F433512

General Info

Members Datasets Scaffolds Average Seq Length
396 201 792 292

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10031863|Ga0157374_100318634
Length 315
Sequence MERILFGDNQFFAVNHISDEKSREQSIRFQDDMAIIKTLNYASDAGVNTFMCTTHDRISGICDYIRKNPEQYSGFKIYPCMPYAHKYANAVTELGIVGTLKEYVPGNFFGSIFKGGVAYLSKDYISIMELLVDAEMKMFAKINTPVIFLQNVITDLLLGLGMKDVFKAYHNYVEKKYNAEAGYITMNMPKLLDMLDEIGISNPIICTSINKAGFRMSGGKELYESALKNRYVRVIAMQVLAGGAIPPKEAIEYVCNLPNIESILFGASSRGHINETVSLIKHFDTQNQFIKLPAESIIYNSTTHTNKRNGVPTLI

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
195 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
196 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
197 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 2739367663 Pedobacter sp. YR510 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0
Rhizoplane 1.77
Rhizosphere 92.17
Stem 0
Stem Tuber 0
Unclassified 9.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10031863 3300013296 Unclassified 4796
2 JGI24739J22299_10001305 3300001989 Bacteria 9355
3 JGI24737J22298_10008241 3300001990 Bacteria 3497
4 rootH2_10009740 3300003320 Bacteria 3805
5 rootL2_10001297 3300003322 Bacteria 12085
6 rootH1_10220272 3300003323 Bacteria 1835
7 Ga0065707_10010337 3300005295 Bacteria 2991
8 Ga0070658_10018520 3300005327 Bacteria 5574
9 Ga0070658_10067345 3300005327 Bacteria 2926
10 Ga0070676_10036177 3300005328 Bacteria 2843
11 Ga0070676_10200450 3300005328 Bacteria 1308
12 Ga0070670_100006525 3300005331 Bacteria 9880
13 Ga0070670_100025102 3300005331 Bacteria 5128
14 Ga0070670_100335817 3300005331 Bacteria 1326
15 Ga0070677_10003384 3300005333 Bacteria 5139
16 Ga0068869_100007517 3300005334 Bacteria 6970
17 Ga0068869_100080859 3300005334 Bacteria 2425
18 Ga0068869_100093771 3300005334 Bacteria 2262
19 Ga0070680_100000692 3300005336 Bacteria 23396
20 Ga0070680_100011897 3300005336 Bacteria 6752
21 Ga0070680_100268514 3300005336 Unclassified 1444
22 Ga0070680_100298771 3300005336 Bacteria 1365
23 Ga0070680_100356391 3300005336 Bacteria 1244
24 Ga0070682_100005892 3300005337 Bacteria 6851
25 Ga0070682_100197119 3300005337 Unclassified 1418
26 Ga0070682_100360244 3300005337 Bacteria 1087
27 Ga0070660_100134691 3300005339 Unclassified 1979
28 Ga0070660_100184663 3300005339 Bacteria 1688
29 Ga0070660_100263966 3300005339 Bacteria 1406
30 Ga0070691_10003367 3300005341 Bacteria 7183
31 Ga0070668_100008222 3300005347 Bacteria 7746
32 Ga0070668_100052518 3300005347 Bacteria 3141
33 Ga0070668_100075776 3300005347 Unclassified 2627
34 Ga0070668_100076297 3300005347 Unclassified 2618
35 Ga0070669_100000136 3300005353 Bacteria 66350
36 Ga0070669_100036725 3300005353 Bacteria 3552
37 Ga0070669_100145150 3300005353 Bacteria 1833
38 Ga0070675_100001894 3300005354 Bacteria 15450
39 Ga0070675_100042147 3300005354 Bacteria 3729
40 Ga0070675_100081016 3300005354 Bacteria 2707
41 Ga0070671_100000081 3300005355 Bacteria 60882
42 Ga0070671_100209611 3300005355 Bacteria 1653
43 Ga0070674_100006908 3300005356 Bacteria 6653
44 Ga0070673_100114507 3300005364 Bacteria 2241
45 Ga0070673_100194933 3300005364 Bacteria 1742
46 Ga0070673_100222602 3300005364 Unclassified 1634
47 Ga0070659_100000272 3300005366 Bacteria 40405
48 Ga0070659_100001005 3300005366 Bacteria 20712
49 Ga0070659_100016708 3300005366 Bacteria 5513
50 Ga0070659_100039938 3300005366 Bacteria 3665
51 Ga0070659_100139211 3300005366 Bacteria 1975
52 Ga0070659_100330090 3300005366 Bacteria 1276
53 Ga0070667_100031587 3300005367 Bacteria 4415
54 Ga0070713_100341097 3300005436 Bacteria 1388
55 Ga0070705_100126140 3300005440 Bacteria 1662
56 Ga0070678_100060883 3300005456 Bacteria 2781
57 Ga0070662_100005831 3300005457 Bacteria 7901
58 Ga0070662_100150956 3300005457 Bacteria 1809
59 Ga0070681_10004949 3300005458 Bacteria 12811
60 Ga0070681_10216878 3300005458 Bacteria 1829
61 Ga0068867_100007630 3300005459 Bacteria 7653
62 Ga0068867_100011441 3300005459 Bacteria 6260
63 Ga0068867_100025712 3300005459 Unclassified 4225
64 Ga0068867_100037533 3300005459 Bacteria 3522
65 Ga0068867_100072115 3300005459 Bacteria 2585
66 Ga0068867_100178058 3300005459 Bacteria 1689
67 Ga0068867_100324946 3300005459 Unclassified 1276
68 Ga0070679_100006735 3300005530 Bacteria 10716
69 Ga0070679_100018081 3300005530 Bacteria 6832
70 Ga0070679_100034023 3300005530 Bacteria 5048
71 Ga0070679_100040794 3300005530 Bacteria 4618
72 Ga0068853_100055061 3300005539 Bacteria 3428
73 Ga0070672_100017424 3300005543 Bacteria 5170
74 Ga0070693_100003112 3300005547 Bacteria 7705
75 Ga0070665_100000015 3300005548 Bacteria 462744
76 Ga0070665_100000023 3300005548 Bacteria 375278
77 Ga0070665_100010440 3300005548 Bacteria 9397
78 Ga0068855_100001030 3300005563 Bacteria 34697
79 Ga0068855_100011886 3300005563 Bacteria 10526
80 Ga0068855_100037474 3300005563 Bacteria 5765
81 Ga0070664_100039592 3300005564 Unclassified 3972
82 Ga0070664_100265418 3300005564 Unclassified 1545
83 Ga0070664_100559296 3300005564 Bacteria 1058
84 Ga0068857_100029318 3300005577 Bacteria 4856
85 Ga0068857_100202064 3300005577 Bacteria 1812
86 Ga0068856_100018206 3300005614 Bacteria 6809
87 Ga0068856_100075927 3300005614 Unclassified 3329
88 Ga0068852_100079718 3300005616 Bacteria 2901
89 Ga0068859_100009953 3300005617 Bacteria 9590
90 Ga0068859_100015705 3300005617 Bacteria 7609
91 Ga0068859_100622725 3300005617 Bacteria 1172
92 Ga0068864_100018220 3300005618 Bacteria 5861
93 Ga0068864_100032702 3300005618 Bacteria 4421
94 Ga0068864_100277147 3300005618 Bacteria 1564
95 Ga0068866_10003816 3300005718 Bacteria 6178
96 Ga0068866_10109882 3300005718 Bacteria 1536
97 Ga0068861_100004899 3300005719 Bacteria 9012
98 Ga0068861_100007705 3300005719 Bacteria 7392
99 Ga0068851_10015319 3300005834 Unclassified 3652
100 Ga0068870_10003398 3300005840 Bacteria 6749
101 Ga0068870_10016500 3300005840 Bacteria 3530
102 Ga0068863_100003020 3300005841 Bacteria 16635
103 Ga0068863_100449802 3300005841 Bacteria 1264
104 Ga0068858_100009404 3300005842 Bacteria 9327
105 Ga0068860_100001140 3300005843 Bacteria 29150
106 Ga0068860_100001966 3300005843 Bacteria 21729
107 Ga0068860_100058350 3300005843 Bacteria 3669
108 Ga0068862_100000876 3300005844 Bacteria 29314
109 Ga0068862_100001498 3300005844 Bacteria 21421
110 Ga0068862_100003597 3300005844 Bacteria 13267
111 Ga0081539_10000761 3300005985 Bacteria 63684
112 Ga0075366_10000031 3300006195 Bacteria 49332
113 Ga0097621_100000187 3300006237 Bacteria 39656
114 Ga0097621_100000633 3300006237 Bacteria 24802
115 Ga0097621_100003629 3300006237 Bacteria 10673
116 Ga0097621_100042264 3300006237 Bacteria 3671
117 Ga0075370_10117288 3300006353 Bacteria 1548
118 Ga0075370_10283516 3300006353 Unclassified 984
119 Ga0068871_100000065 3300006358 Bacteria 58280
120 Ga0068871_100001972 3300006358 Bacteria 13912
121 Ga0068871_100003689 3300006358 Bacteria 10521
122 Ga0068871_100004870 3300006358 Bacteria 9380
123 Ga0068865_100013740 3300006881 Bacteria 5128
124 Ga0068865_100043876 3300006881 Unclassified 3057
125 Ga0068865_100048951 3300006881 Bacteria 2911
126 Ga0097620_100001403 3300006931 Bacteria 24458
127 Ga0097620_100009952 3300006931 Bacteria 9590
128 Ga0097620_100015704 3300006931 Bacteria 7609
129 Ga0097620_100622770 3300006931 Bacteria 1172
130 Ga0105251_10026326 3300009011 Bacteria 2962
131 Ga0105240_10006602 3300009093 Bacteria 17029
132 Ga0105240_10059560 3300009093 Bacteria 4764
133 Ga0105240_10067025 3300009093 Bacteria 4451
134 Ga0105240_10250767 3300009093 Bacteria 2047
135 Ga0111539_10001550 3300009094 Bacteria 30595
136 Ga0105247_10000201 3300009101 Bacteria 58586
137 Ga0105243_10262935 3300009148 Bacteria 1546
138 Ga0105243_10303190 3300009148 Bacteria 1449
139 Ga0105241_10000280 3300009174 Bacteria 38076
140 Ga0105241_10034086 3300009174 Bacteria 3824
141 Ga0105241_10115713 3300009174 Bacteria 2153
142 Ga0105242_10019434 3300009176 Bacteria 5323
143 Ga0105242_10062567 3300009176 Unclassified 3063
144 Ga0105242_10107032 3300009176 Bacteria 2378
145 Ga0105248_10010523 3300009177 Bacteria 10190
146 Ga0105248_10201549 3300009177 Bacteria 2242
147 Ga0105248_10311372 3300009177 Bacteria 1773
148 Ga0105237_10000537 3300009545 Bacteria 53507
149 Ga0105237_10001235 3300009545 Bacteria 34083
150 Ga0105249_10003481 3300009553 Bacteria 13640
151 Ga0105239_10000183 3300010375 Bacteria 91439
152 Ga0105246_10001938 3300011119 Bacteria 12496
153 Ga0105246_10159029 3300011119 Bacteria 1719
154 Ga0157373_10001449 3300013100 Bacteria 18131
155 Ga0157373_10070328 3300013100 Bacteria 2473
156 Ga0157371_10001484 3300013102 Bacteria 24264
157 Ga0157371_10001648 3300013102 Bacteria 22775
158 Ga0157371_10047115 3300013102 Bacteria 3064
159 Ga0157371_10077464 3300013102 Unclassified 2354
160 Ga0157370_10000856 3300013104 Bacteria 38622
161 Ga0157370_10001574 3300013104 Bacteria 28236
162 Ga0157370_10002740 3300013104 Bacteria 21074
163 Ga0157370_10003842 3300013104 Bacteria 17514
164 Ga0157369_10084912 3300013105 Bacteria 3383
165 Ga0157369_10382200 3300013105 Bacteria 1461
166 Ga0157374_10090073 3300013296 Bacteria 2924
167 Ga0157378_10005974 3300013297 Bacteria 10671
168 Ga0157378_10016881 3300013297 Bacteria 6398
169 Ga0157378_10037125 3300013297 Bacteria 4314
170 Ga0157378_10303719 3300013297 Bacteria 1545
171 Ga0163162_10001079 3300013306 Bacteria 25355
172 Ga0163162_10004292 3300013306 Bacteria 13714
173 Ga0163162_10022303 3300013306 Bacteria 6241
174 Ga0163162_10066083 3300013306 Bacteria 3665
175 Ga0163162_10117599 3300013306 Bacteria 2760
176 Ga0163162_10314170 3300013306 Bacteria 1699
177 Ga0157372_10002919 3300013307 Bacteria 18469
178 Ga0157372_10047756 3300013307 Bacteria 4758
179 Ga0157372_10194007 3300013307 Unclassified 2353
180 Ga0157372_10244444 3300013307 Unclassified 2082
181 Ga0157375_10000134 3300013308 Bacteria 73895
182 Ga0157375_10059458 3300013308 Bacteria 3787
183 Ga0163163_10000015 3300014325 Bacteria 214881
184 Ga0163163_10006638 3300014325 Bacteria 10134
185 Ga0163163_10330813 3300014325 Bacteria 1578
186 Ga0163163_10567645 3300014325 Bacteria 1197
187 Ga0157380_10005157 3300014326 Bacteria 9133
188 Ga0157380_10055601 3300014326 Unclassified 3144
189 Ga0157380_10133004 3300014326 Bacteria 2125
190 Ga0157380_10357993 3300014326 Bacteria 1368
191 Ga0157377_10000311 3300014745 Bacteria 22398
192 Ga0157379_10000110 3300014968 Bacteria 56593
193 Ga0157379_10006276 3300014968 Bacteria 10237
194 Ga0157379_10009068 3300014968 Bacteria 8668
195 Ga0157379_10298727 3300014968 Bacteria 1467
196 Ga0157376_10000541 3300014969 Bacteria 24295
197 Ga0157376_10148220 3300014969 Unclassified 2113
198 Ga0157376_10243904 3300014969 Bacteria 1675
199 Ga0163161_10007741 3300017792 Bacteria 7430
200 Ga0163161_10057037 3300017792 Bacteria 2838
201 Ga0163161_10196427 3300017792 Bacteria 1553
202 Ga0163161_10236827 3300017792 Bacteria 1418
203 Ga0163161_10313385 3300017792 Bacteria 1238
204 Ga0209148_1008143 3300025254 Bacteria 2123
205 Ga0207697_10000437 3300025315 Bacteria 23468
206 Ga0207697_10017570 3300025315 Bacteria 2938
207 Ga0207642_10046610 3300025899 Bacteria 1933
208 Ga0207710_10028214 3300025900 Bacteria 2436
209 Ga0207688_10041181 3300025901 Bacteria 2568
210 Ga0207680_10000312 3300025903 Bacteria 23192
211 Ga0207680_10125939 3300025903 Bacteria 1682
212 Ga0207647_10005462 3300025904 Bacteria 9316
213 Ga0207645_10000284 3300025907 Bacteria 42247
214 Ga0207643_10011045 3300025908 Bacteria 4874
215 Ga0207643_10198473 3300025908 Bacteria 1221
216 Ga0207705_10008486 3300025909 Bacteria 7498
217 Ga0207705_10084100 3300025909 Bacteria 2323
218 Ga0207654_10000120 3300025911 Bacteria 50396
219 Ga0207654_10045114 3300025911 Bacteria 2507
220 Ga0207654_10057552 3300025911 Bacteria 2259
221 Ga0207707_10000631 3300025912 Bacteria 34920
222 Ga0207707_10016682 3300025912 Bacteria 6403
223 Ga0207695_10011891 3300025913 Bacteria 10490
224 Ga0207695_10031660 3300025913 Bacteria 5797
225 Ga0207695_10082686 3300025913 Bacteria 3245
226 Ga0207671_10000317 3300025914 Bacteria 71183
227 Ga0207671_10000731 3300025914 Bacteria 41649
228 Ga0207660_10001090 3300025917 Bacteria 18108
229 Ga0207660_10002006 3300025917 Bacteria 13540
230 Ga0207657_10010351 3300025919 Bacteria 9307
231 Ga0207657_10016518 3300025919 Bacteria 7119
232 Ga0207657_10119170 3300025919 Bacteria 2172
233 Ga0207652_10000699 3300025921 Bacteria 32535
234 Ga0207652_10003036 3300025921 Bacteria 13994
235 Ga0207652_10209724 3300025921 Bacteria 1754
236 Ga0207681_10000046 3300025923 Bacteria 127902
237 Ga0207681_10004689 3300025923 Bacteria 8413
238 Ga0207681_10115436 3300025923 Bacteria 1960
239 Ga0207681_10207238 3300025923 Bacteria 1509
240 Ga0207694_10227712 3300025924 Bacteria 1522
241 Ga0207650_10000733 3300025925 Bacteria 25257
242 Ga0207650_10010731 3300025925 Bacteria 6289
243 Ga0207650_10275516 3300025925 Bacteria 1368
244 Ga0207659_10034920 3300025926 Bacteria 3472
245 Ga0207659_10044093 3300025926 Bacteria 3136
246 Ga0207659_10087102 3300025926 Bacteria 2324
247 Ga0207644_10000038 3300025931 Bacteria 121482
248 Ga0207644_10031586 3300025931 Bacteria 3691
249 Ga0207690_10000111 3300025932 Bacteria 66639
250 Ga0207690_10001855 3300025932 Bacteria 12992
251 Ga0207706_10272816 3300025933 Bacteria 1476
252 Ga0207686_10154105 3300025934 Bacteria 1603
253 Ga0207709_10160468 3300025935 Bacteria 1567
254 Ga0207669_10036983 3300025937 Bacteria 2796
255 Ga0207704_10035912 3300025938 Unclassified 2846
256 Ga0207691_10008598 3300025940 Bacteria 9794
257 Ga0207691_10080937 3300025940 Bacteria 2920
258 Ga0207691_10128611 3300025940 Bacteria 2239
259 Ga0207691_10162936 3300025940 Bacteria 1955
260 Ga0207711_10049910 3300025941 Unclassified 3582
261 Ga0207711_10200247 3300025941 Bacteria 1822
262 Ga0207689_10007607 3300025942 Bacteria 9491
263 Ga0207689_10046840 3300025942 Bacteria 3572
264 Ga0207661_10245540 3300025944 Unclassified 1590
265 Ga0207679_10348416 3300025945 Unclassified 1290
266 Ga0207679_10443482 3300025945 Bacteria 1150
267 Ga0207667_10001956 3300025949 Bacteria 25826
268 Ga0207667_10005266 3300025949 Bacteria 15779
269 Ga0207667_10045683 3300025949 Bacteria 4638
270 Ga0207667_10072113 3300025949 Unclassified 3590
271 Ga0207712_10151898 3300025961 Bacteria 1790
272 Ga0207712_10340009 3300025961 Bacteria 1244
273 Ga0207668_10000374 3300025972 Bacteria 28432
274 Ga0207668_10111090 3300025972 Unclassified 2057
275 Ga0207668_10120850 3300025972 Bacteria 1983
276 Ga0207668_10223365 3300025972 Bacteria 1514
277 Ga0207658_10005205 3300025986 Bacteria 8952
278 Ga0207658_10010771 3300025986 Bacteria 6220
279 Ga0207658_10063569 3300025986 Bacteria 2766
280 Ga0207658_10109216 3300025986 Unclassified 2183
281 Ga0207639_10003077 3300026041 Bacteria 11210
282 Ga0207678_10359062 3300026067 Bacteria 1257
283 Ga0207708_10139410 3300026075 Bacteria 1901
284 Ga0207702_10021449 3300026078 Bacteria 5348
285 Ga0207641_10014884 3300026088 Bacteria 6377
286 Ga0207648_10000383 3300026089 Bacteria 48959
287 Ga0207648_10001646 3300026089 Bacteria 24478
288 Ga0207648_10012793 3300026089 Bacteria 7840
289 Ga0207648_10013131 3300026089 Bacteria 7720
290 Ga0207648_10255834 3300026089 Bacteria 1562
291 Ga0207676_10066320 3300026095 Bacteria 2878
292 Ga0207674_10010972 3300026116 Bacteria 10196
293 Ga0207674_10037715 3300026116 Bacteria 5023
294 Ga0207675_100000095 3300026118 Bacteria 70192
295 Ga0207675_100000591 3300026118 Bacteria 35514
296 Ga0207683_10002635 3300026121 Bacteria 15683
297 Ga0207683_10157525 3300026121 Unclassified 2051
298 Ga0207698_10060878 3300026142 Bacteria 2938
299 Ga0268266_10000002 3300028379 Bacteria 3059047
300 Ga0268266_10000005 3300028379 Bacteria 1448194
301 Ga0268265_10027484 3300028380 Bacteria 4062
302 Ga0268264_10000406 3300028381 Bacteria 61180
303 Ga0268264_10005375 3300028381 Bacteria 10849
304 Ga0268264_10030701 3300028381 Bacteria 4405
305 Ga0307515_10000290 3300028794 Bacteria 123604
306 Ga0307515_10006021 3300028794 Bacteria 24408
307 Ga0307513_10004546 3300031456 Bacteria 18509
308 Ga0316583_10052666 3300032133 Unclassified 1432
309 Ga0307507_10000032 3300033179 Bacteria 194155
310 Ga0373937_0231338 3300036401 Bacteria 1741
311 Ga0316582_0014897 3300036647 Bacteria 4429
312 Ga0395899_0000002 3300037312 Bacteria 1324310
313 Ga0395899_0001303 3300037312 Bacteria 21529
314 Ga0395899_0006595 3300037312 Bacteria 8994
315 Ga0395899_0139549 3300037312 Bacteria 1725
316 Ga0395900_0003632 3300037418 Bacteria 16587
317 Ga0395900_0007783 3300037418 Bacteria 11055
318 Ga0395900_0142886 3300037418 Bacteria 2449
319 Ga0395898_0002487 3300037466 Bacteria 21674
320 Ga0395898_0005926 3300037466 Bacteria 13129
321 Ga0395898_0079395 3300037466 Bacteria 3165
322 Ga0395905_0040885 3300037471 Bacteria 4350
323 Ga0395905_0782194 3300037471 Bacteria 857
324 Ga0395901_0013481 3300038443 Bacteria 8310
325 Ga0395901_0037736 3300038443 Bacteria 4997
326 Ga0395901_0041501 3300038443 Bacteria 4769
327 Ga0395901_0175163 3300038443 Bacteria 2250
328 Ga0400489_84318 3300039093 Bacteria 12965
329 Ga0466963_0126664 3300044694 Bacteria 1761
330 Ga0453684_0001296 3300044712 Bacteria 74312
331 Ga0453684_0003472 3300044712 Bacteria 35393
332 Ga0453684_0029629 3300044712 Bacteria 7761
333 Ga0453684_0168717 3300044712 Bacteria 2581
334 Ga0453684_0655224 3300044712 Bacteria 1145
335 Ga0466967_0228996 3300045976 Bacteria 1769
336 Ga0495629_0024999 3300046459 Bacteria 4249
337 Ga0495650_0040967 3300046471 Bacteria 1984
338 Ga0495585_0000596 3300046492 Bacteria 33838
339 Ga0495583_0040354 3300046506 Bacteria 2193
340 Ga0495583_0075369 3300046506 Bacteria 1475
341 Ga0495606_0098216 3300046507 Unclassified 1787
342 Ga0495620_0023611 3300046515 Bacteria 2938
343 Ga0495631_0022500 3300046518 Bacteria 2930
344 Ga0495637_0007136 3300046520 Bacteria 5562
345 Ga0495648_0000357 3300046524 Bacteria 50228
346 Ga0495648_0000851 3300046524 Bacteria 32195
347 Ga0495663_0000423 3300046525 Bacteria 15423
348 Ga0495611_0008832 3300046648 Bacteria 4260
349 Ga0495625_0000534 3300046660 Bacteria 55918
350 Ga0495625_0000907 3300046660 Bacteria 39912
351 Ga0495625_0008837 3300046660 Bacteria 8526
352 Ga0495625_0192166 3300046660 Bacteria 1351
353 Ga0495658_0006565 3300046683 Bacteria 5714
354 Ga0495669_0000258 3300046684 Bacteria 30670
355 Ga0495670_0036247 3300046691 Unclassified 2458
356 Ga0495649_0011886 3300046694 Bacteria 5089
357 Ga0495683_0000657 3300047323 Bacteria 25619
358 Ga0495687_000240 3300047443 Bacteria 75621
359 Ga0495677_0058206 3300047445 Bacteria 1429
360 Ga0495681_0001387 3300047470 Bacteria 18289
361 Ga0496100_0063963 3300048903 Unclassified 2433
362 Ga0496102_0184650 3300048905 Unclassified 1965
363 Ga0496104_0135741 3300048907 Unclassified 2364
364 Ga0496105_0412113 3300048908 Unclassified 1071
365 Ga0496109_0102362 3300048912 Bacteria 2658
366 Ga0496109_0457123 3300048912 Bacteria 1206
367 Ga0496115_0026214 3300048918 Bacteria 4547
368 Ga0496117_0010493 3300048920 Bacteria 8432
369 Ga0496118_0019011 3300048921 Bacteria 6159
370 Ga0496121_0000650 3300048924 Bacteria 65007
371 Ga0496126_0006072 3300048929 Bacteria 13556
372 Ga0495682_0004988 3300049460 Bacteria 5580
373 Ga0501034_0059815 3300049571 Bacteria 3827
374 Ga0501037_0288900 3300049573 Bacteria 1141
375 Ga0501039_0014838 3300049575 Bacteria 5957
376 Ga0501047_0290758 3300049581 Unclassified 1478
377 Ga0501048_0189699 3300049582 Unclassified 1457
378 Ga0501067_0028046 3300049583 Bacteria 3120
379 Ga0501073_0052185 3300049589 Bacteria 2863
380 Ga0501079_0027137 3300049741 Bacteria 4390
381 Ga0501080_0010707 3300049742 Bacteria 8390
382 Ga0501080_0083667 3300049742 Bacteria 2964
383 Ga0501080_0171775 3300049742 Bacteria 1999
384 Ga0501044_0012801 3300049823 Bacteria 9085
385 Ga0501044_0344046 3300049823 Bacteria 1412
386 nmdc:mga0k408_85_c1 3300050493 Bacteria 43890
387 nmdc:mga07m45_39190_c1 3300050496 Bacteria 2043
388 nmdc:mga08y16_111002_c1 3300050511 Bacteria 2855
389 Ga0500610_0000214 3300053079 Bacteria 17753
390 Ga0500595_000740 3300053119 Bacteria 19333
391 Ga0500642_0000431 3300053130 Bacteria 13565
392 Ga0500564_034159 3300053138 Bacteria 2347
393 Ga0500645_000134 3300053730 Bacteria 58275
394 Ga0501084_0054360 3300054114 Bacteria 3349
395 Ga0501082_0050294 3300060353 Bacteria 3594
396 2739645518 2739367663 Bacteria 5040914
397 Ga0157374_10031863
398 JGI24739J22299_10001305
399 JGI24737J22298_10008241
400 rootH2_10009740
401 rootL2_10001297
402 rootH1_10220272
403 Ga0065707_10010337
404 Ga0070658_10018520
405 Ga0070658_10067345
406 Ga0070676_10036177
407 Ga0070676_10200450
408 Ga0070670_100006525
409 Ga0070670_100025102
410 Ga0070670_100335817
411 Ga0070677_10003384
412 Ga0068869_100007517
413 Ga0068869_100080859
414 Ga0068869_100093771
415 Ga0070680_100000692
416 Ga0070680_100011897
417 Ga0070680_100268514
418 Ga0070680_100298771
419 Ga0070680_100356391
420 Ga0070682_100005892
421 Ga0070682_100197119
422 Ga0070682_100360244
423 Ga0070660_100134691
424 Ga0070660_100184663
425 Ga0070660_100263966
426 Ga0070691_10003367
427 Ga0070668_100008222
428 Ga0070668_100052518
429 Ga0070668_100075776
430 Ga0070668_100076297
431 Ga0070669_100000136
432 Ga0070669_100036725
433 Ga0070669_100145150
434 Ga0070675_100001894
435 Ga0070675_100042147
436 Ga0070675_100081016
437 Ga0070671_100000081
438 Ga0070671_100209611
439 Ga0070674_100006908
440 Ga0070673_100114507
441 Ga0070673_100194933
442 Ga0070673_100222602
443 Ga0070659_100000272
444 Ga0070659_100001005
445 Ga0070659_100016708
446 Ga0070659_100039938
447 Ga0070659_100139211
448 Ga0070659_100330090
449 Ga0070667_100031587
450 Ga0070713_100341097
451 Ga0070705_100126140
452 Ga0070678_100060883
453 Ga0070662_100005831
454 Ga0070662_100150956
455 Ga0070681_10004949
456 Ga0070681_10216878
457 Ga0068867_100007630
458 Ga0068867_100011441
459 Ga0068867_100025712
460 Ga0068867_100037533
461 Ga0068867_100072115
462 Ga0068867_100178058
463 Ga0068867_100324946
464 Ga0070679_100006735
465 Ga0070679_100018081
466 Ga0070679_100034023
467 Ga0070679_100040794
468 Ga0068853_100055061
469 Ga0070672_100017424
470 Ga0070693_100003112
471 Ga0070665_100000015
472 Ga0070665_100000023
473 Ga0070665_100010440
474 Ga0068855_100001030
475 Ga0068855_100011886
476 Ga0068855_100037474
477 Ga0070664_100039592
478 Ga0070664_100265418
479 Ga0070664_100559296
480 Ga0068857_100029318
481 Ga0068857_100202064
482 Ga0068856_100018206
483 Ga0068856_100075927
484 Ga0068852_100079718
485 Ga0068859_100009953
486 Ga0068859_100015705
487 Ga0068859_100622725
488 Ga0068864_100018220
489 Ga0068864_100032702
490 Ga0068864_100277147
491 Ga0068866_10003816
492 Ga0068866_10109882
493 Ga0068861_100004899
494 Ga0068861_100007705
495 Ga0068851_10015319
496 Ga0068870_10003398
497 Ga0068870_10016500
498 Ga0068863_100003020
499 Ga0068863_100449802
500 Ga0068858_100009404
501 Ga0068860_100001140
502 Ga0068860_100001966
503 Ga0068860_100058350
504 Ga0068862_100000876
505 Ga0068862_100001498
506 Ga0068862_100003597
507 Ga0081539_10000761
508 Ga0075366_10000031
509 Ga0097621_100000187
510 Ga0097621_100000633
511 Ga0097621_100003629
512 Ga0097621_100042264
513 Ga0075370_10117288
514 Ga0075370_10283516
515 Ga0068871_100000065
516 Ga0068871_100001972
517 Ga0068871_100003689
518 Ga0068871_100004870
519 Ga0068865_100013740
520 Ga0068865_100043876
521 Ga0068865_100048951
522 Ga0097620_100001403
523 Ga0097620_100009952
524 Ga0097620_100015704
525 Ga0097620_100622770
526 Ga0105251_10026326
527 Ga0105240_10006602
528 Ga0105240_10059560
529 Ga0105240_10067025
530 Ga0105240_10250767
531 Ga0111539_10001550
532 Ga0105247_10000201
533 Ga0105243_10262935
534 Ga0105243_10303190
535 Ga0105241_10000280
536 Ga0105241_10034086
537 Ga0105241_10115713
538 Ga0105242_10019434
539 Ga0105242_10062567
540 Ga0105242_10107032
541 Ga0105248_10010523
542 Ga0105248_10201549
543 Ga0105248_10311372
544 Ga0105237_10000537
545 Ga0105237_10001235
546 Ga0105249_10003481
547 Ga0105239_10000183
548 Ga0105246_10001938
549 Ga0105246_10159029
550 Ga0157373_10001449
551 Ga0157373_10070328
552 Ga0157371_10001484
553 Ga0157371_10001648
554 Ga0157371_10047115
555 Ga0157371_10077464
556 Ga0157370_10000856
557 Ga0157370_10001574
558 Ga0157370_10002740
559 Ga0157370_10003842
560 Ga0157369_10084912
561 Ga0157369_10382200
562 Ga0157374_10090073
563 Ga0157378_10005974
564 Ga0157378_10016881
565 Ga0157378_10037125
566 Ga0157378_10303719
567 Ga0163162_10001079
568 Ga0163162_10004292
569 Ga0163162_10022303
570 Ga0163162_10066083
571 Ga0163162_10117599
572 Ga0163162_10314170
573 Ga0157372_10002919
574 Ga0157372_10047756
575 Ga0157372_10194007
576 Ga0157372_10244444
577 Ga0157375_10000134
578 Ga0157375_10059458
579 Ga0163163_10000015
580 Ga0163163_10006638
581 Ga0163163_10330813
582 Ga0163163_10567645
583 Ga0157380_10005157
584 Ga0157380_10055601
585 Ga0157380_10133004
586 Ga0157380_10357993
587 Ga0157377_10000311
588 Ga0157379_10000110
589 Ga0157379_10006276
590 Ga0157379_10009068
591 Ga0157379_10298727
592 Ga0157376_10000541
593 Ga0157376_10148220
594 Ga0157376_10243904
595 Ga0163161_10007741
596 Ga0163161_10057037
597 Ga0163161_10196427
598 Ga0163161_10236827
599 Ga0163161_10313385
600 Ga0209148_1008143
601 Ga0207697_10000437
602 Ga0207697_10017570
603 Ga0207642_10046610
604 Ga0207710_10028214
605 Ga0207688_10041181
606 Ga0207680_10000312
607 Ga0207680_10125939
608 Ga0207647_10005462
609 Ga0207645_10000284
610 Ga0207643_10011045
611 Ga0207643_10198473
612 Ga0207705_10008486
613 Ga0207705_10084100
614 Ga0207654_10000120
615 Ga0207654_10045114
616 Ga0207654_10057552
617 Ga0207707_10000631
618 Ga0207707_10016682
619 Ga0207695_10011891
620 Ga0207695_10031660
621 Ga0207695_10082686
622 Ga0207671_10000317
623 Ga0207671_10000731
624 Ga0207660_10001090
625 Ga0207660_10002006
626 Ga0207657_10010351
627 Ga0207657_10016518
628 Ga0207657_10119170
629 Ga0207652_10000699
630 Ga0207652_10003036
631 Ga0207652_10209724
632 Ga0207681_10000046
633 Ga0207681_10004689
634 Ga0207681_10115436
635 Ga0207681_10207238
636 Ga0207694_10227712
637 Ga0207650_10000733
638 Ga0207650_10010731
639 Ga0207650_10275516
640 Ga0207659_10034920
641 Ga0207659_10044093
642 Ga0207659_10087102
643 Ga0207644_10000038
644 Ga0207644_10031586
645 Ga0207690_10000111
646 Ga0207690_10001855
647 Ga0207706_10272816
648 Ga0207686_10154105
649 Ga0207709_10160468
650 Ga0207669_10036983
651 Ga0207704_10035912
652 Ga0207691_10008598
653 Ga0207691_10080937
654 Ga0207691_10128611
655 Ga0207691_10162936
656 Ga0207711_10049910
657 Ga0207711_10200247
658 Ga0207689_10007607
659 Ga0207689_10046840
660 Ga0207661_10245540
661 Ga0207679_10348416
662 Ga0207679_10443482
663 Ga0207667_10001956
664 Ga0207667_10005266
665 Ga0207667_10045683
666 Ga0207667_10072113
667 Ga0207712_10151898
668 Ga0207712_10340009
669 Ga0207668_10000374
670 Ga0207668_10111090
671 Ga0207668_10120850
672 Ga0207668_10223365
673 Ga0207658_10005205
674 Ga0207658_10010771
675 Ga0207658_10063569
676 Ga0207658_10109216
677 Ga0207639_10003077
678 Ga0207678_10359062
679 Ga0207708_10139410
680 Ga0207702_10021449
681 Ga0207641_10014884
682 Ga0207648_10000383
683 Ga0207648_10001646
684 Ga0207648_10012793
685 Ga0207648_10013131
686 Ga0207648_10255834
687 Ga0207676_10066320
688 Ga0207674_10010972
689 Ga0207674_10037715
690 Ga0207675_100000095
691 Ga0207675_100000591
692 Ga0207683_10002635
693 Ga0207683_10157525
694 Ga0207698_10060878
695 Ga0268266_10000002
696 Ga0268266_10000005
697 Ga0268265_10027484
698 Ga0268264_10000406
699 Ga0268264_10005375
700 Ga0268264_10030701
701 Ga0307515_10000290
702 Ga0307515_10006021
703 Ga0307513_10004546
704 Ga0316583_10052666
705 Ga0307507_10000032
706 Ga0373937_0231338
707 Ga0316582_0014897
708 Ga0395899_0000002
709 Ga0395899_0001303
710 Ga0395899_0006595
711 Ga0395899_0139549
712 Ga0395900_0003632
713 Ga0395900_0007783
714 Ga0395900_0142886
715 Ga0395898_0002487
716 Ga0395898_0005926
717 Ga0395898_0079395
718 Ga0395905_0040885
719 Ga0395905_0782194
720 Ga0395901_0013481
721 Ga0395901_0037736
722 Ga0395901_0041501
723 Ga0395901_0175163
724 Ga0400489_84318
725 Ga0466963_0126664
726 Ga0453684_0001296
727 Ga0453684_0003472
728 Ga0453684_0029629
729 Ga0453684_0168717
730 Ga0453684_0655224
731 Ga0466967_0228996
732 Ga0495629_0024999
733 Ga0495650_0040967
734 Ga0495585_0000596
735 Ga0495583_0040354
736 Ga0495583_0075369
737 Ga0495606_0098216
738 Ga0495620_0023611
739 Ga0495631_0022500
740 Ga0495637_0007136
741 Ga0495648_0000357
742 Ga0495648_0000851
743 Ga0495663_0000423
744 Ga0495611_0008832
745 Ga0495625_0000534
746 Ga0495625_0000907
747 Ga0495625_0008837
748 Ga0495625_0192166
749 Ga0495658_0006565
750 Ga0495669_0000258
751 Ga0495670_0036247
752 Ga0495649_0011886
753 Ga0495683_0000657
754 Ga0495687_000240
755 Ga0495677_0058206
756 Ga0495681_0001387
757 Ga0496100_0063963
758 Ga0496102_0184650
759 Ga0496104_0135741
760 Ga0496105_0412113
761 Ga0496109_0102362
762 Ga0496109_0457123
763 Ga0496115_0026214
764 Ga0496117_0010493
765 Ga0496118_0019011
766 Ga0496121_0000650
767 Ga0496126_0006072
768 Ga0495682_0004988
769 Ga0501034_0059815
770 Ga0501037_0288900
771 Ga0501039_0014838
772 Ga0501047_0290758
773 Ga0501048_0189699
774 Ga0501067_0028046
775 Ga0501073_0052185
776 Ga0501079_0027137
777 Ga0501080_0010707
778 Ga0501080_0083667
779 Ga0501080_0171775
780 Ga0501044_0012801
781 Ga0501044_0344046
782 nmdc:mga0k408_85_c1
783 nmdc:mga07m45_39190_c1
784 nmdc:mga08y16_111002_c1
785 Ga0500610_0000214
786 Ga0500595_000740
787 Ga0500642_0000431
788 Ga0500564_034159
789 Ga0500645_000134
790 Ga0501084_0054360
791 Ga0501082_0050294
792 2739645518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4exb-assembly2.cif.gz_C putative aldo-keto reductase from pseudomona aeruginosa 0.7713 1 284
4exb-assembly2.cif.gz_F putative aldo-keto reductase from pseudomona aeruginosa 0.7668 1 284
4exb-assembly1.cif.gz_A putative aldo-keto reductase from pseudomona aeruginosa 0.7634 1 284
4exb-assembly3.cif.gz_E putative aldo-keto reductase from pseudomona aeruginosa 0.7571 1 284
4exa-assembly1.cif.gz_B crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.7557 1 284
ID Description Score Start End Superfamily
4exaF00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7459 1 284 3.20.20.100
4exaF00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.6812 1 284 3.20.20.100
af_Q2G2T8_4_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.6726 1 286 3.20.20.100
af_Q58328_1_266_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6602 2 281 3.20.20.70
af_Q2G0K7_1_209_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6514 2 286 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A849G6T1-F1-model_v4 Uncharacterized protein 0.9723 1 83
AF-A0A1V6AYN9-F1-model_v4 Uncharacterized protein 0.9531 158 284
AF-A0A849G6T1-F1-model_v4 Uncharacterized protein 0.9497 1 83
AF-A0A7K3IUI3-F1-model_v4 Uncharacterized protein 0.9492 178 285
AF-A0A2D6IW55-F1-model_v4 Uncharacterized protein 0.9491 1 285

Map