F433486

General Info

Members Datasets Scaffolds Average Seq Length
396 238 792 203

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10041053|Ga0105251_100410533
Length 233
Sequence LPHYKSIFRALPGLDNAHICAFSSSIEDLPVTELLAVALFTLLAVISPGADFAMVTRSSYAQGRKAGLAAATGIALGVQVHVLYTVLGIAVIISQSPVLFLAMKVLGAGYLIYLGYQSLTNTTRISLEGQPSATGLLAAMRTGFLTNALNPKTMLFVVSAYTQVVQPGTPLGVDFAYGAFMSFAHWVWFSLVAVFFSSAGLRKAMIERQVVVDRVIGVALIGLGLAVVVAGVR

Samples

Sample ID Description Type Environment
1 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
15 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
16 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
17 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
18 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
31 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
32 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
37 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
46 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
47 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
55 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
56 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
57 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
58 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
59 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
60 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
61 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
62 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
63 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
64 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
65 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
66 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
67 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
68 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
69 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
70 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
71 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
72 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
73 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
74 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
75 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
76 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
77 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
78 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
79 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
80 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
85 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
88 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
92 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
93 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
94 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
129 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
153 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
154 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
155 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
156 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
157 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
158 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
159 2511231006 Pseudomonas sp. GM17 Isolate Nodule
160 2511231011 Pseudomonas sp. GM30 Isolate Nodule
161 2511231012 Pseudomonas sp. GM33 Isolate Nodule
162 2511231021 Pseudomonas sp. GM78 Isolate Nodule
163 2511231024 Pseudomonas sp. GM84 Isolate Nodule
164 2511231031 Pseudomonas sp. GM16 Isolate Nodule
165 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
166 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
167 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
168 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
169 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
170 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
171 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
172 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
173 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
174 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
175 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
176 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
177 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
178 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
179 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
180 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
181 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
182 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
183 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
184 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
185 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
186 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
187 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
188 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
189 2643221580 Devosia sp. Root635 Isolate Unclassified
190 2643221591 Devosia sp. Root685 Isolate Unclassified
191 2643221594 Achromobacter sp. Root170 Isolate Unclassified
192 2643221674 Devosia sp. Root436 Isolate Unclassified
193 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
194 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
195 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
196 2721755523 Delftia sp. HK171 Isolate Unclassified
197 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
198 2765235841 Pseudomonas putida AA7 Isolate Unclassified
199 2773857673 Pseudomonas sp. 443 Isolate Unclassified
200 2784132063 Pseudomonas sp. 424 Isolate Unclassified
201 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
202 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
203 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
204 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
205 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
206 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
207 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
208 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
209 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
210 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
211 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
212 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
213 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
214 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
215 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
216 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
217 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
218 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
219 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
220 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
221 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
222 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
223 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
224 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
225 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
226 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
227 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
228 641522639 Methylobacterium sp. 4-46 Isolate Nodule
229 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
230 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
231 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
232 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
233 8052494512 Pseudomonas putida LD6 Isolate Unclassified
234 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
235 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
236 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
237 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
238 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.8
Metatranscriptomes 0
Isolates 20.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.31
Nodule 3.03
Rhizoplane 7.07
Rhizosphere 60.61
Stem 0
Stem Tuber 1.01
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105251_10041053 3300009011 Bacteria 2253
2 SwRhRL2b_contig_1239518 2162886007 Bacteria 977
3 SwRhRL2b_contig_1412887 2162886007 Bacteria 1254
4 SwRhRL2b_contig_1576138 2162886007 Bacteria 1493
5 JGI25162J39368_1000073 3300002737 Bacteria 121835
6 JGI25163J39215_1000344 3300002771 Bacteria 15364
7 JGI25164J39214_1000052 3300002772 Bacteria 121835
8 JGI25165J46597_1000137 3300003214 Bacteria 121835
9 rootL2_10034844 3300003322 Bacteria 4872
10 rootL2_10061469 3300003322 Bacteria 5732
11 Ga0065714_10005176 3300005288 Bacteria 6060
12 Ga0065714_10007326 3300005288 Bacteria 3413
13 Ga0065704_10018605 3300005289 Bacteria 1395
14 Ga0065704_10019726 3300005289 Bacteria 1345
15 Ga0065704_10082445 3300005289 Bacteria 3598
16 Ga0065704_10213646 3300005289 Bacteria 1099
17 Ga0065715_10110412 3300005293 Bacteria 2621
18 Ga0070669_100452815 3300005353 Bacteria 1058
19 Ga0070710_10615877 3300005437 Bacteria 757
20 Ga0075364_10018607 3300006051 Bacteria 4351
21 Ga0075364_10103398 3300006051 Bacteria 1897
22 Ga0075432_10000283 3300006058 Bacteria 14091
23 Ga0075432_10006283 3300006058 Bacteria 4038
24 Ga0075432_10014416 3300006058 Bacteria 2693
25 Ga0075362_10208040 3300006177 Bacteria 954
26 Ga0075436_100167993 3300006914 Bacteria 1548
27 Ga0099823_1001409 3300006944 Bacteria 19810
28 Ga0079104_1000096 3300006946 Bacteria 129793
29 Ga0105251_10000003 3300009011 Bacteria 311814
30 Ga0105251_10000666 3300009011 Bacteria 31657
31 Ga0105251_10004069 3300009011 Bacteria 10265
32 Ga0105251_10012563 3300009011 Bacteria 4785
33 Ga0105251_10023139 3300009011 Bacteria 3212
34 Ga0105251_10050437 3300009011 Bacteria 1988
35 Ga0105251_10315674 3300009011 Bacteria 710
36 Ga0105244_10009666 3300009036 Bacteria 5904
37 Ga0105244_10010261 3300009036 Bacteria 5688
38 Ga0105244_10013142 3300009036 Bacteria 4851
39 Ga0105244_10015110 3300009036 Bacteria 4437
40 Ga0105244_10022084 3300009036 Bacteria 3508
41 Ga0105244_10024383 3300009036 Bacteria 3302
42 Ga0105244_10038938 3300009036 Bacteria 2477
43 Ga0105244_10111220 3300009036 Bacteria 1332
44 Ga0105250_10000160 3300009092 Bacteria 57969
45 Ga0105250_10000207 3300009092 Bacteria 49366
46 Ga0105250_10024225 3300009092 Bacteria 2445
47 Ga0105250_10025257 3300009092 Bacteria 2394
48 Ga0105250_10043853 3300009092 Bacteria 1793
49 Ga0105250_10118011 3300009092 Bacteria 1089
50 Ga0105243_10000469 3300009148 Bacteria 41718
51 Ga0105243_10021356 3300009148 Bacteria 4914
52 Ga0105243_10120836 3300009148 Bacteria 2208
53 Ga0105243_10239901 3300009148 Bacteria 1612
54 Ga0157373_10164731 3300013100 Bacteria 1560
55 Ga0157371_10001034 3300013102 Bacteria 30510
56 Ga0157370_10075897 3300013104 Bacteria 3167
57 Ga0157370_10290325 3300013104 Bacteria 1510
58 Ga0163162_10000137 3300013306 Bacteria 66670
59 Ga0163162_10197112 3300013306 Bacteria 2143
60 Ga0163162_10795267 3300013306 Bacteria 1063
61 Ga0157372_10005048 3300013307 Bacteria 14020
62 Ga0157372_10107160 3300013307 Bacteria 3197
63 Ga0157375_10105830 3300013308 Bacteria 2904
64 Ga0182008_10000356 3300014497 Bacteria 35646
65 Ga0182008_10002102 3300014497 Bacteria 12705
66 Ga0182008_10023510 3300014497 Bacteria 3147
67 Ga0182006_1005569 3300015261 Bacteria 5981
68 Ga0182006_1031953 3300015261 Bacteria 2119
69 Ga0182005_1025474 3300015265 Bacteria 1614
70 Ga0182005_1066346 3300015265 Bacteria 988
71 Ga0163161_10000054 3300017792 Bacteria 117153
72 Ga0163161_10020632 3300017792 Bacteria 4626
73 Ga0163161_10114034 3300017792 Bacteria 2024
74 Ga0209760_100068 3300025207 Bacteria 85849
75 Ga0209563_100671 3300025230 Bacteria 10840
76 Ga0207427_100007 3300025231 Bacteria 746220
77 Ga0209437_100006 3300025233 Bacteria 1042724
78 Ga0209233_1000086 3300025261 Bacteria 331687
79 Ga0209676_1004835 3300025292 Bacteria 7315
80 Ga0209676_1006898 3300025292 Bacteria 5487
81 Ga0209050_1000229 3300025298 Bacteria 123110
82 Ga0209051_1003454 3300025303 Bacteria 10348
83 Ga0207696_1000002 3300025711 Bacteria 1098043
84 Ga0207696_1000075 3300025711 Bacteria 210629
85 Ga0207696_1000172 3300025711 Bacteria 102404
86 Ga0207696_1005413 3300025711 Bacteria 5301
87 Ga0207696_1025937 3300025711 Bacteria 1820
88 Ga0207696_1030104 3300025711 Bacteria 1652
89 Ga0207696_1045012 3300025711 Bacteria 1278
90 Ga0207655_1000019 3300025728 Bacteria 536324
91 Ga0207655_1000445 3300025728 Bacteria 54522
92 Ga0207655_1000523 3300025728 Bacteria 48957
93 Ga0207655_1002113 3300025728 Bacteria 16620
94 Ga0207655_1007560 3300025728 Bacteria 7034
95 Ga0207655_1024013 3300025728 Bacteria 3001
96 Ga0207655_1042293 3300025728 Bacteria 1942
97 Ga0207655_1088078 3300025728 Bacteria 1100
98 Ga0207713_1000009 3300025735 Bacteria 551314
99 Ga0207713_1007332 3300025735 Bacteria 6533
100 Ga0207713_1014064 3300025735 Bacteria 4179
101 Ga0207713_1015213 3300025735 Bacteria 3961
102 Ga0207713_1028956 3300025735 Bacteria 2489
103 Ga0207713_1031138 3300025735 Bacteria 2363
104 Ga0207713_1056410 3300025735 Bacteria 1526
105 Ga0207713_1058945 3300025735 Bacteria 1476
106 Ga0207713_1094132 3300025735 Bacteria 1047
107 Ga0207713_1153740 3300025735 Bacteria 740
108 Ga0207706_10063173 3300025933 Bacteria 3261
109 Ga0207709_10000413 3300025935 Bacteria 41737
110 Ga0207709_10000439 3300025935 Bacteria 39121
111 Ga0207709_10005415 3300025935 Bacteria 7255
112 Ga0207709_10008803 3300025935 Bacteria 5567
113 Ga0209281_1000020 3300027111 Bacteria 575972
114 Ga0209389_1000125 3300027296 Bacteria 68494
115 Ga0209371_1000516 3300027312 Bacteria 36907
116 Ga0207428_10003937 3300027907 Bacteria 14237
117 Ga0207428_10028258 3300027907 Bacteria 4662
118 Ga0207428_10202528 3300027907 Bacteria 1493
119 Ga0268256_1000213 3300030500 Bacteria 65237
120 Ga0307516_10350382 3300031730 Bacteria 1142
121 Ga0307407_10327748 3300031903 Bacteria 1077
122 Ga0307412_10479823 3300031911 Bacteria 1031
123 Ga0307414_10180938 3300032004 Bacteria 1695
124 Ga0307414_10355495 3300032004 Bacteria 1259
125 Ga0307414_10581700 3300032004 Bacteria 1002
126 Ga0307510_10005552 3300033180 Bacteria 15031
127 Ga0237819_00713 3300038705 Bacteria 10756
128 Ga0400483_097404 3300039062 Bacteria 15635
129 Ga0436365_0097220 3300039437 Bacteria 1431
130 Ga0436361_1040516 3300039447 Bacteria 1168
131 Ga0439438_001397 3300041405 Bacteria 10650
132 Ga0439438_002347 3300041405 Bacteria 8070
133 Ga0439447_006392 3300041407 Bacteria 3832
134 Ga0439466_0000953 3300041411 Bacteria 11092
135 Ga0439466_0074771 3300041411 Bacteria 1074
136 Ga0451791_0751728 3300041451 Bacteria 973
137 Ga0439451_000933 3300042009 Bacteria 5629
138 Ga0439456_000060 3300042013 Bacteria 39159
139 Ga0439456_009462 3300042013 Bacteria 2012
140 Ga0439463_000047 3300042016 Bacteria 25575
141 Ga0450911_019095 3300042115 Bacteria 899
142 Ga0450919_007258 3300042121 Bacteria 1297
143 Ga0450920_000989 3300042122 Bacteria 4648
144 Ga0450922_003400 3300042124 Bacteria 1467
145 Ga0450902_000056 3300042137 Bacteria 10663
146 Ga0450903_003590 3300042138 Bacteria 2678
147 Ga0450903_010503 3300042138 Bacteria 1497
148 Ga0450905_004957 3300042142 Bacteria 1780
149 Ga0450906_010731 3300042145 Bacteria 1725
150 Ga0450907_003059 3300042146 Bacteria 3041
151 Ga0450910_008317 3300042147 Bacteria 1457
152 Ga0450908_006096 3300042184 Bacteria 2298
153 Ga0439464_0015962 3300042439 Bacteria 2029
154 Ga0439460_0000975 3300042461 Bacteria 6577
155 Ga0439460_0001906 3300042461 Bacteria 4984
156 Ga0450918_010238 3300042531 Bacteria 1638
157 Ga0450901_000333 3300042533 Bacteria 5779
158 Ga0451577_0005424 3300042876 Bacteria 13079
159 Ga0439440_0013058 3300042993 Bacteria 1775
160 Ga0439440_0067613 3300042993 Bacteria 924
161 Ga0466961_0112028 3300044693 Bacteria 1716
162 Ga0495617_000415 3300046452 Bacteria 23324
163 Ga0495617_001567 3300046452 Bacteria 9888
164 Ga0495617_002350 3300046452 Bacteria 7575
165 Ga0495617_008457 3300046452 Bacteria 3548
166 Ga0495627_000497 3300046453 Bacteria 32934
167 Ga0495592_0001251 3300046454 Bacteria 17591
168 Ga0495590_0000491 3300046457 Bacteria 19416
169 Ga0495591_018413 3300046458 Bacteria 2369
170 Ga0495638_0005389 3300046460 Bacteria 9536
171 Ga0495638_0131044 3300046460 Bacteria 1472
172 Ga0495653_0000250 3300046463 Bacteria 43089
173 Ga0495584_0001284 3300046491 Bacteria 15285
174 Ga0495585_0184598 3300046492 Bacteria 1070
175 Ga0495596_0133451 3300046500 Bacteria 963
176 Ga0495596_0280352 3300046500 Bacteria 647
177 Ga0495607_0005029 3300046501 Bacteria 9587
178 Ga0495607_0010875 3300046501 Bacteria 6089
179 Ga0495607_0038668 3300046501 Bacteria 2857
180 Ga0495607_0217262 3300046501 Bacteria 937
181 Ga0495583_0002309 3300046506 Bacteria 16613
182 Ga0495610_0003412 3300046512 Bacteria 12401
183 Ga0495616_0003859 3300046513 Bacteria 9552
184 Ga0495620_0000124 3300046515 Bacteria 62374
185 Ga0495620_0121380 3300046515 Bacteria 1029
186 Ga0495632_0000277 3300046519 Bacteria 50320
187 Ga0495632_0000466 3300046519 Bacteria 38410
188 Ga0495632_0002099 3300046519 Bacteria 15592
189 Ga0495637_0000275 3300046520 Bacteria 40472
190 Ga0495643_0000783 3300046522 Bacteria 35376
191 Ga0495643_0000810 3300046522 Bacteria 34361
192 Ga0495643_0006497 3300046522 Bacteria 7693
193 Ga0495648_0000318 3300046524 Bacteria 53345
194 Ga0495648_0000606 3300046524 Bacteria 38334
195 Ga0495666_0000454 3300046526 Bacteria 18249
196 Ga0495652_0239890 3300046529 Bacteria 1350
197 Ga0495654_0001187 3300046530 Bacteria 18541
198 Ga0495654_0001645 3300046530 Bacteria 15120
199 Ga0495609_0001884 3300046538 Bacteria 13379
200 Ga0495597_0033649 3300046542 Bacteria 2319
201 Ga0495597_0063130 3300046542 Bacteria 1610
202 Ga0495645_0048549 3300046543 Bacteria 3091
203 Ga0495633_0194862 3300046558 Bacteria 931
204 Ga0495656_0107424 3300046615 Bacteria 1300
205 Ga0495668_0016020 3300046616 Bacteria 4365
206 Ga0495611_0000067 3300046648 Bacteria 72577
207 Ga0495625_0001947 3300046660 Bacteria 23353
208 Ga0495625_0006625 3300046660 Bacteria 10280
209 Ga0495661_0002810 3300046665 Bacteria 13185
210 Ga0495661_0082226 3300046665 Bacteria 1854
211 Ga0495646_0002463 3300046680 Bacteria 11376
212 Ga0495613_0000743 3300046689 Bacteria 25557
213 Ga0495613_0000978 3300046689 Bacteria 21774
214 Ga0495624_0000034 3300046690 Bacteria 90505
215 Ga0495670_0000061 3300046691 Bacteria 48947
216 Ga0495671_0003987 3300046692 Bacteria 8925
217 Ga0495671_0007360 3300046692 Bacteria 6281
218 Ga0495671_0027672 3300046692 Bacteria 2926
219 Ga0495671_0032666 3300046692 Bacteria 2656
220 Ga0495649_0000735 3300046694 Bacteria 26611
221 Ga0495589_0103748 3300046794 Bacteria 1374
222 Ga0495660_0006651 3300046810 Bacteria 6833
223 Ga0495660_0031886 3300046810 Bacteria 2960
224 Ga0495604_0024755 3300047317 Bacteria 4788
225 Ga0495672_0000151 3300047320 Bacteria 100793
226 Ga0495672_0009871 3300047320 Bacteria 6864
227 Ga0495672_0038295 3300047320 Bacteria 2926
228 Ga0495676_0006569 3300047321 Bacteria 10717
229 Ga0495680_0006037 3300047322 Bacteria 11321
230 Ga0495680_0006176 3300047322 Bacteria 11173
231 Ga0495683_0001526 3300047323 Bacteria 15007
232 Ga0495683_0006336 3300047323 Bacteria 6469
233 Ga0495679_018701 3300047446 Bacteria 2452
234 Ga0495673_0005971 3300047469 Bacteria 7246
235 Ga0495673_0021835 3300047469 Bacteria 3151
236 Ga0495681_0000240 3300047470 Bacteria 45463
237 Ga0495684_0069646 3300047471 Bacteria 2674
238 Ga0495686_0002037 3300047472 Bacteria 19919
239 Ga0495593_0002122 3300047673 Bacteria 11850
240 Ga0495593_0009438 3300047673 Bacteria 5660
241 Ga0495602_0000429 3300048088 Bacteria 39500
242 Ga0496106_0350101 3300048909 Bacteria 1186
243 Ga0496110_0116482 3300048913 Bacteria 2405
244 Ga0496111_0074786 3300048914 Bacteria 2468
245 Ga0496114_0041244 3300048917 Bacteria 3824
246 Ga0496114_0172720 3300048917 Bacteria 1884
247 Ga0496116_0000399 3300048919 Bacteria 63018
248 Ga0496116_0000827 3300048919 Bacteria 39072
249 Ga0496116_0005079 3300048919 Bacteria 12365
250 Ga0496116_0020546 3300048919 Bacteria 5011
251 Ga0496116_0180478 3300048919 Bacteria 1131
252 Ga0496117_0000133 3300048920 Bacteria 161454
253 Ga0496117_0001129 3300048920 Bacteria 40277
254 Ga0496117_0002629 3300048920 Bacteria 22276
255 Ga0496117_0004196 3300048920 Bacteria 16096
256 Ga0496117_0004685 3300048920 Bacteria 14857
257 Ga0496117_0053283 3300048920 Bacteria 2843
258 Ga0496118_0000752 3300048921 Bacteria 52469
259 Ga0496118_0000966 3300048921 Bacteria 44919
260 Ga0496118_0003371 3300048921 Bacteria 20185
261 Ga0496118_0003476 3300048921 Bacteria 19765
262 Ga0496118_0031423 3300048921 Bacteria 4402
263 Ga0496118_0033228 3300048921 Bacteria 4236
264 Ga0496119_0000811 3300048922 Bacteria 41743
265 Ga0496119_0068557 3300048922 Bacteria 2088
266 Ga0496119_0268682 3300048922 Bacteria 853
267 Ga0496120_0002513 3300048923 Bacteria 18364
268 Ga0496121_0000691 3300048924 Bacteria 62894
269 Ga0496121_0001424 3300048924 Bacteria 40476
270 Ga0496121_0051069 3300048924 Bacteria 3486
271 Ga0496121_0245769 3300048924 Bacteria 1244
272 Ga0496121_0659065 3300048924 Bacteria 636
273 Ga0496122_0005114 3300048925 Bacteria 15825
274 Ga0496122_0005493 3300048925 Bacteria 15082
275 Ga0496122_0015460 3300048925 Bacteria 7296
276 Ga0496122_0038001 3300048925 Bacteria 3865
277 Ga0496123_0000567 3300048926 Bacteria 63083
278 Ga0496123_0003087 3300048926 Bacteria 19126
279 Ga0496123_0003948 3300048926 Bacteria 16072
280 Ga0496123_0023486 3300048926 Bacteria 4718
281 Ga0496123_0062703 3300048926 Bacteria 2379
282 Ga0496124_0002720 3300048927 Bacteria 22570
283 Ga0496124_0003048 3300048927 Bacteria 20889
284 Ga0496124_0003771 3300048927 Bacteria 18230
285 Ga0496124_0006599 3300048927 Bacteria 12601
286 Ga0496124_0022517 3300048927 Bacteria 5772
287 Ga0496124_0031391 3300048927 Bacteria 4703
288 Ga0496124_0039598 3300048927 Bacteria 4084
289 Ga0496124_0044576 3300048927 Bacteria 3804
290 Ga0496124_0044708 3300048927 Bacteria 3798
291 Ga0496124_0046841 3300048927 Bacteria 3701
292 Ga0496124_0373888 3300048927 Bacteria 999
293 Ga0496125_0000191 3300048928 Bacteria 131220
294 Ga0496125_0002428 3300048928 Bacteria 24231
295 Ga0496125_0012112 3300048928 Bacteria 8580
296 Ga0496125_0012244 3300048928 Bacteria 8532
297 Ga0496125_0031043 3300048928 Bacteria 4768
298 Ga0496125_0040250 3300048928 Bacteria 4012
299 Ga0496125_0096839 3300048928 Bacteria 2189
300 Ga0496125_0244342 3300048928 Bacteria 1137
301 Ga0496125_0399002 3300048928 Bacteria 804
302 Ga0496126_0116662 3300048929 Bacteria 2320
303 Ga0496126_0189995 3300048929 Bacteria 1740
304 Ga0496126_0326544 3300048929 Bacteria 1260
305 Ga0496126_0504806 3300048929 Bacteria 966
306 Ga0501034_0000131 3300049571 Bacteria 139479
307 Ga0501034_1321237 3300049571 Bacteria 597
308 nmdc:mga00v17_17312_c1 3300050491 Bacteria 4077
309 nmdc:mga00v17_324438_c1 3300050491 Bacteria 1000
310 Ga0500593_157485 3300053117 Bacteria 872
311 Ga0500618_003827 3300053125 Bacteria 5025
312 Ga0500659_0005131 3300053135 Bacteria 7372
313 Ga0500600_0235318 3300053149 Unclassified 833
314 Ga0500604_0002462 3300053151 Bacteria 5046
315 Ga0500624_002614 3300053157 Bacteria 2417
316 Ga0500634_0000461 3300053161 Bacteria 13217
317 2511265195 2511231006 Bacteria 6794709
318 2511293167 2511231011 Bacteria 6149768
319 2511300782 2511231012 Bacteria 6738011
320 2511357114 2511231021 Bacteria 7302637
321 2511375666 2511231024 Bacteria 5835885
322 2511413065 2511231031 Bacteria 6558529
323 2512329030 2512047018 Bacteria 6663241
324 2538426957 2537561728 Bacteria 5149301
325 2545676047 2545555834 Bacteria 8130841
326 2555245694 2554235231 Bacteria 5215788
327 2555671597 2554235341 Bacteria 6867980
328 2583794078 2582580891 Bacteria 6800976
329 2597859671 2597489887 Bacteria 6666321
330 2599354246 2599185160 Bacteria 6844013
331 2599360040 2599185161 Bacteria 6960462
332 2599366362 2599185162 Bacteria 6957254
333 2599373152 2599185163 Bacteria 6995158
334 2599379354 2599185164 Bacteria 6841688
335 2599385668 2599185165 Bacteria 6843250
336 2599392011 2599185166 Bacteria 6959206
337 2599403777 2599185168 Bacteria 6997636
338 2599461080 2599185181 Bacteria 6844519
339 2599469622 2599185182 Bacteria 6883168
340 2599482500 2599185185 Bacteria 6652270
341 2599490100 2599185186 Bacteria 6831633
342 2599803779 2599185257 Bacteria 6492581
343 2600213695 2599185356 Bacteria 6843884
344 2600445364 2600254954 Bacteria 5100516
345 2601773863 2600255313 Bacteria 6842543
346 2602009764 2600255389 Bacteria 5275336
347 2643910345 2643221580 Bacteria 3816678
348 2643964708 2643221591 Bacteria 4397626
349 2643981016 2643221594 Bacteria 5811388
350 2644411768 2643221674 Bacteria 3919126
351 2671096827 2667528171 Bacteria 6900659
352 2671770652 2671180172 Bacteria 6495783
353 2707102113 2706794495 Bacteria 4536932
354 2722883479 2721755523 Bacteria 6430384
355 2743739209 2740892503 Bacteria 6855563
356 2765581900 2765235841 Bacteria 6137024
357 2774134197 2773857673 Bacteria 6513460
358 2784264024 2784132063 Bacteria 6262788
359 2807406554 2806310737 Bacteria 5751088
360 2807454886 2806310745 Bacteria 5742165
361 2809036061 2808606395 Bacteria 6020352
362 2819657919 2818991456 Bacteria 6123676
363 2819701920 2818991464 Bacteria 6907494
364 2823424385 2823421272 Bacteria 5372474
365 2839140836 2839138175 Bacteria 6549354
366 2852657896 2852657418 Bacteria 6472974
367 2855200027 2855195626 Bacteria 4927512
368 2858469477 2858466076 Bacteria 4722413
369 2871273985 2871272651 Bacteria 5042015
370 2880233911 2880230671 Bacteria 6140320
371 2900053817 2900051742 Bacteria 4985156
372 2904436891 2904434214 Bacteria 6230908
373 2904523230 2904518522 Bacteria 6068986
374 2912964522 2912963787 Bacteria 5646108
375 2917075468 2917070673 Bacteria 6868303
376 2919159395 2919155634 Bacteria 4860545
377 2923158291 2923153595 Bacteria 6870622
378 2935356455 2935353572 Unclassified 6955622
379 2939641431 2939636861 Bacteria 6297853
380 2939652029 2939651529 Bacteria 5895393
381 3007397583 3007395558 Bacteria 6755444
382 3007720614 3007718800 Bacteria 5971527
383 3007804853 3007803356 Bacteria 5931491
384 3007873354 3007872151 Bacteria 5268868
385 637321919 637000220 Bacteria 7074893
386 641645482 641522639 Bacteria 7737025
387 8002395507 8002392321 Bacteria 4159911
388 8003401480 8003400568 Bacteria 5535898
389 8015692379 8015687852 Bacteria 6613826
390 8019773945 8019769354 Bacteria 6924660
391 8052499248 8052494512 Bacteria 5765634
392 8054933365 8054929484 Bacteria 5599761
393 8056120591 8056115690 Bacteria 5527654
394 8056121583 8056120720 Bacteria 5758328
395 8056142233 8056137416 Bacteria 6147080
396 8057804459 8057798959 Bacteria 6713499
397 Ga0105251_10041053
398 SwRhRL2b_contig_1239518
399 SwRhRL2b_contig_1412887
400 SwRhRL2b_contig_1576138
401 JGI25162J39368_1000073
402 JGI25163J39215_1000344
403 JGI25164J39214_1000052
404 JGI25165J46597_1000137
405 rootL2_10034844
406 rootL2_10061469
407 Ga0065714_10005176
408 Ga0065714_10007326
409 Ga0065704_10018605
410 Ga0065704_10019726
411 Ga0065704_10082445
412 Ga0065704_10213646
413 Ga0065715_10110412
414 Ga0070669_100452815
415 Ga0070710_10615877
416 Ga0075364_10018607
417 Ga0075364_10103398
418 Ga0075432_10000283
419 Ga0075432_10006283
420 Ga0075432_10014416
421 Ga0075362_10208040
422 Ga0075436_100167993
423 Ga0099823_1001409
424 Ga0079104_1000096
425 Ga0105251_10000003
426 Ga0105251_10000666
427 Ga0105251_10004069
428 Ga0105251_10012563
429 Ga0105251_10023139
430 Ga0105251_10050437
431 Ga0105251_10315674
432 Ga0105244_10009666
433 Ga0105244_10010261
434 Ga0105244_10013142
435 Ga0105244_10015110
436 Ga0105244_10022084
437 Ga0105244_10024383
438 Ga0105244_10038938
439 Ga0105244_10111220
440 Ga0105250_10000160
441 Ga0105250_10000207
442 Ga0105250_10024225
443 Ga0105250_10025257
444 Ga0105250_10043853
445 Ga0105250_10118011
446 Ga0105243_10000469
447 Ga0105243_10021356
448 Ga0105243_10120836
449 Ga0105243_10239901
450 Ga0157373_10164731
451 Ga0157371_10001034
452 Ga0157370_10075897
453 Ga0157370_10290325
454 Ga0163162_10000137
455 Ga0163162_10197112
456 Ga0163162_10795267
457 Ga0157372_10005048
458 Ga0157372_10107160
459 Ga0157375_10105830
460 Ga0182008_10000356
461 Ga0182008_10002102
462 Ga0182008_10023510
463 Ga0182006_1005569
464 Ga0182006_1031953
465 Ga0182005_1025474
466 Ga0182005_1066346
467 Ga0163161_10000054
468 Ga0163161_10020632
469 Ga0163161_10114034
470 Ga0209760_100068
471 Ga0209563_100671
472 Ga0207427_100007
473 Ga0209437_100006
474 Ga0209233_1000086
475 Ga0209676_1004835
476 Ga0209676_1006898
477 Ga0209050_1000229
478 Ga0209051_1003454
479 Ga0207696_1000002
480 Ga0207696_1000075
481 Ga0207696_1000172
482 Ga0207696_1005413
483 Ga0207696_1025937
484 Ga0207696_1030104
485 Ga0207696_1045012
486 Ga0207655_1000019
487 Ga0207655_1000445
488 Ga0207655_1000523
489 Ga0207655_1002113
490 Ga0207655_1007560
491 Ga0207655_1024013
492 Ga0207655_1042293
493 Ga0207655_1088078
494 Ga0207713_1000009
495 Ga0207713_1007332
496 Ga0207713_1014064
497 Ga0207713_1015213
498 Ga0207713_1028956
499 Ga0207713_1031138
500 Ga0207713_1056410
501 Ga0207713_1058945
502 Ga0207713_1094132
503 Ga0207713_1153740
504 Ga0207706_10063173
505 Ga0207709_10000413
506 Ga0207709_10000439
507 Ga0207709_10005415
508 Ga0207709_10008803
509 Ga0209281_1000020
510 Ga0209389_1000125
511 Ga0209371_1000516
512 Ga0207428_10003937
513 Ga0207428_10028258
514 Ga0207428_10202528
515 Ga0268256_1000213
516 Ga0307516_10350382
517 Ga0307407_10327748
518 Ga0307412_10479823
519 Ga0307414_10180938
520 Ga0307414_10355495
521 Ga0307414_10581700
522 Ga0307510_10005552
523 Ga0237819_00713
524 Ga0400483_097404
525 Ga0436365_0097220
526 Ga0436361_1040516
527 Ga0439438_001397
528 Ga0439438_002347
529 Ga0439447_006392
530 Ga0439466_0000953
531 Ga0439466_0074771
532 Ga0451791_0751728
533 Ga0439451_000933
534 Ga0439456_000060
535 Ga0439456_009462
536 Ga0439463_000047
537 Ga0450911_019095
538 Ga0450919_007258
539 Ga0450920_000989
540 Ga0450922_003400
541 Ga0450902_000056
542 Ga0450903_003590
543 Ga0450903_010503
544 Ga0450905_004957
545 Ga0450906_010731
546 Ga0450907_003059
547 Ga0450910_008317
548 Ga0450908_006096
549 Ga0439464_0015962
550 Ga0439460_0000975
551 Ga0439460_0001906
552 Ga0450918_010238
553 Ga0450901_000333
554 Ga0451577_0005424
555 Ga0439440_0013058
556 Ga0439440_0067613
557 Ga0466961_0112028
558 Ga0495617_000415
559 Ga0495617_001567
560 Ga0495617_002350
561 Ga0495617_008457
562 Ga0495627_000497
563 Ga0495592_0001251
564 Ga0495590_0000491
565 Ga0495591_018413
566 Ga0495638_0005389
567 Ga0495638_0131044
568 Ga0495653_0000250
569 Ga0495584_0001284
570 Ga0495585_0184598
571 Ga0495596_0133451
572 Ga0495596_0280352
573 Ga0495607_0005029
574 Ga0495607_0010875
575 Ga0495607_0038668
576 Ga0495607_0217262
577 Ga0495583_0002309
578 Ga0495610_0003412
579 Ga0495616_0003859
580 Ga0495620_0000124
581 Ga0495620_0121380
582 Ga0495632_0000277
583 Ga0495632_0000466
584 Ga0495632_0002099
585 Ga0495637_0000275
586 Ga0495643_0000783
587 Ga0495643_0000810
588 Ga0495643_0006497
589 Ga0495648_0000318
590 Ga0495648_0000606
591 Ga0495666_0000454
592 Ga0495652_0239890
593 Ga0495654_0001187
594 Ga0495654_0001645
595 Ga0495609_0001884
596 Ga0495597_0033649
597 Ga0495597_0063130
598 Ga0495645_0048549
599 Ga0495633_0194862
600 Ga0495656_0107424
601 Ga0495668_0016020
602 Ga0495611_0000067
603 Ga0495625_0001947
604 Ga0495625_0006625
605 Ga0495661_0002810
606 Ga0495661_0082226
607 Ga0495646_0002463
608 Ga0495613_0000743
609 Ga0495613_0000978
610 Ga0495624_0000034
611 Ga0495670_0000061
612 Ga0495671_0003987
613 Ga0495671_0007360
614 Ga0495671_0027672
615 Ga0495671_0032666
616 Ga0495649_0000735
617 Ga0495589_0103748
618 Ga0495660_0006651
619 Ga0495660_0031886
620 Ga0495604_0024755
621 Ga0495672_0000151
622 Ga0495672_0009871
623 Ga0495672_0038295
624 Ga0495676_0006569
625 Ga0495680_0006037
626 Ga0495680_0006176
627 Ga0495683_0001526
628 Ga0495683_0006336
629 Ga0495679_018701
630 Ga0495673_0005971
631 Ga0495673_0021835
632 Ga0495681_0000240
633 Ga0495684_0069646
634 Ga0495686_0002037
635 Ga0495593_0002122
636 Ga0495593_0009438
637 Ga0495602_0000429
638 Ga0496106_0350101
639 Ga0496110_0116482
640 Ga0496111_0074786
641 Ga0496114_0041244
642 Ga0496114_0172720
643 Ga0496116_0000399
644 Ga0496116_0000827
645 Ga0496116_0005079
646 Ga0496116_0020546
647 Ga0496116_0180478
648 Ga0496117_0000133
649 Ga0496117_0001129
650 Ga0496117_0002629
651 Ga0496117_0004196
652 Ga0496117_0004685
653 Ga0496117_0053283
654 Ga0496118_0000752
655 Ga0496118_0000966
656 Ga0496118_0003371
657 Ga0496118_0003476
658 Ga0496118_0031423
659 Ga0496118_0033228
660 Ga0496119_0000811
661 Ga0496119_0068557
662 Ga0496119_0268682
663 Ga0496120_0002513
664 Ga0496121_0000691
665 Ga0496121_0001424
666 Ga0496121_0051069
667 Ga0496121_0245769
668 Ga0496121_0659065
669 Ga0496122_0005114
670 Ga0496122_0005493
671 Ga0496122_0015460
672 Ga0496122_0038001
673 Ga0496123_0000567
674 Ga0496123_0003087
675 Ga0496123_0003948
676 Ga0496123_0023486
677 Ga0496123_0062703
678 Ga0496124_0002720
679 Ga0496124_0003048
680 Ga0496124_0003771
681 Ga0496124_0006599
682 Ga0496124_0022517
683 Ga0496124_0031391
684 Ga0496124_0039598
685 Ga0496124_0044576
686 Ga0496124_0044708
687 Ga0496124_0046841
688 Ga0496124_0373888
689 Ga0496125_0000191
690 Ga0496125_0002428
691 Ga0496125_0012112
692 Ga0496125_0012244
693 Ga0496125_0031043
694 Ga0496125_0040250
695 Ga0496125_0096839
696 Ga0496125_0244342
697 Ga0496125_0399002
698 Ga0496126_0116662
699 Ga0496126_0189995
700 Ga0496126_0326544
701 Ga0496126_0504806
702 Ga0501034_0000131
703 Ga0501034_1321237
704 nmdc:mga00v17_17312_c1
705 nmdc:mga00v17_324438_c1
706 Ga0500593_157485
707 Ga0500618_003827
708 Ga0500659_0005131
709 Ga0500600_0235318
710 Ga0500604_0002462
711 Ga0500624_002614
712 Ga0500634_0000461
713 2511265195
714 2511293167
715 2511300782
716 2511357114
717 2511375666
718 2511413065
719 2512329030
720 2538426957
721 2545676047
722 2555245694
723 2555671597
724 2583794078
725 2597859671
726 2599354246
727 2599360040
728 2599366362
729 2599373152
730 2599379354
731 2599385668
732 2599392011
733 2599403777
734 2599461080
735 2599469622
736 2599482500
737 2599490100
738 2599803779
739 2600213695
740 2600445364
741 2601773863
742 2602009764
743 2643910345
744 2643964708
745 2643981016
746 2644411768
747 2671096827
748 2671770652
749 2707102113
750 2722883479
751 2743739209
752 2765581900
753 2774134197
754 2784264024
755 2807406554
756 2807454886
757 2809036061
758 2819657919
759 2819701920
760 2823424385
761 2839140836
762 2852657896
763 2855200027
764 2858469477
765 2871273985
766 2880233911
767 2900053817
768 2904436891
769 2904523230
770 2912964522
771 2917075468
772 2919159395
773 2923158291
774 2935356455
775 2939641431
776 2939652029
777 3007397583
778 3007720614
779 3007804853
780 3007873354
781 637321919
782 641645482
783 8002395507
784 8003401480
785 8015692379
786 8019773945
787 8052499248
788 8054933365
789 8056120591
790 8056121583
791 8056142233
792 8057804459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

42

231

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.4546 1 198
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.451 1 205
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.4428 1 202
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4313 1 205
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4306 2 203
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6954 22 198 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6766 22 198 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5891 6 198 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.553 2 202 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5435 2 202 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A021X3G6-F1-model_v4 Putative threonine efflux protein 0.9199 2 203 GO:0005886
GO:0015171
AF-A0A5D3WLB5-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.909 2 199 GO:0005886
GO:0015171
AF-A0A5P6NW10-F1-model_v4 deleted 0.909 2 202
AF-A0A231GPC9-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.9089 2 202 GO:0005886
GO:0015171
AF-A0A543QTM5-F1-model_v4 deleted 0.9074 2 202

Map