207681_10413549
565 Ga0207659_10325937
566 Ga0207690_10001135
567 Ga0207706_10001227
568 Ga0207686_10100204
569 Ga0207709_10082796
570 Ga0207709_10174275
571 Ga0207665_10010469
572 Ga0207691_10031985
573 Ga0207691_10085519
574 Ga0207711_10172288
575 Ga0207689_10000423
576 Ga0207689_10018904
577 Ga0207661_10162796
578 Ga0207667_10004015
579 Ga0207640_10000757
580 Ga0207658_10025673
581 Ga0207703_10042723
582 Ga0207639_10000492
583 Ga0207678_10048822
584 Ga0207702_10000576
585 Ga0207648_10003731
586 Ga0207648_10039862
587 Ga0207674_10000075
588 Ga0207675_100012761
589 Ga0207675_100130254
590 Ga0209968_1001412
591 Ga0209999_1000474
592 Ga0209970_1000578
593 Ga0209983_1002249
594 Ga0209971_1000016
595 Ga0209971_1016630
596 Ga0209966_1000083
597 Ga0209998_10000121
598 Ga0209974_10013040
599 Ga0209974_10070395
600 Ga0207428_10000553
601 Ga0207428_10005638
602 Ga0268265_10011929
603 Ga0268264_10002546
604 Ga0268264_10086519
605 Ga0307408_100013212
606 Ga0307408_100053809
607 Ga0307405_10352898
608 Ga0307406_10185276
609 Ga0307412_10163860
610 Ga0307416_100119187
611 Ga0307411_10005436
612 Ga0307415_100496271
613 Ga0373949_0022626
614 Ga0373939_0017083
615 Ga0373961_0001828
616 Ga0439448_0001406
617 Ga0439450_004459
618 Ga0439455_0002215
619 Ga0439459_0000182
620 Ga0439464_0022934
621 Ga0439460_0002605
622 Ga0451577_0004590
623 Ga0451577_0063649
624 Ga0451577_0215940
625 Ga0451577_0330883
626 Ga0453683_0007170
627 Ga0453683_0029046
628 Ga0453683_0039380
629 Ga0453684_0043679
630 Ga0453684_0098665
631 Ga0453684_0247638
632 Ga0453684_0297323
633 Ga0451576_0000853
634 Ga0451576_0025466
635 Ga0451576_0029253
636 Ga0451576_0030560
637 Ga0451576_0077486
638 Ga0451576_0245106
639 Ga0451576_0642088
640 Ga0495580_0121816
641 Ga0495580_0289183
642 Ga0496107_0038222
643 Ga0496108_0350227
644 Ga0496109_0253244
645 Ga0496110_0198446
646 Ga0501032_0485486
647 Ga0501033_0022791
648 Ga0501036_0014230
649 Ga0501036_0069752
650 Ga0501036_0429756
651 Ga0501037_0314563
652 Ga0501038_0002163
653 Ga0501038_0087092
654 Ga0501038_0238848
655 Ga0501039_0083144
656 Ga0501039_0165932
657 Ga0501040_0010773
658 Ga0501040_0010904
659 Ga0501040_0038600
660 Ga0501040_0047991
661 Ga0501040_0070486
662 Ga0501040_0115854
663 Ga0501040_0352544
664 Ga0501040_0453168
665 Ga0501041_0002832
666 Ga0501041_0007674
667 Ga0501041_0013921
668 Ga0501041_0105145
669 Ga0501042_0023313
670 Ga0501042_0044855
671 Ga0501042_0077351
672 Ga0501042_0104468
673 Ga0501043_0144333
674 Ga0501043_0318418
675 Ga0501043_0409225
676 Ga0501046_0000115
677 Ga0501046_0026184
678 Ga0501048_0019363
679 Ga0501048_0065579
680 Ga0501067_0007660
681 Ga0501068_0108831
682 Ga0501068_0247193
683 Ga0501069_0028189
684 Ga0501071_0091298
685 Ga0501071_0116846
686 Ga0501071_0172738
687 Ga0501072_0000632
688 Ga0501072_0080098
689 Ga0501072_0149023
690 Ga0501072_0193680
691 Ga0501074_0008162
692 Ga0501074_0033541
693 Ga0501074_0098640
694 Ga0501074_0260463
695 Ga0501075_0000002
696 Ga0501075_0024516
697 Ga0501075_0033925
698 Ga0501075_0044311
699 Ga0501075_0058960
700 Ga0501075_0093131
701 Ga0501075_0109426
702 Ga0501075_0153352
703 Ga0501076_0000077
704 Ga0501076_0015149
705 Ga0501076_0021375
706 Ga0501076_0032232
707 Ga0501076_0068180
708 Ga0501076_0085533
709 Ga0501077_0008787
710 Ga0501077_0013757
711 Ga0501077_0024902
712 Ga0501077_0060059
713 Ga0501077_0257716
714 Ga0501077_0343568
715 Ga0501079_0002429
716 Ga0501079_0002671
717 Ga0501079_0006233
718 Ga0501079_0011740
719 Ga0501079_0024799
720 Ga0501079_0034899
721 Ga0501079_0042900
722 Ga0501079_0475282
723 Ga0501080_0019588
724 Ga0501081_0002048
725 Ga0501081_0004046
726 Ga0501081_0006281
727 Ga0501081_0036044
728 Ga0501081_0053655
729 Ga0501081_0099148
730 Ga0501081_0113986
731 Ga0501081_0198595
732 Ga0501081_0245824
733 Ga0501081_0339164
734 Ga0501083_0044190
735 Ga0501083_0083518
736 Ga0501045_0033325
737 Ga0501045_0051912
738 Ga0501045_0061489
739 Ga0501045_0347173
740 nmdc:mga05p37_197613_c1
741 nmdc:mga05p37_215670_c1
742 nmdc:mga05p37_22422_c1
743 nmdc:mga05p37_33367_c1
744 nmdc:mga05p37_424176_c1
745 nmdc:mga05p37_55915_c1
746 nmdc:mga09592_554233_c1
747 nmdc:mga06r32_244906_c1
748 nmdc:mga06r32_272475_c1
749 nmdc:mga06r32_79566_c2
750 nmdc:mga08y16_253845_c1
751 nmdc:mga08y16_7184_c1
752 nmdc:mga08y16_977_c1
753 nmdc:mga0n895_101685_c1
754 nmdc:mga0n895_170535_c1
755 nmdc:mga0n895_316386_c1
756 nmdc:mga0n895_354585_c1
757 nmdc:mga0n895_355525_c1
758 nmdc:mga0n895_366569_c1
759 nmdc:mga0n895_70272_c1
760 nmdc:mga0rr50_114750_c1
761 nmdc:mga0rr50_432174_c1
762 nmdc:mga0rr50_52599_c1
763 nmdc:mga0rr50_86525_c1
764 nmdc:mga08x19_141732_c1
765 nmdc:mga0a205_10953_c1
766 nmdc:mga0a205_18943_c1
767 nmdc:mga0a205_39357_c1
768 Ga0501084_0023031
769 Ga0501084_0024953
770 Ga0501084_0029241
771 Ga0501084_0033774
772 Ga0501084_0081740
773 Ga0501084_0122032
774 Ga0501084_0263971
775 Ga0501082_0001573
776 Ga0501082_0010461
777 Ga0501082_0014640
778 Ga0501082_0026623
779 Ga0501082_0045924
780 Ga0501082_0086521
781 Ga0501082_0227317
782 Ga0530510_0000001
783 Ga0530510_0000470
784 Ga0530510_0006447
785 Ga0530510_0009914
786 Ga0530510_0011897
787 Ga0530510_0028806
788 Ga0530510_0048583
789 Ga0530510_0061786
790 Ga0530510_0123197
791 Ga0530510_0238546
792 Ga0530510_0390644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

51

280

0.93

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

66

291

0.83

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

59

224

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5my5-assembly1.cif.gz_A tungstate binding protein - tupa - from desulfovibrio alaskensis g20 0.9177 14 244
3cvg-assembly5.cif.gz_C crystal structure of a periplasmic putative metal binding protein 0.874 56 247
3cvg-assembly1.cif.gz_A crystal structure of a periplasmic putative metal binding protein 0.8624 13 247
5my5-assembly1.cif.gz_A tungstate binding protein - tupa - from desulfovibrio alaskensis g20 0.8472 14 244
3lr1-assembly1.cif.gz_A the crystal structure of the tungstate abc transporter from geobacter sulfurreducens 0.8343 12 230
ID Description Score Start End Superfamily
3muqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9689 79 189 3.40.190.10
3muqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9429 79 189 3.40.190.10
5my5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9225 82 187 3.40.190.10
5my5A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9034 14 244 3.40.190.10
5my5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8681 82 187 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6V8PJW2-F1-model_v4 Tungstate transport system substrate-binding protein 0.9789 51 246
AF-A0A351X5Q1-F1-model_v4 Tungsten ABC transporter substrate-binding protein 0.9736 38 245
AF-A0A800IIE3-F1-model_v4 Tungsten ABC transporter substrate-binding protein 0.9731 111 244
AF-A0A7R8X4V2-F1-model_v4 PBP domain-containing protein 0.9698 95 249
AF-A0A3A4NSE7-F1-model_v4 Tungsten ABC transporter substrate-binding protein 0.9697 92 251

Map