F433625

General Info

Members Datasets Scaffolds Average Seq Length
396 241 391 239

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0000896|Ga0501073_0000896_11771_12634
Length 287
Sequence MPKKPETGHIRQIRTRIRHDPALNRNLIDFRGRLVQIVRPRQACRRMNGYVDIYTLIFLAIAVVIFLRLRSVLGRRTGSERPPFDPFSKRPDARPESRDDKVVSLPRRTEERGAPAPRASIEATAEERVKTVAPPGSPVAAGLKAIAQVDAEFETTRFIAGAKAAYEMIVTAFAEGDRKVLKQLLSKDVFDGFIAAITQRETRQEKIEFRFVGIDKAEITGAALKNGTAQVTVKFLSKLISATRDKAGAVIDGDPFHVSDVTDIWTFARDVASRDPNWKLIATESVE

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
3 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
4 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
135 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
143 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
144 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
230 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
231 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
232 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
233 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
234 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
235 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
240 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
241 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.22
Metatranscriptomes 1.52
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.85
Nodule 0
Rhizoplane 7.32
Rhizosphere 80.56
Stem 0
Stem Tuber 0
Unclassified 2.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11937103 2162886012 Bacteria 3665
2 Ga0065715_10131104 3300005293 Bacteria 2014
3 Ga0070658_10004070 3300005327 Bacteria 11985
4 Ga0070690_100143387 3300005330 Bacteria 1623
5 Ga0068869_100081190 3300005334 Bacteria 2421
6 Ga0070680_100002429 3300005336 Bacteria 13799
7 Ga0070680_100004020 3300005336 Bacteria 11005
8 Ga0070680_100354019 3300005336 Unclassified 1249
9 Ga0070680_100651615 3300005336 Unclassified 905
10 Ga0068868_100195670 3300005338 Bacteria 1683
11 Ga0070689_100009702 3300005340 Bacteria 6830
12 Ga0070689_100329077 3300005340 Bacteria 1278
13 Ga0070689_100501579 3300005340 Bacteria 1040
14 Ga0070691_10001921 3300005341 Bacteria 9125
15 Ga0070691_10008144 3300005341 Bacteria 4800
16 Ga0070691_10009985 3300005341 Bacteria 4325
17 Ga0070661_100031738 3300005344 Bacteria 3820
18 Ga0070661_100146443 3300005344 Bacteria 1783
19 Ga0070692_10086459 3300005345 Bacteria 1697
20 Ga0070669_100226202 3300005353 Unclassified 1481
21 Ga0070669_100290909 3300005353 Bacteria 1311
22 Ga0070673_100164922 3300005364 Bacteria 1887
23 Ga0070659_100080499 3300005366 Bacteria 2601
24 Ga0070703_10006756 3300005406 Bacteria 3217
25 Ga0070713_100019108 3300005436 Bacteria 5222
26 Ga0070705_100001191 3300005440 Bacteria 14159
27 Ga0070705_100239291 3300005440 Unclassified 1268
28 Ga0070705_100357086 3300005440 Unclassified 1068
29 Ga0070700_100003138 3300005441 Bacteria 8490
30 Ga0070694_100003405 3300005444 Bacteria 9533
31 Ga0070708_100162751 3300005445 Bacteria 2080
32 Ga0070708_100335977 3300005445 Bacteria 1424
33 Ga0070663_100692623 3300005455 Unclassified 865
34 Ga0070681_10001080 3300005458 Bacteria 23262
35 Ga0070681_10014577 3300005458 Bacteria 7823
36 Ga0070681_10038983 3300005458 Bacteria 4764
37 Ga0070707_100328255 3300005468 Bacteria 1487
38 Ga0070698_100002001 3300005471 Bacteria 22625
39 Ga0070699_100000576 3300005518 Bacteria 34772
40 Ga0070679_100012577 3300005530 Bacteria 8092
41 Ga0070684_100031254 3300005535 Bacteria 4531
42 Ga0070697_100029756 3300005536 Bacteria 4382
43 Ga0070697_100315280 3300005536 Unclassified 1346
44 Ga0070697_100348133 3300005536 Bacteria 1279
45 Ga0068853_100115526 3300005539 Bacteria 2388
46 Ga0070695_100004237 3300005545 Bacteria 8395
47 Ga0070695_100008859 3300005545 Bacteria 5978
48 Ga0070696_100000306 3300005546 Bacteria 29692
49 Ga0070696_100242106 3300005546 Bacteria 1361
50 Ga0070693_100051494 3300005547 Bacteria 2358
51 Ga0070665_100003491 3300005548 Bacteria 16737
52 Ga0070665_100064747 3300005548 Bacteria 3666
53 Ga0070665_100140375 3300005548 Bacteria 2419
54 Ga0068855_100011830 3300005563 Bacteria 10549
55 Ga0070664_100025936 3300005564 Bacteria 4859
56 Ga0068857_100002806 3300005577 Bacteria 14326
57 Ga0068857_100093339 3300005577 Bacteria 2695
58 Ga0068856_100047586 3300005614 Bacteria 4225
59 Ga0068852_100276049 3300005616 Bacteria 1619
60 Ga0068859_100000758 3300005617 Bacteria 32556
61 Ga0068861_100045098 3300005719 Bacteria 3318
62 Ga0068863_100513623 3300005841 Unclassified 1181
63 Ga0068863_100789698 3300005841 Bacteria 947
64 Ga0068860_100005957 3300005843 Bacteria 12262
65 Ga0068860_100310317 3300005843 Bacteria 1546
66 Ga0068860_100347047 3300005843 Unclassified 1460
67 Ga0068862_100003289 3300005844 Bacteria 13980
68 Ga0068862_100103542 3300005844 Unclassified 2493
69 Ga0081455_10000559 3300005937 Bacteria 48458
70 Ga0081455_10003778 3300005937 Bacteria 17289
71 Ga0081538_10033689 3300005981 Bacteria 3403
72 Ga0081540_1000034 3300005983 Bacteria 142197
73 Ga0081540_1009289 3300005983 Bacteria 6783
74 Ga0081540_1036545 3300005983 Bacteria 2617
75 Ga0081540_1062561 3300005983 Bacteria 1766
76 Ga0081539_10001625 3300005985 Bacteria 36847
77 Ga0081539_10007126 3300005985 Bacteria 10325
78 Ga0075365_10017418 3300006038 Bacteria 4395
79 Ga0075365_10019493 3300006038 Bacteria 4188
80 Ga0075365_10077886 3300006038 Bacteria 2241
81 Ga0075365_10104197 3300006038 Bacteria 1945
82 Ga0075365_10273128 3300006038 Bacteria 1189
83 Ga0075368_10012691 3300006042 Bacteria 3086
84 Ga0075364_10014752 3300006051 Bacteria 4833
85 Ga0075364_10033938 3300006051 Bacteria 3289
86 Ga0075362_10035907 3300006177 Bacteria 2166
87 Ga0075362_10046256 3300006177 Bacteria 1935
88 Ga0075362_10049643 3300006177 Bacteria 1875
89 Ga0075367_10030065 3300006178 Bacteria 3111
90 Ga0075367_10058757 3300006178 Bacteria 2289
91 Ga0075367_10128229 3300006178 Unclassified 1567
92 Ga0075366_10004023 3300006195 Bacteria 7859
93 Ga0075428_100003163 3300006844 Bacteria 17988
94 Ga0075428_100025496 3300006844 Bacteria 6545
95 Ga0075430_100017713 3300006846 Bacteria 6064
96 Ga0075430_100239351 3300006846 Bacteria 1504
97 Ga0075431_100003540 3300006847 Bacteria 15121
98 Ga0075431_100008143 3300006847 Bacteria 10473
99 Ga0075433_10034716 3300006852 Bacteria 4333
100 Ga0075433_10270057 3300006852 Bacteria 1507
101 Ga0075433_10280989 3300006852 Unclassified 1475
102 Ga0075433_10532949 3300006852 Unclassified 1033
103 Ga0075434_100153388 3300006871 Unclassified 2324
104 Ga0075434_100555973 3300006871 Unclassified 1167
105 Ga0075429_100340331 3300006880 Unclassified 1313
106 Ga0068865_100292176 3300006881 Bacteria 1301
107 Ga0075436_100018938 3300006914 Bacteria 4714
108 Ga0097620_100000758 3300006931 Bacteria 32556
109 Ga0075435_100008127 3300007076 Bacteria 7515
110 Ga0105240_10054035 3300009093 Bacteria 5036
111 Ga0111539_10008126 3300009094 Bacteria 13367
112 Ga0111539_10016129 3300009094 Bacteria 9271
113 Ga0111539_10132528 3300009094 Bacteria 2918
114 Ga0111539_10403645 3300009094 Bacteria 1592
115 Ga0105245_10117296 3300009098 Bacteria 2483
116 Ga0105245_10488757 3300009098 Bacteria 1245
117 Ga0105245_10973415 3300009098 Bacteria 892
118 Ga0105247_10064661 3300009101 Unclassified 2274
119 Ga0114129_10020885 3300009147 Bacteria 9303
120 Ga0114129_10088856 3300009147 Bacteria 4284
121 Ga0114129_10322653 3300009147 Bacteria 2053
122 Ga0105241_10376712 3300009174 Bacteria 1239
123 Ga0105248_10245551 3300009177 Unclassified 2015
124 Ga0105238_10150619 3300009551 Bacteria 2301
125 Ga0105238_10390780 3300009551 Bacteria 1383
126 Ga0105249_10002183 3300009553 Bacteria 16943
127 Ga0105249_10211435 3300009553 Bacteria 1904
128 Ga0105249_10239029 3300009553 Unclassified 1795
129 Ga0105249_10545734 3300009553 Bacteria 1209
130 Ga0105239_10191751 3300010375 Bacteria 2288
131 Ga0105239_10391850 3300010375 Bacteria 1571
132 Ga0105239_10517618 3300010375 Bacteria 1357
133 Ga0157371_10291542 3300013102 Bacteria 1180
134 Ga0157370_10016281 3300013104 Bacteria 7534
135 Ga0157369_10184644 3300013105 Bacteria 2193
136 Ga0157369_10542591 3300013105 Bacteria 1202
137 Ga0157374_10429199 3300013296 Unclassified 1321
138 Ga0163162_10410480 3300013306 Bacteria 1487
139 Ga0157375_10149658 3300013308 Bacteria 2469
140 Ga0157375_10807788 3300013308 Unclassified 1086
141 Ga0157379_10128465 3300014968 Bacteria 2281
142 Ga0157379_10172011 3300014968 Bacteria 1955
143 Ga0157376_10133076 3300014969 Bacteria 2222
144 Ga0163161_10023494 3300017792 Bacteria 4349
145 Ga0206356_11442817 3300020070 Bacteria 941
146 Ga0213876_10005904 3300021384 Bacteria 6693
147 Ga0224712_10112714 3300022467 Bacteria 1169
148 Ga0224712_10120107 3300022467 Bacteria 1137
149 Ga0207426_1007004 3300025302 Bacteria 4785
150 Ga0207653_10004101 3300025885 Bacteria 4585
151 Ga0207647_10074560 3300025904 Bacteria 2043
152 Ga0207705_10022609 3300025909 Bacteria 4485
153 Ga0207705_10434885 3300025909 Bacteria 1017
154 Ga0207684_10123777 3300025910 Bacteria 2218
155 Ga0207707_10003608 3300025912 Bacteria 13718
156 Ga0207707_10052945 3300025912 Bacteria 3533
157 Ga0207707_10065270 3300025912 Bacteria 3171
158 Ga0207695_10040468 3300025913 Bacteria 4996
159 Ga0207695_10599595 3300025913 Bacteria 983
160 Ga0207693_10271292 3300025915 Unclassified 1329
161 Ga0207657_10035640 3300025919 Bacteria 4460
162 Ga0207657_10147416 3300025919 Bacteria 1919
163 Ga0207652_10202800 3300025921 Bacteria 1785
164 Ga0207646_10037609 3300025922 Bacteria 4363
165 Ga0207681_10171491 3300025923 Bacteria 1645
166 Ga0207694_10274624 3300025924 Bacteria 1383
167 Ga0207659_10020179 3300025926 Bacteria 4401
168 Ga0207687_10753656 3300025927 Bacteria 829
169 Ga0207700_10058572 3300025928 Bacteria 2910
170 Ga0207700_10207893 3300025928 Bacteria 1653
171 Ga0207644_10199243 3300025931 Bacteria 1579
172 Ga0207690_10140708 3300025932 Bacteria 1778
173 Ga0207690_10230166 3300025932 Bacteria 1422
174 Ga0207690_10436693 3300025932 Bacteria 1050
175 Ga0207709_10054041 3300025935 Bacteria 2474
176 Ga0207670_10027870 3300025936 Bacteria 3578
177 Ga0207704_10580895 3300025938 Bacteria 915
178 Ga0207665_10312039 3300025939 Bacteria 1178
179 Ga0207691_10089951 3300025940 Bacteria 2752
180 Ga0207661_10188126 3300025944 Bacteria 1808
181 Ga0207651_10503216 3300025960 Bacteria 1048
182 Ga0207651_10555182 3300025960 Bacteria 999
183 Ga0207712_10014626 3300025961 Bacteria 5053
184 Ga0207668_10066689 3300025972 Bacteria 2552
185 Ga0207668_10667853 3300025972 Bacteria 911
186 Ga0207677_10144825 3300026023 Bacteria 1824
187 Ga0207677_10215694 3300026023 Bacteria 1536
188 Ga0207678_10007695 3300026067 Bacteria 9517
189 Ga0207678_10715072 3300026067 Bacteria 882
190 Ga0207702_10014235 3300026078 Bacteria 6605
191 Ga0207702_10040096 3300026078 Bacteria 3925
192 Ga0207641_10169600 3300026088 Unclassified 1991
193 Ga0207641_10519328 3300026088 Bacteria 1158
194 Ga0207648_10293888 3300026089 Bacteria 1455
195 Ga0207674_10002061 3300026116 Bacteria 25517
196 Ga0207674_10135407 3300026116 Bacteria 2425
197 Ga0207674_10162708 3300026116 Bacteria 2186
198 Ga0207675_100140681 3300026118 Bacteria 2292
199 Ga0207698_11102001 3300026142 Unclassified 807
200 Ga0207428_10019144 3300027907 Bacteria 5837
201 Ga0268266_10070832 3300028379 Bacteria 3021
202 Ga0268266_10076592 3300028379 Bacteria 2907
203 Ga0268266_10815017 3300028379 Bacteria 902
204 Ga0268265_10005384 3300028380 Bacteria 8762
205 Ga0268264_11086086 3300028381 Unclassified 808
206 Ga0265334_10013613 3300028573 Bacteria 3404
207 Ga0265340_10004593 3300031247 Bacteria 7686
208 Ga0265340_10025575 3300031247 Bacteria 2988
209 Ga0265339_10019199 3300031249 Bacteria 4015
210 Ga0265316_10012445 3300031344 Bacteria 7629
211 Ga0307513_10213901 3300031456 Bacteria 1756
212 Ga0265313_10001114 3300031595 Bacteria 25692
213 Ga0316575_10032049 3300031665 Bacteria 2058
214 Ga0316579_10033121 3300031691 Bacteria 2371
215 Ga0265342_10011655 3300031712 Bacteria 5998
216 Ga0316578_10099721 3300031728 Bacteria 1740
217 Ga0307516_10040673 3300031730 Bacteria 4626
218 Ga0316577_10293096 3300031733 Bacteria 921
219 Ga0307409_100308859 3300031995 Bacteria 1475
220 Ga0307416_100437869 3300032002 Bacteria 1356
221 Ga0316583_10041451 3300032133 Bacteria 1629
222 Ga0316585_10017568 3300032137 Bacteria 2163
223 Ga0316592_1033264 3300033524 Bacteria 1127
224 Ga0316587_1027381 3300033529 Bacteria 997
225 Ga0373958_0008480 3300034819 Bacteria 1666
226 Ga0373958_0034509 3300034819 Bacteria 1008
227 Ga0373938_0008972 3300034957 Bacteria 1799
228 Ga0373929_0048364 3300035085 Unclassified 966
229 Ga0373940_0129880 3300035088 Unclassified 788
230 Ga0373949_0074209 3300035090 Unclassified 896
231 Ga0373952_0012631 3300035092 Unclassified 1664
232 Ga0373932_0005865 3300035112 Unclassified 2893
233 Ga0373932_0092735 3300035112 Unclassified 971
234 Ga0373941_0089431 3300035115 Bacteria 1054
235 Ga0373956_0184799 3300035119 Unclassified 986
236 Ga0373946_0189352 3300035171 Bacteria 980
237 Ga0373942_0008661 3300035207 Bacteria 2374
238 Ga0373931_0001143 3300035691 Bacteria 11279
239 Ga0373931_0005929 3300035691 Bacteria 5680
240 Ga0373931_0063333 3300035691 Bacteria 1998
241 Ga0373931_0305513 3300035691 Bacteria 984
242 Ga0373927_0102385 3300035695 Bacteria 1863
243 Ga0373927_0196153 3300035695 Bacteria 1325
244 Ga0373937_0097430 3300036401 Bacteria 2728
245 Ga0316582_0247059 3300036647 Bacteria 1222
246 Ga0316584_0180554 3300036712 Bacteria 1562
247 Ga0373925_0073932 3300037068 Bacteria 2581
248 Ga0373925_0219617 3300037068 Unclassified 1517
249 Ga0373925_0276800 3300037068 Bacteria 1351
250 Ga0395899_0001760 3300037312 Bacteria 17991
251 Ga0395899_0006200 3300037312 Bacteria 9261
252 Ga0395899_0038516 3300037312 Bacteria 3581
253 Ga0395900_0003157 3300037418 Bacteria 17863
254 Ga0395900_0004742 3300037418 Bacteria 14338
255 Ga0395900_0013753 3300037418 Bacteria 8261
256 Ga0395900_0044035 3300037418 Bacteria 4600
257 Ga0395898_0002978 3300037466 Bacteria 19251
258 Ga0395905_0275103 3300037471 Bacteria 1570
259 Ga0395901_0002132 3300038443 Bacteria 20275
260 Ga0395901_0002329 3300038443 Bacteria 19348
261 Ga0395901_0067779 3300038443 Bacteria 3717
262 Ga0400487_54173 3300039110 Bacteria 2462
263 Ga0436365_1034188 3300039437 Bacteria 34077
264 Ga0436360_0009934 3300039438 Bacteria 1008
265 Ga0436361_0862854 3300039447 Bacteria 1628
266 Ga0466963_0018767 3300044694 Bacteria 4329
267 Ga0466957_0198015 3300044842 Bacteria 1318
268 Ga0466967_0107966 3300045976 Bacteria 2553
269 Ga0495603_0084366 3300046455 Bacteria 1860
270 Ga0495590_0111988 3300046457 Unclassified 974
271 Ga0495584_0062267 3300046491 Bacteria 1875
272 Ga0495647_0224666 3300046681 Unclassified 830
273 Ga0496101_0213396 3300048904 Unclassified 1496
274 Ga0496102_0003057 3300048905 Bacteria 14173
275 Ga0496102_0852107 3300048905 Unclassified 833
276 Ga0496104_0002697 3300048907 Bacteria 15284
277 Ga0496105_0017645 3300048908 Bacteria 5726
278 Ga0496105_0205548 3300048908 Unclassified 1606
279 Ga0496106_0002107 3300048909 Bacteria 14884
280 Ga0496106_0116363 3300048909 Unclassified 2085
281 Ga0496106_0318487 3300048909 Bacteria 1248
282 Ga0496107_0005009 3300048910 Bacteria 9022
283 Ga0496107_0529597 3300048910 Unclassified 873
284 Ga0496108_0074647 3300048911 Bacteria 2864
285 Ga0496108_0150021 3300048911 Unclassified 2011
286 Ga0496108_0189080 3300048911 Bacteria 1784
287 Ga0496108_0297584 3300048911 Bacteria 1405
288 Ga0496109_0009026 3300048912 Bacteria 8493
289 Ga0496110_0000798 3300048913 Bacteria 22017
290 Ga0496110_0031990 3300048913 Bacteria 4541
291 Ga0496110_0217218 3300048913 Unclassified 1739
292 Ga0496110_0920034 3300048913 Bacteria 781
293 Ga0496111_0014600 3300048914 Bacteria 5371
294 Ga0496111_0107066 3300048914 Bacteria 2058
295 Ga0496112_0031836 3300048915 Bacteria 5118
296 Ga0496112_0112581 3300048915 Bacteria 2692
297 Ga0496112_0322203 3300048915 Unclassified 1490
298 Ga0496113_0006675 3300048916 Bacteria 7342
299 Ga0496113_0039240 3300048916 Bacteria 3485
300 Ga0496115_0017709 3300048918 Bacteria 5453
301 Ga0496115_0071269 3300048918 Bacteria 2819
302 Ga0496126_0047400 3300048929 Bacteria 3934
303 Ga0501034_0001957 3300049571 Bacteria 26076
304 Ga0501034_0002934 3300049571 Bacteria 19768
305 Ga0501034_0042247 3300049571 Bacteria 4615
306 Ga0501034_0223346 3300049571 Bacteria 1835
307 Ga0501034_0488517 3300049571 Unclassified 1146
308 Ga0501036_0210695 3300049572 Bacteria 1633
309 Ga0501036_0282725 3300049572 Bacteria 1388
310 Ga0501039_0322238 3300049575 Bacteria 1215
311 Ga0501039_0525037 3300049575 Bacteria 929
312 Ga0501040_0038801 3300049576 Bacteria 3238
313 Ga0501042_0159625 3300049578 Bacteria 1627
314 Ga0501042_0378981 3300049578 Unclassified 1024
315 Ga0501043_0160014 3300049579 Bacteria 1760
316 Ga0501046_0141430 3300049580 Bacteria 1821
317 Ga0501046_0156106 3300049580 Bacteria 1719
318 Ga0501046_0498033 3300049580 Bacteria 873
319 Ga0501047_0121637 3300049581 Unclassified 2492
320 Ga0501047_0448654 3300049581 Unclassified 1119
321 Ga0501070_0091956 3300049586 Bacteria 2511
322 Ga0501070_0131656 3300049586 Bacteria 2066
323 Ga0501073_0000896 3300049589 Bacteria 21361
324 Ga0501073_0200056 3300049589 Bacteria 1382
325 Ga0501073_0200723 3300049589 Bacteria 1379
326 Ga0501075_0048895 3300049591 Bacteria 3178
327 Ga0501075_0383422 3300049591 Bacteria 1071
328 Ga0501076_0302262 3300049592 Unclassified 1312
329 Ga0501076_0364928 3300049592 Bacteria 1186
330 Ga0501077_0026367 3300049593 Bacteria 3688
331 Ga0501077_0084907 3300049593 Unclassified 2007
332 Ga0501077_0123976 3300049593 Bacteria 1638
333 Ga0501079_0036261 3300049741 Bacteria 3799
334 Ga0501079_0457149 3300049741 Bacteria 1003
335 Ga0501080_0174404 3300049742 Unclassified 1982
336 Ga0501081_0054376 3300049743 Bacteria 2766
337 Ga0501083_0017473 3300049744 Bacteria 5001
338 Ga0501044_0053405 3300049823 Bacteria 4158
339 Ga0501044_0053729 3300049823 Bacteria 4143
340 Ga0501044_0210048 3300049823 Bacteria 1901
341 Ga0501045_0129842 3300049824 Unclassified 1873
342 Ga0501045_0208560 3300049824 Bacteria 1455
343 nmdc:mga03683_166516_c1 3300050489 Unclassified 1000
344 nmdc:mga03683_35520_c1 3300050489 Bacteria 2022
345 nmdc:mga03683_65866_c1 3300050489 Bacteria 1539
346 nmdc:mga03n38_27109_c1 3300050490 Bacteria 2373
347 nmdc:mga03n38_348616_c1 3300050490 Bacteria 805
348 nmdc:mga00v17_3154_c1 3300050491 Bacteria 8490
349 nmdc:mga0yw44_12487_c1 3300050492 Bacteria 4431
350 nmdc:mga0yw44_147846_c1 3300050492 Bacteria 1531
351 nmdc:mga0k408_2740_c1 3300050493 Bacteria 9365
352 nmdc:mga06z11_25010_c1 3300050494 Bacteria 2824
353 nmdc:mga06z11_307492_c1 3300050494 Unclassified 944
354 nmdc:mga06z11_7805_c1 3300050494 Bacteria 4424
355 nmdc:mga06z11_8985_c1 3300050494 Bacteria 4195
356 nmdc:mga04h51_112419_c1 3300050495 Bacteria 1006
357 nmdc:mga07m45_68901_c1 3300050496 Bacteria 2011
358 nmdc:mga05p37_441939_c1 3300050507 Bacteria 1508
359 nmdc:mga05p37_630074_c1 3300050507 Unclassified 1205
360 nmdc:mga09592_332631_c1 3300050508 Unclassified 1315
361 nmdc:mga0qj67_14972_c1 3300050509 Bacteria 5867
362 nmdc:mga06r32_4445_c1 3300050510 Bacteria 12549
363 nmdc:mga06r32_8520_c1 3300050510 Bacteria 9244
364 nmdc:mga08y16_251989_c1 3300050511 Bacteria 1824
365 nmdc:mga08y16_32911_c1 3300050511 Bacteria 5449
366 nmdc:mga08y16_353352_c1 3300050511 Unclassified 1509
367 nmdc:mga08y16_457101_c1 3300050511 Bacteria 1302
368 nmdc:mga0n895_17124_c1 3300050512 Bacteria 6676
369 nmdc:mga0n895_376469_c1 3300050512 Unclassified 1437
370 nmdc:mga0rr50_167247_c1 3300050513 Unclassified 1789
371 nmdc:mga08x19_40148_c1 3300050514 Bacteria 2977
372 nmdc:mga0a205_429294_c1 3300050515 Bacteria 1183
373 nmdc:mga0a205_46109_c1 3300050515 Bacteria 4204
374 nmdc:mga0a205_64266_c1 3300050515 Bacteria 3544
375 nmdc:mga0a205_657145_c1 3300050515 Bacteria 899
376 nmdc:mga0a205_70094_c1 3300050515 Bacteria 3384
377 Ga0500644_0018998 3300053088 Bacteria 2022
378 Ga0500646_0044480 3300053090 Unclassified 1261
379 Ga0500583_0083886 3300053092 Bacteria 1543
380 Ga0500583_0166033 3300053092 Unclassified 1099
381 Ga0500641_0056849 3300053096 Unclassified 1622
382 Ga0500556_0036726 3300053104 Bacteria 1701
383 Ga0500652_048659 3300053131 Unclassified 1726
384 Ga0500552_000583 3300053733 Bacteria 3415
385 Ga0501084_0180083 3300054114 Bacteria 1784
386 Ga0587111_0030144 3300060346 Bacteria 1103
387 Ga0501082_0049510 3300060353 Bacteria 3624
388 Ga0501082_0178143 3300060353 Bacteria 1849
389 Ga0501082_0312570 3300060353 Bacteria 1368
390 Ga0530510_0080123 3300061734 Bacteria 2376
391 Ga0530510_0088425 3300061734 Bacteria 2258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_100437869 Ga0307416_1004378692 199
2 3300050490 nmdc:mga03n38_348616_c1 nmdc:mga03n38_348616_c1_19_663 201
3 3300025302 Ga0207426_1007004 Ga0207426_10070046 202
4 3300026067 Ga0207678_10715072 Ga0207678_107150722 202
5 3300005981 Ga0081538_10033689 Ga0081538_100336893 204
6 3300049571 Ga0501034_0223346 Ga0501034_0223346_960_1685 209
7 iso_pu_bacteria 2511231221 2512034777 210
8 iso_pu_bacteria 2897803580 2897808726 211
9 3300006038 Ga0075365_10019493 Ga0075365_100194934 212
10 3300006177 Ga0075362_10046256 Ga0075362_100462561 212
11 3300006178 Ga0075367_10058757 Ga0075367_100587572 212
12 3300025960 Ga0207651_10503216 Ga0207651_105032162 212
13 3300050492 nmdc:mga0yw44_12487_c1 nmdc:mga0yw44_12487_c1_2947_3687 212
14 3300050494 nmdc:mga06z11_25010_c1 nmdc:mga06z11_25010_c1_393_1133 212
15 3300005548 Ga0070665_100064747 Ga0070665_1000647474 213
16 3300005844 Ga0068862_100103542 Ga0068862_1001035422 213
17 3300028379 Ga0268266_10076592 Ga0268266_100765923 213
18 3300037312 Ga0395899_0038516 Ga0395899_0038516_2151_2888 213
19 3300037418 Ga0395900_0013753 Ga0395900_0013753_5839_6576 213
20 3300037466 Ga0395898_0002978 Ga0395898_0002978_1539_2276 213
21 3300038443 Ga0395901_0067779 Ga0395901_0067779_1929_2666 213
22 iso_pu_bacteria 8054002106 8054003779 213
23 3300010375 Ga0105239_10517618 Ga0105239_105176182 214
24 3300026116 Ga0207674_10162708 Ga0207674_101627082 214
25 3300009553 Ga0105249_10545734 Ga0105249_105457342 215
26 3300038443 Ga0395901_0002329 Ga0395901_0002329_3956_4681 215
27 3300048929 Ga0496126_0047400 Ga0496126_0047400_2099_2836 215
28 3300037418 Ga0395900_0003157 Ga0395900_0003157_1485_2210 216
29 3300050494 nmdc:mga06z11_307492_c1 nmdc:mga06z11_307492_c1_18_680 216
30 3300005985 Ga0081539_10001625 Ga0081539_1000162523 217
31 3300009098 Ga0105245_10973415 Ga0105245_109734151 217
32 3300049571 Ga0501034_0001957 Ga0501034_0001957_12036_12761 217
33 3300049571 Ga0501034_0002934 Ga0501034_0002934_10476_11201 217
34 3300049823 Ga0501044_0210048 Ga0501044_0210048_1121_1846 217
35 3300053092 Ga0500583_0083886 Ga0500583_0083886_562_1290 217
36 3300060346 Ga0587111_0030144 Ga0587111_0030144_116_814 217
37 3300005340 Ga0070689_100009702 Ga0070689_1000097023 218
38 3300005445 Ga0070708_100162751 Ga0070708_1001627512 218
39 3300005468 Ga0070707_100328255 Ga0070707_1003282552 218
40 3300005471 Ga0070698_100002001 Ga0070698_1000020017 218
41 3300005536 Ga0070697_100315280 Ga0070697_1003152801 218
42 3300009553 Ga0105249_10211435 Ga0105249_102114353 218
43 3300009553 Ga0105249_10239029 Ga0105249_102390292 218
44 3300013104 Ga0157370_10016281 Ga0157370_100162814 218
45 3300013308 Ga0157375_10807788 Ga0157375_108077881 218
46 3300025922 Ga0207646_10037609 Ga0207646_100376095 218
47 3300025927 Ga0207687_10753656 Ga0207687_107536561 218
48 3300025931 Ga0207644_10199243 Ga0207644_101992432 218
49 3300025932 Ga0207690_10436693 Ga0207690_104366931 218
50 3300026023 Ga0207677_10215694 Ga0207677_102156941 218
51 3300025938 Ga0207704_10580895 Ga0207704_105808951 219
52 3300035695 Ga0373927_0102385 Ga0373927_0102385_556_1293 219
53 3300049571 Ga0501034_0042247 Ga0501034_0042247_3385_4098 219
54 3300049580 Ga0501046_0141430 Ga0501046_0141430_355_1086 219
55 3300049581 Ga0501047_0121637 Ga0501047_0121637_1551_2264 219
56 3300049581 Ga0501047_0448654 Ga0501047_0448654_12_743 219
57 3300049742 Ga0501080_0174404 Ga0501080_0174404_188_919 219
58 3300005577 Ga0068857_100093339 Ga0068857_1000933392 220
59 3300005937 Ga0081455_10003778 Ga0081455_1000377812 220
60 3300013105 Ga0157369_10542591 Ga0157369_105425912 220
61 3300022467 Ga0224712_10112714 Ga0224712_101127141 220
62 3300026116 Ga0207674_10135407 Ga0207674_101354072 220
63 3300035171 Ga0373946_0189352 Ga0373946_0189352_214_948 220
64 3300053088 Ga0500644_0018998 Ga0500644_0018998_208_939 220
65 3300048905 Ga0496102_0852107 Ga0496102_0852107_33_728 221
66 3300005344 Ga0070661_100031738 Ga0070661_1000317386 222
67 3300005353 Ga0070669_100226202 Ga0070669_1002262022 222
68 3300005366 Ga0070659_100080499 Ga0070659_1000804991 222
69 3300005440 Ga0070705_100239291 Ga0070705_1002392911 222
70 3300005535 Ga0070684_100031254 Ga0070684_1000312542 222
71 3300005548 Ga0070665_100140375 Ga0070665_1001403753 222
72 3300005564 Ga0070664_100025936 Ga0070664_1000259364 222
73 3300005614 Ga0068856_100047586 Ga0068856_1000475862 222
74 3300005616 Ga0068852_100276049 Ga0068852_1002760491 222
75 3300009174 Ga0105241_10376712 Ga0105241_103767122 222
76 3300009551 Ga0105238_10150619 Ga0105238_101506192 222
77 3300010375 Ga0105239_10391850 Ga0105239_103918502 222
78 3300013102 Ga0157371_10291542 Ga0157371_102915421 222
79 3300013105 Ga0157369_10184644 Ga0157369_101846441 222
80 3300020070 Ga0206356_11442817 Ga0206356_114428171 222
81 3300022467 Ga0224712_10120107 Ga0224712_101201072 222
82 3300025909 Ga0207705_10434885 Ga0207705_104348851 222
83 3300025913 Ga0207695_10599595 Ga0207695_105995951 222
84 3300025919 Ga0207657_10147416 Ga0207657_101474162 222
85 3300025932 Ga0207690_10230166 Ga0207690_102301661 222
86 3300025944 Ga0207661_10188126 Ga0207661_101881261 222
87 3300026078 Ga0207702_10040096 Ga0207702_100400964 222
88 3300026118 Ga0207675_100140681 Ga0207675_1001406813 222
89 3300028379 Ga0268266_10815017 Ga0268266_108150171 222
90 3300035691 Ga0373931_0305513 Ga0373931_0305513_248_970 222
91 3300037312 Ga0395899_0006200 Ga0395899_0006200_1613_2335 222
92 3300037418 Ga0395900_0004742 Ga0395900_0004742_9480_10202 222
93 3300044694 Ga0466963_0018767 Ga0466963_0018767_136_861 222
94 3300044842 Ga0466957_0198015 Ga0466957_0198015_501_1226 222
95 3300045976 Ga0466967_0107966 Ga0466967_0107966_609_1334 222
96 3300005330 Ga0070690_100143387 Ga0070690_1001433871 223
97 3300005338 Ga0068868_100195670 Ga0068868_1001956702 223
98 3300013296 Ga0157374_10429199 Ga0157374_104291992 223
99 3300013306 Ga0163162_10410480 Ga0163162_104104802 223
100 3300014969 Ga0157376_10133076 Ga0157376_101330762 223
101 3300025940 Ga0207691_10089951 Ga0207691_100899513 223
102 3300026023 Ga0207677_10144825 Ga0207677_101448252 223
103 3300037068 Ga0373925_0276800 Ga0373925_0276800_474_1205 223
104 3300039438 Ga0436360_0009934 Ga0436360_0009934_208_933 223
105 3300050494 nmdc:mga06z11_7805_c1 nmdc:mga06z11_7805_c1_884_1615 223
106 3300050496 nmdc:mga07m45_68901_c1 nmdc:mga07m45_68901_c1_722_1453 223
107 3300050515 nmdc:mga0a205_70094_c1 nmdc:mga0a205_70094_c1_1919_2662 223
108 3300005336 Ga0070680_100354019 Ga0070680_1003540192 224
109 3300005336 Ga0070680_100651615 Ga0070680_1006516151 224
110 3300005353 Ga0070669_100290909 Ga0070669_1002909092 224
111 3300005445 Ga0070708_100335977 Ga0070708_1003359772 224
112 3300005458 Ga0070681_10014577 Ga0070681_100145778 224
113 3300005548 Ga0070665_100003491 Ga0070665_10000349114 224
114 3300025912 Ga0207707_10065270 Ga0207707_100652702 224
115 3300028379 Ga0268266_10070832 Ga0268266_100708324 224
116 3300037471 Ga0395905_0275103 Ga0395905_0275103_777_1502 224
117 3300039447 Ga0436361_0862854 Ga0436361_0862854_601_1338 224
118 3300005327 Ga0070658_10004070 Ga0070658_100040704 225
119 3300005336 Ga0070680_100004020 Ga0070680_1000040208 225
120 3300005340 Ga0070689_100329077 Ga0070689_1003290771 225
121 3300005341 Ga0070691_10008144 Ga0070691_100081442 225
122 3300005344 Ga0070661_100146443 Ga0070661_1001464432 225
123 3300005364 Ga0070673_100164922 Ga0070673_1001649222 225
124 3300005458 Ga0070681_10001080 Ga0070681_1000108014 225
125 3300005530 Ga0070679_100012577 Ga0070679_1000125775 225
126 3300005563 Ga0068855_100011830 Ga0068855_1000118309 225
127 3300006038 Ga0075365_10273128 Ga0075365_102731282 225
128 3300006177 Ga0075362_10035907 Ga0075362_100359072 225
129 3300006177 Ga0075362_10049643 Ga0075362_100496432 225
130 3300006195 Ga0075366_10004023 Ga0075366_100040237 225
131 3300009093 Ga0105240_10054035 Ga0105240_100540356 225
132 3300009551 Ga0105238_10390780 Ga0105238_103907802 225
133 3300021384 Ga0213876_10005904 Ga0213876_100059041 225
134 3300025909 Ga0207705_10022609 Ga0207705_100226094 225
135 3300025912 Ga0207707_10003608 Ga0207707_100036086 225
136 3300025913 Ga0207695_10040468 Ga0207695_100404681 225
137 3300025919 Ga0207657_10035640 Ga0207657_100356404 225
138 3300025921 Ga0207652_10202800 Ga0207652_102028002 225
139 3300025923 Ga0207681_10171491 Ga0207681_101714912 225
140 3300025924 Ga0207694_10274624 Ga0207694_102746242 225
141 3300025926 Ga0207659_10020179 Ga0207659_100201791 225
142 3300025936 Ga0207670_10027870 Ga0207670_100278702 225
143 3300025960 Ga0207651_10555182 Ga0207651_105551821 225
144 3300026078 Ga0207702_10014235 Ga0207702_100142356 225
145 3300026142 Ga0207698_11102001 Ga0207698_111020011 225
146 3300037312 Ga0395899_0001760 Ga0395899_0001760_12238_12975 225
147 3300037418 Ga0395900_0044035 Ga0395900_0044035_952_1689 225
148 3300038443 Ga0395901_0002132 Ga0395901_0002132_5406_6143 225
149 3300039437 Ga0436365_1034188 Ga0436365_1034188_21978_22673 225
150 3300049589 Ga0501073_0200056 Ga0501073_0200056_72_773 225
151 3300050489 nmdc:mga03683_35520_c1 nmdc:mga03683_35520_c1_94_810 225
152 3300050489 nmdc:mga03683_65866_c1 nmdc:mga03683_65866_c1_106_834 225
153 3300050493 nmdc:mga0k408_2740_c1 nmdc:mga0k408_2740_c1_451_1167 225
154 3300005436 Ga0070713_100019108 Ga0070713_1000191083 227
155 3300005841 Ga0068863_100789698 Ga0068863_1007896981 227
156 3300025915 Ga0207693_10271292 Ga0207693_102712922 227
157 3300025928 Ga0207700_10058572 Ga0207700_100585722 227
158 3300025939 Ga0207665_10312039 Ga0207665_103120392 227
159 3300026088 Ga0207641_10169600 Ga0207641_101696002 227
160 3300028573 Ga0265334_10013613 Ga0265334_100136134 227
161 3300031247 Ga0265340_10025575 Ga0265340_100255753 227
162 3300037068 Ga0373925_0073932 Ga0373925_0073932_141_878 227
163 3300014968 Ga0157379_10172011 Ga0157379_101720112 228
164 3300035088 Ga0373940_0129880 Ga0373940_0129880_11_751 228
165 3300035112 Ga0373932_0092735 Ga0373932_0092735_202_942 228
166 3300035691 Ga0373931_0063333 Ga0373931_0063333_1072_1812 228
167 3300035695 Ga0373927_0196153 Ga0373927_0196153_527_1267 228
168 3300036401 Ga0373937_0097430 Ga0373937_0097430_1154_1894 228
169 3300049572 Ga0501036_0210695 Ga0501036_0210695_159_911 228
170 3300049591 Ga0501075_0383422 Ga0501075_0383422_68_820 228
171 3300049741 Ga0501079_0036261 Ga0501079_0036261_2941_3693 228
172 3300049824 Ga0501045_0208560 Ga0501045_0208560_129_881 228
173 3300053733 Ga0500552_000583 Ga0500552_000583_1760_2497 228
174 3300061734 Ga0530510_0088425 Ga0530510_0088425_1256_2008 228
175 3300005985 Ga0081539_10007126 Ga0081539_100071267 229
176 3300039110 Ga0400487_54173 Ga0400487_54173_1388_2089 229
177 3300031691 Ga0316579_10033121 Ga0316579_100331212 230
178 3300031728 Ga0316578_10099721 Ga0316578_100997212 230
179 3300031733 Ga0316577_10293096 Ga0316577_102930961 230
180 3300032133 Ga0316583_10041451 Ga0316583_100414512 230
181 3300032137 Ga0316585_10017568 Ga0316585_100175681 230
182 3300033524 Ga0316592_1033264 Ga0316592_10332642 230
183 3300033529 Ga0316587_1027381 Ga0316587_10273811 230
184 3300036647 Ga0316582_0247059 Ga0316582_0247059_308_1033 230
185 3300036712 Ga0316584_0180554 Ga0316584_0180554_804_1529 230
186 3300031665 Ga0316575_10032049 Ga0316575_100320492 231
187 iso_pu_bacteria 8054563764 8054565700 231
188 3300005983 Ga0081540_1009289 Ga0081540_10092897 232
189 3300005983 Ga0081540_1036545 Ga0081540_10365452 232
190 3300031247 Ga0265340_10004593 Ga0265340_100045934 232
191 3300031249 Ga0265339_10019199 Ga0265339_100191992 232
192 3300031344 Ga0265316_10012445 Ga0265316_100124454 232
193 3300031595 Ga0265313_10001114 Ga0265313_1000111413 232
194 3300031712 Ga0265342_10011655 Ga0265342_100116551 232
195 3300031995 Ga0307409_100308859 Ga0307409_1003088592 232
196 3300049571 Ga0501034_0488517 Ga0501034_0488517_212_952 232
197 3300049823 Ga0501044_0053405 Ga0501044_0053405_1166_1906 232
198 iso_pu_bacteria 2917554339 2917555058 232
199 3300006038 Ga0075365_10104197 Ga0075365_101041972 233
200 3300006042 Ga0075368_10012691 Ga0075368_100126913 233
201 3300006051 Ga0075364_10033938 Ga0075364_100339383 233
202 3300006178 Ga0075367_10030065 Ga0075367_100300652 233
203 3300006178 Ga0075367_10128229 Ga0075367_101282292 233
204 3300006846 Ga0075430_100239351 Ga0075430_1002393512 233
205 3300025928 Ga0207700_10207893 Ga0207700_102078932 233
206 3300031456 Ga0307513_10213901 Ga0307513_102139012 233
207 3300031730 Ga0307516_10040673 Ga0307516_100406734 233
208 3300049589 Ga0501073_0200723 Ga0501073_0200723_91_816 233
209 3300049823 Ga0501044_0053729 Ga0501044_0053729_3021_3725 233
210 3300050489 nmdc:mga03683_166516_c1 nmdc:mga03683_166516_c1_175_888 233
211 3300050490 nmdc:mga03n38_27109_c1 nmdc:mga03n38_27109_c1_1168_1881 233
212 3300050492 nmdc:mga0yw44_147846_c1 nmdc:mga0yw44_147846_c1_490_1203 233
213 3300050495 nmdc:mga04h51_112419_c1 nmdc:mga04h51_112419_c1_29_742 233
214 3300053090 Ga0500646_0044480 Ga0500646_0044480_237_998 233
215 3300053092 Ga0500583_0166033 Ga0500583_0166033_213_974 233
216 3300053096 Ga0500641_0056849 Ga0500641_0056849_324_1085 233
217 3300053104 Ga0500556_0036726 Ga0500556_0036726_264_1025 233
218 3300053131 Ga0500652_048659 Ga0500652_048659_381_1142 233
219 3300049572 Ga0501036_0282725 Ga0501036_0282725_627_1355 234
220 3300049580 Ga0501046_0498033 Ga0501046_0498033_139_858 234
221 3300049586 Ga0501070_0091956 Ga0501070_0091956_1205_1933 234
222 3300049589 Ga0501073_0000896 Ga0501073_0000896_11771_12634 235
223 3300049744 Ga0501083_0017473 Ga0501083_0017473_2589_3452 235
224 3300060353 Ga0501082_0178143 Ga0501082_0178143_522_1385 235
225 3300005546 Ga0070696_100242106 Ga0070696_1002421062 236
226 3300005843 Ga0068860_100347047 Ga0068860_1003470472 236
227 3300006038 Ga0075365_10077886 Ga0075365_100778863 236
228 3300006844 Ga0075428_100003163 Ga0075428_10000316317 236
229 3300006880 Ga0075429_100340331 Ga0075429_1003403311 236
230 3300009147 Ga0114129_10020885 Ga0114129_1002088510 236
231 3300026089 Ga0207648_10293888 Ga0207648_102938882 236
232 3300049578 Ga0501042_0378981 Ga0501042_0378981_88_822 236
233 3300050507 nmdc:mga05p37_630074_c1 nmdc:mga05p37_630074_c1_73_810 236
234 3300050508 nmdc:mga09592_332631_c1 nmdc:mga09592_332631_c1_218_955 236
235 3300050511 nmdc:mga08y16_353352_c1 nmdc:mga08y16_353352_c1_95_832 236
236 3300006038 Ga0075365_10017418 Ga0075365_100174182 237
237 3300006051 Ga0075364_10014752 Ga0075364_100147525 237
238 3300046455 Ga0495603_0084366 Ga0495603_0084366_650_1390 237
239 3300048907 Ga0496104_0002697 Ga0496104_0002697_286_1026 237
240 3300048908 Ga0496105_0205548 Ga0496105_0205548_718_1458 237
241 3300048911 Ga0496108_0074647 Ga0496108_0074647_109_849 237
242 3300048912 Ga0496109_0009026 Ga0496109_0009026_2375_3115 237
243 3300048913 Ga0496110_0000798 Ga0496110_0000798_7268_8008 237
244 3300048914 Ga0496111_0014600 Ga0496111_0014600_2199_2939 237
245 3300048916 Ga0496113_0006675 Ga0496113_0006675_2853_3593 237
246 3300049578 Ga0501042_0159625 Ga0501042_0159625_12_752 237
247 3300049586 Ga0501070_0131656 Ga0501070_0131656_283_1023 237
248 3300049593 Ga0501077_0123976 Ga0501077_0123976_466_1206 237
249 3300050491 nmdc:mga00v17_3154_c1 nmdc:mga00v17_3154_c1_1906_2649 237
250 3300050494 nmdc:mga06z11_8985_c1 nmdc:mga06z11_8985_c1_2632_3375 237
251 3300060353 Ga0501082_0049510 Ga0501082_0049510_1901_2641 237
252 3300005334 Ga0068869_100081190 Ga0068869_1000811902 238
253 3300005336 Ga0070680_100002429 Ga0070680_10000242910 238
254 3300005340 Ga0070689_100501579 Ga0070689_1005015792 238
255 3300005341 Ga0070691_10001921 Ga0070691_100019212 238
256 3300005341 Ga0070691_10009985 Ga0070691_100099853 238
257 3300005345 Ga0070692_10086459 Ga0070692_100864591 238
258 3300005406 Ga0070703_10006756 Ga0070703_100067561 238
259 3300005440 Ga0070705_100001191 Ga0070705_1000011912 238
260 3300005440 Ga0070705_100357086 Ga0070705_1003570862 238
261 3300005441 Ga0070700_100003138 Ga0070700_1000031381 238
262 3300005444 Ga0070694_100003405 Ga0070694_1000034051 238
263 3300005455 Ga0070663_100692623 Ga0070663_1006926231 238
264 3300005458 Ga0070681_10038983 Ga0070681_100389835 238
265 3300005518 Ga0070699_100000576 Ga0070699_10000057625 238
266 3300005536 Ga0070697_100029756 Ga0070697_1000297563 238
267 3300005536 Ga0070697_100348133 Ga0070697_1003481331 238
268 3300005539 Ga0068853_100115526 Ga0068853_1001155261 238
269 3300005545 Ga0070695_100004237 Ga0070695_1000042376 238
270 3300005545 Ga0070695_100008859 Ga0070695_1000088594 238
271 3300005546 Ga0070696_100000306 Ga0070696_10000030613 238
272 3300005547 Ga0070693_100051494 Ga0070693_1000514942 238
273 3300005577 Ga0068857_100002806 Ga0068857_1000028068 238
274 3300005617 Ga0068859_100000758 Ga0068859_1000007586 238
275 3300005719 Ga0068861_100045098 Ga0068861_1000450981 238
276 3300005841 Ga0068863_100513623 Ga0068863_1005136232 238
277 3300005843 Ga0068860_100005957 Ga0068860_1000059574 238
278 3300005843 Ga0068860_100310317 Ga0068860_1003103172 238
279 3300005844 Ga0068862_100003289 Ga0068862_10000328913 238
280 3300005937 Ga0081455_10000559 Ga0081455_1000055937 238
281 3300005983 Ga0081540_1000034 Ga0081540_1000034112 238
282 3300005983 Ga0081540_1062561 Ga0081540_10625612 238
283 3300006844 Ga0075428_100025496 Ga0075428_1000254962 238
284 3300006846 Ga0075430_100017713 Ga0075430_1000177135 238
285 3300006847 Ga0075431_100003540 Ga0075431_1000035405 238
286 3300006847 Ga0075431_100008143 Ga0075431_1000081435 238
287 3300006852 Ga0075433_10034716 Ga0075433_100347165 238
288 3300006852 Ga0075433_10280989 Ga0075433_102809892 238
289 3300006852 Ga0075433_10532949 Ga0075433_105329491 238
290 3300006871 Ga0075434_100153388 Ga0075434_1001533882 238
291 3300006871 Ga0075434_100555973 Ga0075434_1005559732 238
292 3300006881 Ga0068865_100292176 Ga0068865_1002921761 238
293 3300006914 Ga0075436_100018938 Ga0075436_1000189384 238
294 3300006931 Ga0097620_100000758 Ga0097620_1000007586 238
295 3300007076 Ga0075435_100008127 Ga0075435_1000081273 238
296 3300009094 Ga0111539_10008126 Ga0111539_1000812615 238
297 3300009094 Ga0111539_10016129 Ga0111539_100161295 238
298 3300009094 Ga0111539_10132528 Ga0111539_101325282 238
299 3300009094 Ga0111539_10403645 Ga0111539_104036452 238
300 3300009098 Ga0105245_10117296 Ga0105245_101172964 238
301 3300009098 Ga0105245_10488757 Ga0105245_104887572 238
302 3300009101 Ga0105247_10064661 Ga0105247_100646612 238
303 3300009147 Ga0114129_10088856 Ga0114129_100888565 238
304 3300009177 Ga0105248_10245551 Ga0105248_102455511 238
305 3300009553 Ga0105249_10002183 Ga0105249_100021839 238
306 3300010375 Ga0105239_10191751 Ga0105239_101917513 238
307 3300013308 Ga0157375_10149658 Ga0157375_101496581 238
308 3300014968 Ga0157379_10128465 Ga0157379_101284652 238
309 3300017792 Ga0163161_10023494 Ga0163161_100234944 238
310 3300025885 Ga0207653_10004101 Ga0207653_100041014 238
311 3300025904 Ga0207647_10074560 Ga0207647_100745602 238
312 3300025910 Ga0207684_10123777 Ga0207684_101237772 238
313 3300025912 Ga0207707_10052945 Ga0207707_100529452 238
314 3300025932 Ga0207690_10140708 Ga0207690_101407081 238
315 3300025935 Ga0207709_10054041 Ga0207709_100540412 238
316 3300025961 Ga0207712_10014626 Ga0207712_100146265 238
317 3300025972 Ga0207668_10066689 Ga0207668_100666893 238
318 3300025972 Ga0207668_10667853 Ga0207668_106678531 238
319 3300026067 Ga0207678_10007695 Ga0207678_100076958 238
320 3300026088 Ga0207641_10519328 Ga0207641_105193282 238
321 3300026116 Ga0207674_10002061 Ga0207674_1000206112 238
322 3300027907 Ga0207428_10019144 Ga0207428_100191443 238
323 3300028380 Ga0268265_10005384 Ga0268265_100053843 238
324 3300028381 Ga0268264_11086086 Ga0268264_110860861 238
325 3300034819 Ga0373958_0008480 Ga0373958_0008480_781_1527 238
326 3300034819 Ga0373958_0034509 Ga0373958_0034509_183_929 238
327 3300034957 Ga0373938_0008972 Ga0373938_0008972_886_1632 238
328 3300035085 Ga0373929_0048364 Ga0373929_0048364_106_852 238
329 3300035090 Ga0373949_0074209 Ga0373949_0074209_106_852 238
330 3300035092 Ga0373952_0012631 Ga0373952_0012631_776_1522 238
331 3300035112 Ga0373932_0005865 Ga0373932_0005865_2135_2881 238
332 3300035115 Ga0373941_0089431 Ga0373941_0089431_297_1043 238
333 3300035119 Ga0373956_0184799 Ga0373956_0184799_206_952 238
334 3300035207 Ga0373942_0008661 Ga0373942_0008661_821_1567 238
335 3300035691 Ga0373931_0001143 Ga0373931_0001143_5759_6505 238
336 3300035691 Ga0373931_0005929 Ga0373931_0005929_1645_2391 238
337 3300037068 Ga0373925_0219617 Ga0373925_0219617_667_1413 238
338 3300046457 Ga0495590_0111988 Ga0495590_0111988_129_875 238
339 3300046491 Ga0495584_0062267 Ga0495584_0062267_820_1566 238
340 3300046681 Ga0495647_0224666 Ga0495647_0224666_70_816 238
341 3300048904 Ga0496101_0213396 Ga0496101_0213396_326_1075 238
342 3300048905 Ga0496102_0003057 Ga0496102_0003057_33_776 238
343 3300048908 Ga0496105_0017645 Ga0496105_0017645_3785_4534 238
344 3300048909 Ga0496106_0002107 Ga0496106_0002107_12937_13680 238
345 3300048909 Ga0496106_0116363 Ga0496106_0116363_770_1519 238
346 3300048910 Ga0496107_0005009 Ga0496107_0005009_361_1104 238
347 3300048910 Ga0496107_0529597 Ga0496107_0529597_88_837 238
348 3300048911 Ga0496108_0150021 Ga0496108_0150021_1159_1908 238
349 3300048911 Ga0496108_0189080 Ga0496108_0189080_53_799 238
350 3300048913 Ga0496110_0217218 Ga0496110_0217218_842_1588 238
351 3300048913 Ga0496110_0920034 Ga0496110_0920034_11_760 238
352 3300048914 Ga0496111_0107066 Ga0496111_0107066_54_800 238
353 3300048915 Ga0496112_0031836 Ga0496112_0031836_3694_4443 238
354 3300048915 Ga0496112_0322203 Ga0496112_0322203_30_776 238
355 3300048916 Ga0496113_0039240 Ga0496113_0039240_2208_2954 238
356 3300048918 Ga0496115_0017709 Ga0496115_0017709_4141_4890 238
357 3300048918 Ga0496115_0071269 Ga0496115_0071269_1415_2158 238
358 3300049575 Ga0501039_0322238 Ga0501039_0322238_225_968 238
359 3300049576 Ga0501040_0038801 Ga0501040_0038801_1622_2365 238
360 3300049579 Ga0501043_0160014 Ga0501043_0160014_952_1695 238
361 3300049580 Ga0501046_0156106 Ga0501046_0156106_153_896 238
362 3300049592 Ga0501076_0302262 Ga0501076_0302262_521_1264 238
363 3300049593 Ga0501077_0084907 Ga0501077_0084907_605_1348 238
364 3300049741 Ga0501079_0457149 Ga0501079_0457149_143_886 238
365 3300049743 Ga0501081_0054376 Ga0501081_0054376_1376_2119 238
366 3300050507 nmdc:mga05p37_441939_c1 nmdc:mga05p37_441939_c1_418_1161 238
367 3300050509 nmdc:mga0qj67_14972_c1 nmdc:mga0qj67_14972_c1_4169_4912 238
368 3300050510 nmdc:mga06r32_4445_c1 nmdc:mga06r32_4445_c1_9268_10020 238
369 3300050510 nmdc:mga06r32_8520_c1 nmdc:mga06r32_8520_c1_1863_2606 238
370 3300050511 nmdc:mga08y16_251989_c1 nmdc:mga08y16_251989_c1_1053_1799 238
371 3300050511 nmdc:mga08y16_32911_c1 nmdc:mga08y16_32911_c1_546_1292 238
372 3300050511 nmdc:mga08y16_457101_c1 nmdc:mga08y16_457101_c1_254_997 238
373 3300050512 nmdc:mga0n895_17124_c1 nmdc:mga0n895_17124_c1_5777_6523 238
374 3300050512 nmdc:mga0n895_376469_c1 nmdc:mga0n895_376469_c1_675_1421 238
375 3300050513 nmdc:mga0rr50_167247_c1 nmdc:mga0rr50_167247_c1_749_1495 238
376 3300050514 nmdc:mga08x19_40148_c1 nmdc:mga08x19_40148_c1_107_853 238
377 3300050515 nmdc:mga0a205_46109_c1 nmdc:mga0a205_46109_c1_799_1545 238
378 3300050515 nmdc:mga0a205_64266_c1 nmdc:mga0a205_64266_c1_1684_2430 238
379 3300050515 nmdc:mga0a205_657145_c1 nmdc:mga0a205_657145_c1_21_764 238
380 3300054114 Ga0501084_0180083 Ga0501084_0180083_879_1622 238
381 3300060353 Ga0501082_0312570 Ga0501082_0312570_368_1111 238
382 3300061734 Ga0530510_0080123 Ga0530510_0080123_518_1261 238
383 3300049575 Ga0501039_0525037 Ga0501039_0525037_141_887 239
384 3300049591 Ga0501075_0048895 Ga0501075_0048895_1013_1759 239
385 3300049592 Ga0501076_0364928 Ga0501076_0364928_55_801 239
386 3300049593 Ga0501077_0026367 Ga0501077_0026367_458_1204 239
387 3300049824 Ga0501045_0129842 Ga0501045_0129842_1033_1779 239
388 2162886012 MBSR1b_contig_11937103 MBSR1b_0651.00002040 240
389 3300005293 Ga0065715_10131104 Ga0065715_101311042 240
390 3300006852 Ga0075433_10270057 Ga0075433_102700572 240
391 3300009147 Ga0114129_10322653 Ga0114129_103226532 240
392 3300048909 Ga0496106_0318487 Ga0496106_0318487_17_739 240
393 3300048911 Ga0496108_0297584 Ga0496108_0297584_475_1197 240
394 3300048913 Ga0496110_0031990 Ga0496110_0031990_2145_2867 240
395 3300048915 Ga0496112_0112581 Ga0496112_0112581_163_885 240
396 3300050515 nmdc:mga0a205_429294_c1 nmdc:mga0a205_429294_c1_281_1003 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04280

Tim44

Tim44-like domain

139

285

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cw9-assembly1.cif.gz_A crystal structure of human tim44 c-terminal domain 0.8502 91 239
6nu3-assembly1.cif.gz_d structural insights into unique features of the human mitochondrial ribosome recycling 0.8424 91 240
4ce4-assembly1.cif.gz_i 39s large subunit of the porcine mitochondrial ribosome 0.8374 90 239
7qh6-assembly1.cif.gz_d cryo-em structure of the human mtlsu assembly intermediate upon mrm2 depletion - class 1 0.8256 86 239
7ods-assembly1.cif.gz_d state b of the human mitoribosomal large subunit assembly intermediate 0.8106 81 239
ID Description Score Start End Superfamily
af_Q8GXP7_158_313_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8975 92 239 3.10.450.240
af_O02161_236_422_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8929 91 239 3.10.450.240
3j7yd00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8566 91 240 3.10.450.240
af_Q1PF33_284_473_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8491 88 237 3.10.450.240
af_Q8GXP7_158_313_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.849 92 239 3.10.450.240
ID Description Score Start End GO Terms
AF-A0A522WFA1-F1-model_v4 Tim44 domain-containing protein 0.9996 114 240
AF-A0A4R5XK26-F1-model_v4 deleted 0.9905 105 240
AF-D5RNY5-F1-model_v4 Tim44-like domain protein 0.9841 85 239 GO:0005840
GO:1990904
AF-A0A4R5XK26-F1-model_v4 deleted 0.9833 105 240
AF-A0A520HWE3-F1-model_v4 Tim44 domain-containing protein 0.978 112 239

Feature Viewer

pLDDT pTM Quality
80.85 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map