F433563

General Info

Members Datasets Scaffolds Average Seq Length
396 258 792 349

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0034834|Ga0395899_0034834_2427_3422
Length 315
Sequence MGANLVRRLMRDGHDCVVYDVSPEVVASLEGEGATGSESLEDFVSKLDKPRVAWVMIPAGITGRIVDELASYMEKGDIIIDGGNSYYRDDIERAKALKPKGIHYVDIGTSGGVFGLERGFCLMVGGEKKVVRHLDPILKSIAPGAAEEGYLHCGPSGAGHFVKMVHNGIEYGIMAAYAEGLNVIHRANAGKEEVETSAEIAPLQEPEYYQYDIDVGEVAEVWRRGSVVSSWLLDLTAQALQSSPDLSDFGGRVSDSGEGRWTIRAAIDEGVPVPVLTAALYQRFSSRGESQYADQLLSAMRQAFGGHLELAHAGA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
148 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
149 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 2643221553 Microbacterium sp. Root553 Isolate Unclassified
231 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
232 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
233 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
234 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
235 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
236 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
237 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
238 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
239 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
240 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
241 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
242 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
243 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
244 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
245 2919069694 Microbacterium sp. 1154 Isolate Unclassified
246 2919395869 Microbacterium resistens 2980 Isolate Unclassified
247 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
248 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
249 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
250 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
251 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
252 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
253 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
254 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
255 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
256 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
257 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
258 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.68
Metatranscriptomes 0
Isolates 7.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 8.59
Rhizosphere 78.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0034834 3300037312 Bacteria 3781
2 JGI24740J21852_10014284 3300001979 Bacteria 2933
3 JGI25407J50210_10020279 3300003373 Bacteria 1729
4 Ga0070676_10094186 3300005328 Bacteria 1840
5 Ga0070690_100187847 3300005330 Bacteria 1431
6 Ga0068869_100030348 3300005334 Bacteria 3794
7 Ga0068869_100211874 3300005334 Bacteria 1532
8 Ga0070666_10014359 3300005335 Bacteria 5041
9 Ga0070680_100029472 3300005336 Bacteria 4409
10 Ga0070682_100004975 3300005337 Bacteria 7383
11 Ga0070682_100148526 3300005337 Bacteria 1605
12 Ga0070682_100148664 3300005337 Bacteria 1605
13 Ga0068868_100130966 3300005338 Bacteria 2052
14 Ga0070660_100018099 3300005339 Bacteria 5141
15 Ga0070689_100322424 3300005340 Bacteria 1290
16 Ga0070687_100067482 3300005343 Bacteria 1909
17 Ga0070692_10005138 3300005345 Bacteria 5540
18 Ga0070668_100051394 3300005347 Bacteria 3176
19 Ga0070668_100085704 3300005347 Bacteria 2476
20 Ga0070668_100209534 3300005347 Bacteria 1603
21 Ga0070675_100099331 3300005354 Bacteria 2450
22 Ga0070671_100010548 3300005355 Bacteria 7419
23 Ga0070671_100114686 3300005355 Bacteria 2265
24 Ga0070673_100030027 3300005364 Bacteria 4062
25 Ga0070659_100042111 3300005366 Bacteria 3570
26 Ga0070659_100151844 3300005366 Bacteria 1890
27 Ga0070659_100163727 3300005366 Bacteria 1819
28 Ga0070667_100015169 3300005367 Bacteria 6365
29 Ga0070703_10003622 3300005406 Bacteria 4389
30 Ga0070709_10013010 3300005434 Bacteria 4669
31 Ga0070713_100130250 3300005436 Bacteria 2217
32 Ga0070700_100033703 3300005441 Bacteria 3086
33 Ga0070708_100015741 3300005445 Bacteria 6251
34 Ga0070662_100007456 3300005457 Bacteria 7091
35 Ga0068867_100220617 3300005459 Bacteria 1528
36 Ga0068853_100063866 3300005539 Bacteria 3190
37 Ga0070696_100039845 3300005546 Bacteria 3244
38 Ga0070665_100006368 3300005548 Bacteria 12036
39 Ga0070665_100164661 3300005548 Bacteria 2220
40 Ga0070704_100022269 3300005549 Bacteria 4121
41 Ga0068854_100005307 3300005578 Bacteria 8133
42 Ga0068854_100270644 3300005578 Bacteria 1364
43 Ga0070702_100158160 3300005615 Bacteria 1461
44 Ga0068852_100067482 3300005616 Bacteria 3127
45 Ga0068859_100022717 3300005617 Bacteria 6289
46 Ga0068864_100006230 3300005618 Bacteria 9784
47 Ga0068861_100026168 3300005719 Bacteria 4240
48 Ga0068861_100148232 3300005719 Bacteria 1923
49 Ga0068870_10079676 3300005840 Bacteria 1807
50 Ga0068870_10250478 3300005840 Bacteria 1098
51 Ga0068863_100007875 3300005841 Bacteria 10420
52 Ga0068863_100012826 3300005841 Bacteria 8083
53 Ga0068858_100037309 3300005842 Bacteria 4507
54 Ga0068858_100051818 3300005842 Bacteria 3797
55 Ga0068860_100000129 3300005843 Bacteria 122623
56 Ga0068860_100098900 3300005843 Bacteria 2782
57 Ga0068860_100099776 3300005843 Bacteria 2769
58 Ga0068862_100009213 3300005844 Bacteria 8177
59 Ga0068862_100197890 3300005844 Bacteria 1811
60 Ga0081455_10004225 3300005937 Bacteria 16189
61 Ga0081455_10012271 3300005937 Bacteria 8552
62 Ga0081455_10012750 3300005937 Bacteria 8360
63 Ga0081455_10021400 3300005937 Bacteria 6066
64 Ga0081455_10087562 3300005937 Bacteria 2533
65 Ga0081538_10001122 3300005981 Bacteria 28365
66 Ga0081538_10106338 3300005981 Bacteria 1393
67 Ga0070717_10004332 3300006028 Bacteria 10241
68 Ga0075432_10002266 3300006058 Bacteria 6398
69 Ga0075432_10003696 3300006058 Bacteria 5209
70 Ga0070715_10007942 3300006163 Bacteria 3676
71 Ga0070712_100004630 3300006175 Bacteria 8502
72 Ga0097621_100020153 3300006237 Bacteria 5135
73 Ga0075428_100007448 3300006844 Bacteria 12126
74 Ga0075430_100380380 3300006846 Bacteria 1165
75 Ga0075433_10027679 3300006852 Bacteria 4810
76 Ga0075433_10053160 3300006852 Bacteria 3530
77 Ga0075434_100004227 3300006871 Bacteria 12872
78 Ga0075429_100073962 3300006880 Bacteria 2968
79 Ga0068865_100059114 3300006881 Bacteria 2680
80 Ga0075436_100032714 3300006914 Bacteria 3584
81 Ga0097620_100022716 3300006931 Bacteria 6289
82 Ga0075435_100002623 3300007076 Bacteria 11975
83 Ga0111539_10071101 3300009094 Bacteria 4106
84 Ga0105245_10013135 3300009098 Bacteria 7216
85 Ga0105245_10061537 3300009098 Bacteria 3385
86 Ga0105245_10063253 3300009098 Bacteria 3341
87 Ga0105245_10138182 3300009098 Bacteria 2292
88 Ga0105245_10238192 3300009098 Bacteria 1763
89 Ga0114129_10179732 3300009147 Bacteria 2880
90 Ga0105243_10030156 3300009148 Bacteria 4174
91 Ga0105243_10039503 3300009148 Bacteria 3679
92 Ga0105241_10043676 3300009174 Bacteria 3395
93 Ga0105242_10023969 3300009176 Bacteria 4816
94 Ga0105242_10057626 3300009176 Bacteria 3182
95 Ga0105237_10172219 3300009545 Bacteria 2165
96 Ga0105238_10041278 3300009551 Bacteria 4673
97 Ga0105238_10105310 3300009551 Bacteria 2802
98 Ga0105249_10056744 3300009553 Bacteria 3586
99 Ga0105239_10023970 3300010375 Bacteria 6721
100 Ga0105239_10028914 3300010375 Bacteria 6092
101 Ga0157370_10205074 3300013104 Bacteria 1828
102 Ga0157369_10068702 3300013105 Bacteria 3807
103 Ga0157369_10073959 3300013105 Bacteria 3655
104 Ga0157369_10192787 3300013105 Bacteria 2141
105 Ga0171462_1004 3300013250 Bacteria 678877
106 Ga0157378_10262572 3300013297 Bacteria 1657
107 Ga0163162_10043123 3300013306 Bacteria 4516
108 Ga0163162_10080601 3300013306 Bacteria 3323
109 Ga0157372_10064537 3300013307 Bacteria 4108
110 Ga0157372_10190467 3300013307 Bacteria 2376
111 Ga0157372_10257401 3300013307 Bacteria 2026
112 Ga0157375_10473709 3300013308 Bacteria 1417
113 Ga0163163_10216037 3300014325 Bacteria 1966
114 Ga0157380_10079481 3300014326 Bacteria 2678
115 Ga0157377_10199673 3300014745 Bacteria 1269
116 Ga0157379_10017300 3300014968 Bacteria 6352
117 Ga0157379_10020821 3300014968 Bacteria 5804
118 Ga0163161_10003978 3300017792 Bacteria 10351
119 Ga0213876_10086709 3300021384 Bacteria 1657
120 Ga0207656_10090364 3300025321 Bacteria 1389
121 Ga0207692_10022864 3300025898 Bacteria 2883
122 Ga0207642_10012032 3300025899 Bacteria 3110
123 Ga0207642_10107058 3300025899 Bacteria 1416
124 Ga0207710_10027300 3300025900 Bacteria 2471
125 Ga0207680_10004570 3300025903 Bacteria 6571
126 Ga0207647_10016968 3300025904 Bacteria 4957
127 Ga0207647_10082465 3300025904 Bacteria 1926
128 Ga0207645_10076540 3300025907 Bacteria 2143
129 Ga0207643_10214287 3300025908 Bacteria 1176
130 Ga0207654_10030899 3300025911 Bacteria 2945
131 Ga0207693_10004630 3300025915 Bacteria 11604
132 Ga0207662_10043472 3300025918 Bacteria 2650
133 Ga0207657_10003612 3300025919 Bacteria 16487
134 Ga0207694_10092361 3300025924 Bacteria 2389
135 Ga0207694_10098398 3300025924 Bacteria 2316
136 Ga0207687_10068103 3300025927 Bacteria 2535
137 Ga0207687_10078996 3300025927 Bacteria 2371
138 Ga0207700_10084671 3300025928 Bacteria 2486
139 Ga0207644_10013633 3300025931 Bacteria 5424
140 Ga0207690_10028893 3300025932 Bacteria 3518
141 Ga0207706_10006460 3300025933 Bacteria 10886
142 Ga0207706_10144354 3300025933 Bacteria 2094
143 Ga0207686_10015795 3300025934 Bacteria 4231
144 Ga0207709_10089540 3300025935 Bacteria 2007
145 Ga0207704_10046201 3300025938 Bacteria 2593
146 Ga0207704_10116869 3300025938 Bacteria 1816
147 Ga0207665_10000738 3300025939 Bacteria 22007
148 Ga0207711_10063226 3300025941 Bacteria 3194
149 Ga0207689_10009684 3300025942 Bacteria 8298
150 Ga0207667_10351810 3300025949 Bacteria 1502
151 Ga0207651_10011675 3300025960 Bacteria 4929
152 Ga0207712_10019414 3300025961 Bacteria 4438
153 Ga0207712_10161749 3300025961 Bacteria 1741
154 Ga0207668_10059478 3300025972 Bacteria 2678
155 Ga0207640_10005764 3300025981 Bacteria 6753
156 Ga0207658_10017368 3300025986 Bacteria 4957
157 Ga0207677_10196627 3300026023 Bacteria 1599
158 Ga0207703_10010346 3300026035 Bacteria 7301
159 Ga0207703_10154738 3300026035 Bacteria 2002
160 Ga0207639_10151221 3300026041 Bacteria 1944
161 Ga0207678_10021920 3300026067 Bacteria 5600
162 Ga0207678_10162239 3300026067 Bacteria 1909
163 Ga0207708_10015379 3300026075 Bacteria 5740
164 Ga0207702_10029299 3300026078 Bacteria 4580
165 Ga0207702_10240831 3300026078 Bacteria 1695
166 Ga0207641_10001632 3300026088 Bacteria 21867
167 Ga0207641_10059411 3300026088 Bacteria 3256
168 Ga0207648_10065474 3300026089 Bacteria 3168
169 Ga0207648_10289847 3300026089 Bacteria 1465
170 Ga0207676_10314804 3300026095 Bacteria 1434
171 Ga0207675_100008587 3300026118 Bacteria 9607
172 Ga0207675_100016686 3300026118 Bacteria 6857
173 Ga0207675_100033254 3300026118 Bacteria 4805
174 Ga0207683_10003061 3300026121 Bacteria 14623
175 Ga0207698_10051182 3300026142 Bacteria 3156
176 Ga0207428_10000752 3300027907 Bacteria 37021
177 Ga0207428_10006293 3300027907 Bacteria 10976
178 Ga0268266_10000654 3300028379 Bacteria 46877
179 Ga0268266_10009266 3300028379 Bacteria 8683
180 Ga0268265_10017752 3300028380 Bacteria 4919
181 Ga0268265_10474787 3300028380 Bacteria 1173
182 Ga0268264_10000196 3300028381 Bacteria 123687
183 Ga0307405_10004385 3300031731 Bacteria 6663
184 Ga0307413_10000882 3300031824 Bacteria 10597
185 Ga0307413_10087500 3300031824 Bacteria 2018
186 Ga0307410_10000663 3300031852 Bacteria 14246
187 Ga0307410_10006765 3300031852 Bacteria 6217
188 Ga0307410_10266249 3300031852 Bacteria 1339
189 Ga0307406_10000224 3300031901 Bacteria 34452
190 Ga0307406_10000791 3300031901 Bacteria 17697
191 Ga0307406_10001081 3300031901 Bacteria 15166
192 Ga0307406_10051889 3300031901 Bacteria 2606
193 Ga0307406_10071465 3300031901 Bacteria 2274
194 Ga0307407_10001429 3300031903 Bacteria 8638
195 Ga0307407_10026685 3300031903 Bacteria 3062
196 Ga0307407_10036606 3300031903 Bacteria 2705
197 Ga0307412_10033583 3300031911 Bacteria 3263
198 Ga0307412_10045790 3300031911 Bacteria 2862
199 Ga0307409_100000129 3300031995 Bacteria 28229
200 Ga0307409_100150498 3300031995 Bacteria 2019
201 Ga0307409_100191456 3300031995 Bacteria 1821
202 Ga0307409_100273484 3300031995 Bacteria 1557
203 Ga0307416_100000359 3300032002 Bacteria 23730
204 Ga0307416_100023846 3300032002 Bacteria 4451
205 Ga0307414_10046507 3300032004 Bacteria 2979
206 Ga0307411_10077503 3300032005 Bacteria 2275
207 Ga0307411_10121903 3300032005 Bacteria 1888
208 Ga0307415_100001245 3300032126 Bacteria 11957
209 Ga0316212_1003359 3300033547 Bacteria 2309
210 Ga0373939_0021588 3300035114 Bacteria 1764
211 Ga0373931_0060537 3300035691 Bacteria 2038
212 Ga0395900_0001945 3300037418 Bacteria 23361
213 Ga0395898_0003737 3300037466 Bacteria 16877
214 Ga0395905_0025339 3300037471 Bacteria 5593
215 Ga0395901_0002596 3300038443 Bacteria 18307
216 Ga0436365_1448212 3300039437 Bacteria 3250
217 Ga0439448_0061362 3300042005 Bacteria 1243
218 Ga0439455_0025197 3300042012 Bacteria 1444
219 Ga0439440_0001382 3300042993 Bacteria 4404
220 Ga0439440_0001433 3300042993 Bacteria 4325
221 Ga0439440_0026647 3300042993 Bacteria 1339
222 Ga0466972_0056380 3300044658 Bacteria 1889
223 Ga0466972_0082031 3300044658 Bacteria 1535
224 Ga0466965_0007941 3300044683 Bacteria 4893
225 Ga0466965_0011342 3300044683 Bacteria 4175
226 Ga0466966_0022135 3300044684 Bacteria 4173
227 Ga0466966_0040899 3300044684 Bacteria 2981
228 Ga0466966_0056661 3300044684 Bacteria 2479
229 Ga0466961_0005497 3300044693 Bacteria 7991
230 Ga0466961_0015738 3300044693 Bacteria 4854
231 Ga0466963_0082812 3300044694 Bacteria 2175
232 Ga0466963_0083287 3300044694 Bacteria 2169
233 Ga0453684_0023409 3300044712 Bacteria 9101
234 Ga0466971_0021366 3300044719 Bacteria 2881
235 Ga0466968_0039219 3300044735 Bacteria 1993
236 Ga0466968_0098806 3300044735 Bacteria 1301
237 Ga0466970_0001330 3300044765 Bacteria 11944
238 Ga0466970_0035459 3300044765 Bacteria 2642
239 Ga0466970_0037447 3300044765 Bacteria 2571
240 Ga0466970_0087800 3300044765 Bacteria 1687
241 Ga0466957_0017657 3300044842 Bacteria 4184
242 Ga0466960_0028211 3300044901 Bacteria 2567
243 Ga0466959_0010181 3300045049 Bacteria 6713
244 Ga0466959_0020485 3300045049 Bacteria 4873
245 Ga0466959_0151591 3300045049 Bacteria 1634
246 Ga0451576_0077601 3300045051 Bacteria 3457
247 Ga0466958_0003821 3300045836 Bacteria 7864
248 Ga0466958_0043369 3300045836 Bacteria 2709
249 Ga0466958_0132611 3300045836 Bacteria 1565
250 Ga0466967_0000679 3300045976 Bacteria 17246
251 Ga0466967_0027233 3300045976 Bacteria 4752
252 Ga0466967_0044509 3300045976 Bacteria 3851
253 Ga0466967_0145893 3300045976 Bacteria 2208
254 Ga0466967_0218641 3300045976 Bacteria 1809
255 Ga0466967_0351009 3300045976 Bacteria 1428
256 Ga0466967_0442311 3300045976 Bacteria 1270
257 Ga0495653_0026341 3300046463 Bacteria 4662
258 Ga0495631_0018183 3300046518 Bacteria 3313
259 Ga0495645_0111146 3300046543 Bacteria 1939
260 Ga0496100_0096225 3300048903 Bacteria 2031
261 Ga0496101_0487606 3300048904 Bacteria 973
262 Ga0496102_0047791 3300048905 Bacteria 3890
263 Ga0496103_0075108 3300048906 Bacteria 2119
264 Ga0496104_0006628 3300048907 Bacteria 10190
265 Ga0496104_0041487 3300048907 Bacteria 4315
266 Ga0496104_0045048 3300048907 Bacteria 4147
267 Ga0496104_0125751 3300048907 Bacteria 2462
268 Ga0496105_0002878 3300048908 Bacteria 12608
269 Ga0496105_0112138 3300048908 Bacteria 2250
270 Ga0496105_0262972 3300048908 Bacteria 1395
271 Ga0496107_0013942 3300048910 Bacteria 5622
272 Ga0496108_0003758 3300048911 Bacteria 12159
273 Ga0496108_0006874 3300048911 Bacteria 9207
274 Ga0496108_0012355 3300048911 Bacteria 6948
275 Ga0496108_0141228 3300048911 Bacteria 2075
276 Ga0496109_0007968 3300048912 Bacteria 8981
277 Ga0496109_0033115 3300048912 Bacteria 4649
278 Ga0496109_0076152 3300048912 Bacteria 3086
279 Ga0496110_0000318 3300048913 Bacteria 31910
280 Ga0496110_0222484 3300048913 Bacteria 1716
281 Ga0496111_0006181 3300048914 Bacteria 7754
282 Ga0496111_0007235 3300048914 Bacteria 7260
283 Ga0496111_0100276 3300048914 Bacteria 2127
284 Ga0496111_0296945 3300048914 Bacteria 1198
285 Ga0496113_0018009 3300048916 Bacteria 4913
286 Ga0496113_0028235 3300048916 Bacteria 4033
287 Ga0496114_0017375 3300048917 Bacteria 5805
288 Ga0496114_0019025 3300048917 Bacteria 5564
289 Ga0496114_0133294 3300048917 Bacteria 2147
290 Ga0496114_0255298 3300048917 Bacteria 1543
291 Ga0496115_0014978 3300048918 Bacteria 5878
292 Ga0496115_0036302 3300048918 Bacteria 3901
293 Ga0496115_0196953 3300048918 Bacteria 1665
294 Ga0496116_0011697 3300048919 Bacteria 7232
295 Ga0496117_0000061 3300048920 Bacteria 258454
296 Ga0496117_0063881 3300048920 Bacteria 2513
297 Ga0496117_0065744 3300048920 Bacteria 2463
298 Ga0496117_0125208 3300048920 Bacteria 1570
299 Ga0496118_0006172 3300048921 Bacteria 13280
300 Ga0496118_0071382 3300048921 Bacteria 2500
301 Ga0496119_0000497 3300048922 Bacteria 53611
302 Ga0496119_0000786 3300048922 Bacteria 42394
303 Ga0496119_0004511 3300048922 Bacteria 13817
304 Ga0496119_0005290 3300048922 Bacteria 12431
305 Ga0496119_0057619 3300048922 Bacteria 2347
306 Ga0496120_0000336 3300048923 Bacteria 78318
307 Ga0496120_0003347 3300048923 Bacteria 14723
308 Ga0496120_0003348 3300048923 Bacteria 14718
309 Ga0496120_0005471 3300048923 Bacteria 10123
310 Ga0496122_0000030 3300048925 Bacteria 331586
311 Ga0496122_0006086 3300048925 Bacteria 14061
312 Ga0496122_0027798 3300048925 Bacteria 4823
313 Ga0496122_0110409 3300048925 Bacteria 1807
314 Ga0496123_0000024 3300048926 Bacteria 331587
315 Ga0496123_0002259 3300048926 Bacteria 24282
316 Ga0496123_0065427 3300048926 Bacteria 2311
317 Ga0496124_0008554 3300048927 Bacteria 10682
318 Ga0496124_0023306 3300048927 Bacteria 5653
319 Ga0496125_0006791 3300048928 Bacteria 12288
320 Ga0496126_0000006 3300048929 Bacteria 798804
321 Ga0496126_0003442 3300048929 Bacteria 19974
322 Ga0496126_0034331 3300048929 Bacteria 4764
323 Ga0496126_0172438 3300048929 Bacteria 1842
324 Ga0501031_0000577 3300049568 Bacteria 21539
325 Ga0501032_0000432 3300049569 Bacteria 34501
326 Ga0501033_0001452 3300049570 Bacteria 20996
327 Ga0501034_0002349 3300049571 Bacteria 23082
328 Ga0501034_0051137 3300049571 Bacteria 4167
329 Ga0501036_0000108 3300049572 Bacteria 51067
330 Ga0501037_0001254 3300049573 Bacteria 18693
331 Ga0501038_0000130 3300049574 Bacteria 63940
332 Ga0501038_0059241 3300049574 Bacteria 3280
333 Ga0501042_0063090 3300049578 Bacteria 2648
334 Ga0501043_0007720 3300049579 Bacteria 8515
335 Ga0501046_0000067 3300049580 Bacteria 114617
336 Ga0501047_0003345 3300049581 Bacteria 15193
337 Ga0501048_0000007 3300049582 Bacteria 86855
338 Ga0501067_0003198 3300049583 Bacteria 9034
339 Ga0501068_0020176 3300049584 Bacteria 3879
340 Ga0501070_0000171 3300049586 Bacteria 59820
341 Ga0501072_0046458 3300049588 Bacteria 3418
342 Ga0501073_0004998 3300049589 Bacteria 9951
343 Ga0501074_0000506 3300049590 Bacteria 23867
344 Ga0501076_0108436 3300049592 Bacteria 2243
345 Ga0501202_007362 3300049652 Bacteria 1988
346 Ga0501080_0001760 3300049742 Bacteria 18573
347 Ga0501083_0002246 3300049744 Bacteria 13197
348 Ga0501035_0097709 3300049822 Bacteria 2578
349 Ga0501044_0014042 3300049823 Bacteria 8648
350 Ga0501045_0019164 3300049824 Bacteria 4874
351 nmdc:mga00v17_69998_c1 3300050491 Bacteria 2172
352 nmdc:mga05p37_51925_c1 3300050507 Bacteria 5041
353 nmdc:mga05p37_67900_c1 3300050507 Bacteria 4386
354 nmdc:mga09592_139498_c1 3300050508 Bacteria 2089
355 nmdc:mga0qj67_142012_c1 3300050509 Bacteria 1947
356 nmdc:mga06r32_90453_c1 3300050510 Bacteria 2990
357 nmdc:mga08y16_110152_c1 3300050511 Bacteria 2867
358 nmdc:mga08y16_17900_c1 3300050511 Bacteria 7465
359 nmdc:mga08y16_329081_c1 3300050511 Bacteria 1572
360 nmdc:mga0n895_444926_c1 3300050512 Bacteria 1309
361 nmdc:mga0rr50_119585_c1 3300050513 Bacteria 2095
362 nmdc:mga0rr50_508476_c1 3300050513 Bacteria 1025
363 nmdc:mga08x19_84214_c1 3300050514 Bacteria 2091
364 nmdc:mga0a205_5629_c1 3300050515 Bacteria 11289
365 Ga0495655_0014787 3300053083 Bacteria 1645
366 Ga0501084_0001403 3300054114 Bacteria 19059
367 Ga0466962_0019025 3300061719 Bacteria 3299
368 2643784277 2643221553 Bacteria 3544260
369 2644678567 2643221724 Bacteria 3593515
370 2730228072 2728369380 Bacteria 3620317
371 2758226968 2757320536 Bacteria 3629334
372 2774381006 2773857758 Bacteria 3592392
373 2774398513 2773857763 Bacteria 4180068
374 2809228156 2808606447 Bacteria 3572005
375 2812324211 2811994872 Bacteria 4121241
376 2833709587 2833709550 Bacteria 4008291
377 2852634864 2852632344 Bacteria 3463163
378 2852649305 2852646457 Bacteria 3408613
379 2857725515 2857723135 Bacteria 4217853
380 2883822156 2883821847 Bacteria 5121194
381 2904511112 2904509784 Bacteria 3520416
382 2908680140 2908678064 Bacteria 3482747
383 2919072340 2919069694 Bacteria 3622919
384 2919396507 2919395869 Bacteria 3704152
385 2945969924 2945968032 Bacteria 4111363
386 2946035475 2946033335 Bacteria 3835514
387 2946042364 2946041624 Bacteria 4191385
388 2946082851 2946080515 Bacteria 4310960
389 2974296430 2974294766 Bacteria 3767688
390 2974327333 2974324384 Bacteria 3750535
391 2977228959 2977228692 Bacteria 3450105
392 2977237745 2977236895 Bacteria 3569373
393 2977267625 2977264416 Bacteria 3750737
394 2984544471 2984542743 Bacteria 3569378
395 8016256676 8016254467 Bacteria 3797036
396 8045834248 8045830549 Bacteria 4444727
397 Ga0395899_0034834
398 JGI24740J21852_10014284
399 JGI25407J50210_10020279
400 Ga0070676_10094186
401 Ga0070690_100187847
402 Ga0068869_100030348
403 Ga0068869_100211874
404 Ga0070666_10014359
405 Ga0070680_100029472
406 Ga0070682_100004975
407 Ga0070682_100148526
408 Ga0070682_100148664
409 Ga0068868_100130966
410 Ga0070660_100018099
411 Ga0070689_100322424
412 Ga0070687_100067482
413 Ga0070692_10005138
414 Ga0070668_100051394
415 Ga0070668_100085704
416 Ga0070668_100209534
417 Ga0070675_100099331
418 Ga0070671_100010548
419 Ga0070671_100114686
420 Ga0070673_100030027
421 Ga0070659_100042111
422 Ga0070659_100151844
423 Ga0070659_100163727
424 Ga0070667_100015169
425 Ga0070703_10003622
426 Ga0070709_10013010
427 Ga0070713_100130250
428 Ga0070700_100033703
429 Ga0070708_100015741
430 Ga0070662_100007456
431 Ga0068867_100220617
432 Ga0068853_100063866
433 Ga0070696_100039845
434 Ga0070665_100006368
435 Ga0070665_100164661
436 Ga0070704_100022269
437 Ga0068854_100005307
438 Ga0068854_100270644
439 Ga0070702_100158160
440 Ga0068852_100067482
441 Ga0068859_100022717
442 Ga0068864_100006230
443 Ga0068861_100026168
444 Ga0068861_100148232
445 Ga0068870_10079676
446 Ga0068870_10250478
447 Ga0068863_100007875
448 Ga0068863_100012826
449 Ga0068858_100037309
450 Ga0068858_100051818
451 Ga0068860_100000129
452 Ga0068860_100098900
453 Ga0068860_100099776
454 Ga0068862_100009213
455 Ga0068862_100197890
456 Ga0081455_10004225
457 Ga0081455_10012271
458 Ga0081455_10012750
459 Ga0081455_10021400
460 Ga0081455_10087562
461 Ga0081538_10001122
462 Ga0081538_10106338
463 Ga0070717_10004332
464 Ga0075432_10002266
465 Ga0075432_10003696
466 Ga0070715_10007942
467 Ga0070712_100004630
468 Ga0097621_100020153
469 Ga0075428_100007448
470 Ga0075430_100380380
471 Ga0075433_10027679
472 Ga0075433_10053160
473 Ga0075434_100004227
474 Ga0075429_100073962
475 Ga0068865_100059114
476 Ga0075436_100032714
477 Ga0097620_100022716
478 Ga0075435_100002623
479 Ga0111539_10071101
480 Ga0105245_10013135
481 Ga0105245_10061537
482 Ga0105245_10063253
483 Ga0105245_10138182
484 Ga0105245_10238192
485 Ga0114129_10179732
486 Ga0105243_10030156
487 Ga0105243_10039503
488 Ga0105241_10043676
489 Ga0105242_10023969
490 Ga0105242_10057626
491 Ga0105237_10172219
492 Ga0105238_10041278
493 Ga0105238_10105310
494 Ga0105249_10056744
495 Ga0105239_10023970
496 Ga0105239_10028914
497 Ga0157370_10205074
498 Ga0157369_10068702
499 Ga0157369_10073959
500 Ga0157369_10192787
501 Ga0171462_1004
502 Ga0157378_10262572
503 Ga0163162_10043123
504 Ga0163162_10080601
505 Ga0157372_10064537
506 Ga0157372_10190467
507 Ga0157372_10257401
508 Ga0157375_10473709
509 Ga0163163_10216037
510 Ga0157380_10079481
511 Ga0157377_10199673
512 Ga0157379_10017300
513 Ga0157379_10020821
514 Ga0163161_10003978
515 Ga0213876_10086709
516 Ga0207656_10090364
517 Ga0207692_10022864
518 Ga0207642_10012032
519 Ga0207642_10107058
520 Ga0207710_10027300
521 Ga0207680_10004570
522 Ga0207647_10016968
523 Ga0207647_10082465
524 Ga0207645_10076540
525 Ga0207643_10214287
526 Ga0207654_10030899
527 Ga0207693_10004630
528 Ga0207662_10043472
529 Ga0207657_10003612
530 Ga0207694_10092361
531 Ga0207694_10098398
532 Ga0207687_10068103
533 Ga0207687_10078996
534 Ga0207700_10084671
535 Ga0207644_10013633
536 Ga0207690_10028893
537 Ga0207706_10006460
538 Ga0207706_10144354
539 Ga0207686_10015795
540 Ga0207709_10089540
541 Ga0207704_10046201
542 Ga0207704_10116869
543 Ga0207665_10000738
544 Ga0207711_10063226
545 Ga0207689_10009684
546 Ga0207667_10351810
547 Ga0207651_10011675
548 Ga0207712_10019414
549 Ga0207712_10161749
550 Ga0207668_10059478
551 Ga0207640_10005764
552 Ga0207658_10017368
553 Ga0207677_10196627
554 Ga0207703_10010346
555 Ga0207703_10154738
556 Ga0207639_10151221
557 Ga0207678_10021920
558 Ga0207678_10162239
559 Ga0207708_10015379
560 Ga0207702_10029299
561 Ga0207702_10240831
562 Ga0207641_10001632
563 Ga0207641_10059411
564 Ga0207648_10065474
565 Ga0207648_10289847
566 Ga0207676_10314804
567 Ga0207675_100008587
568 Ga0207675_100016686
569 Ga0207675_100033254
570 Ga0207683_10003061
571 Ga0207698_10051182
572 Ga0207428_10000752
573 Ga0207428_10006293
574 Ga0268266_10000654
575 Ga0268266_10009266
576 Ga0268265_10017752
577 Ga0268265_10474787
578 Ga0268264_10000196
579 Ga0307405_10004385
580 Ga0307413_10000882
581 Ga0307413_10087500
582 Ga0307410_10000663
583 Ga0307410_10006765
584 Ga0307410_10266249
585 Ga0307406_10000224
586 Ga0307406_10000791
587 Ga0307406_10001081
588 Ga0307406_10051889
589 Ga0307406_10071465
590 Ga0307407_10001429
591 Ga0307407_10026685
592 Ga0307407_10036606
593 Ga0307412_10033583
594 Ga0307412_10045790
595 Ga0307409_100000129
596 Ga0307409_100150498
597 Ga0307409_100191456
598 Ga0307409_100273484
599 Ga0307416_100000359
600 Ga0307416_100023846
601 Ga0307414_10046507
602 Ga0307411_10077503
603 Ga0307411_10121903
604 Ga0307415_100001245
605 Ga0316212_1003359
606 Ga0373939_0021588
607 Ga0373931_0060537
608 Ga0395900_0001945
609 Ga0395898_0003737
610 Ga0395905_0025339
611 Ga0395901_0002596
612 Ga0436365_1448212
613 Ga0439448_0061362
614 Ga0439455_0025197
615 Ga0439440_0001382
616 Ga0439440_0001433
617 Ga0439440_0026647
618 Ga0466972_0056380
619 Ga0466972_0082031
620 Ga0466965_0007941
621 Ga0466965_0011342
622 Ga0466966_0022135
623 Ga0466966_0040899
624 Ga0466966_0056661
625 Ga0466961_0005497
626 Ga0466961_0015738
627 Ga0466963_0082812
628 Ga0466963_0083287
629 Ga0453684_0023409
630 Ga0466971_0021366
631 Ga0466968_0039219
632 Ga0466968_0098806
633 Ga0466970_0001330
634 Ga0466970_0035459
635 Ga0466970_0037447
636 Ga0466970_0087800
637 Ga0466957_0017657
638 Ga0466960_0028211
639 Ga0466959_0010181
640 Ga0466959_0020485
641 Ga0466959_0151591
642 Ga0451576_0077601
643 Ga0466958_0003821
644 Ga0466958_0043369
645 Ga0466958_0132611
646 Ga0466967_0000679
647 Ga0466967_0027233
648 Ga0466967_0044509
649 Ga0466967_0145893
650 Ga0466967_0218641
651 Ga0466967_0351009
652 Ga0466967_0442311
653 Ga0495653_0026341
654 Ga0495631_0018183
655 Ga0495645_0111146
656 Ga0496100_0096225
657 Ga0496101_0487606
658 Ga0496102_0047791
659 Ga0496103_0075108
660 Ga0496104_0006628
661 Ga0496104_0041487
662 Ga0496104_0045048
663 Ga0496104_0125751
664 Ga0496105_0002878
665 Ga0496105_0112138
666 Ga0496105_0262972
667 Ga0496107_0013942
668 Ga0496108_0003758
669 Ga0496108_0006874
670 Ga0496108_0012355
671 Ga0496108_0141228
672 Ga0496109_0007968
673 Ga0496109_0033115
674 Ga0496109_0076152
675 Ga0496110_0000318
676 Ga0496110_0222484
677 Ga0496111_0006181
678 Ga0496111_0007235
679 Ga0496111_0100276
680 Ga0496111_0296945
681 Ga0496113_0018009
682 Ga0496113_0028235
683 Ga0496114_0017375
684 Ga0496114_0019025
685 Ga0496114_0133294
686 Ga0496114_0255298
687 Ga0496115_0014978
688 Ga0496115_0036302
689 Ga0496115_0196953
690 Ga0496116_0011697
691 Ga0496117_0000061
692 Ga0496117_0063881
693 Ga0496117_0065744
694 Ga0496117_0125208
695 Ga0496118_0006172
696 Ga0496118_0071382
697 Ga0496119_0000497
698 Ga0496119_0000786
699 Ga0496119_0004511
700 Ga0496119_0005290
701 Ga0496119_0057619
702 Ga0496120_0000336
703 Ga0496120_0003347
704 Ga0496120_0003348
705 Ga0496120_0005471
706 Ga0496122_0000030
707 Ga0496122_0006086
708 Ga0496122_0027798
709 Ga0496122_0110409
710 Ga0496123_0000024
711 Ga0496123_0002259
712 Ga0496123_0065427
713 Ga0496124_0008554
714 Ga0496124_0023306
715 Ga0496125_0006791
716 Ga0496126_0000006
717 Ga0496126_0003442
718 Ga0496126_0034331
719 Ga0496126_0172438
720 Ga0501031_0000577
721 Ga0501032_0000432
722 Ga0501033_0001452
723 Ga0501034_0002349
724 Ga0501034_0051137
725 Ga0501036_0000108
726 Ga0501037_0001254
727 Ga0501038_0000130
728 Ga0501038_0059241
729 Ga0501042_0063090
730 Ga0501043_0007720
731 Ga0501046_0000067
732 Ga0501047_0003345
733 Ga0501048_0000007
734 Ga0501067_0003198
735 Ga0501068_0020176
736 Ga0501070_0000171
737 Ga0501072_0046458
738 Ga0501073_0004998
739 Ga0501074_0000506
740 Ga0501076_0108436
741 Ga0501202_007362
742 Ga0501080_0001760
743 Ga0501083_0002246
744 Ga0501035_0097709
745 Ga0501044_0014042
746 Ga0501045_0019164
747 nmdc:mga00v17_69998_c1
748 nmdc:mga05p37_51925_c1
749 nmdc:mga05p37_67900_c1
750 nmdc:mga09592_139498_c1
751 nmdc:mga0qj67_142012_c1
752 nmdc:mga06r32_90453_c1
753 nmdc:mga08y16_110152_c1
754 nmdc:mga08y16_17900_c1
755 nmdc:mga08y16_329081_c1
756 nmdc:mga0n895_444926_c1
757 nmdc:mga0rr50_119585_c1
758 nmdc:mga0rr50_508476_c1
759 nmdc:mga08x19_84214_c1
760 nmdc:mga0a205_5629_c1
761 Ga0495655_0014787
762 Ga0501084_0001403
763 Ga0466962_0019025
764 2643784277
765 2644678567
766 2730228072
767 2758226968
768 2774381006
769 2774398513
770 2809228156
771 2812324211
772 2833709587
773 2852634864
774 2852649305
775 2857725515
776 2883822156
777 2904511112
778 2908680140
779 2919072340
780 2919396507
781 2945969924
782 2946035475
783 2946042364
784 2946082851
785 2974296430
786 2974327333
787 2977228959
788 2977237745
789 2977267625
790 2984544471
791 8016256676
792 8045834248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

1

154

0.96

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

202

309

0.86

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

159

200

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.9587 2 28
6ici-assembly1.cif.gz_A crystal structure of human mical3 0.9476 2 30
7zca-assembly1.cif.gz_A-2 crystal structure of the f191m/f201a variant of variovorax paradoxus indole monooxygenase (vpinda1) in complex with benzyl phenyl sulfoxide 0.9461 1 32
7z98-assembly1.cif.gz_A crystal structure of f191m variant variovorax paradoxus indole monooxygenase (vpinda1) in complex with methyl phenyl sulfide 0.9443 1 32
6fph-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1h 0.9415 1 28
ID Description Score Start End Superfamily
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9479 1 179 3.40.50.720
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9426 1 179 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9393 1 136 3.40.50.720
3i3lA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9342 2 30 3.50.50.60
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.926 2 34 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3L7N5A4-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9967 1 84 GO:0004616
GO:0050661
AF-A0A2N9M0A7-F1-model_v4 6-phosphogluconate dehydrogenase YqeC (EC 1.1.1.-) 0.9955 1 70 GO:0004616
GO:0050661
AF-A0A7C2WQY9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9925 1 114 GO:0004616
GO:0050661
AF-A0A2T2STP7-F1-model_v4 6-phosphogluconate dehydrogenase 0.9913 1 117 GO:0004616
GO:0050661
AF-A0A7K0UTW7-F1-model_v4 deleted 0.9901 3 101

Map