F433640

General Info

Members Datasets Scaffolds Average Seq Length
396 215 396 143

Family's Representative Sequence

Representative Sequence 3300059653|Ga0587108_021951|Ga0587108_021951_41_538
Length 165
Sequence MYMHSFQGGATLLSLGGDRRLMPGCLWLGRAAARGDARHGETVPTISQLVRKGRIKVISKTKSPALQDSPQKRGVCIRVFTQTPKKPNSALRKVARVRLTNGMEVTTYIPGEGHNLQEHSMVLIRGGRVKDLPGVRYHVVRGTLDTTGVNGRRQRRSKYGAKRPK

Samples

Sample ID Description Type Environment
1 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
68 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
100 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
101 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
134 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
135 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
189 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
190 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 62.37
Metatranscriptomes 37.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 1.26
Rhizosphere 95.96
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006778J45830_1055955 3300003162 Bacteria 603
2 Ga0006780_1027817 3300003735 Bacteria 598
3 Ga0058859_11541496 3300004798 Bacteria 1557
4 Ga0058863_10089294 3300004799 Bacteria 899
5 Ga0058863_11343003 3300004799 Bacteria 1919
6 Ga0058863_11685326 3300004799 Bacteria 607
7 Ga0058861_10010842 3300004800 Bacteria 921
8 Ga0058861_11600259 3300004800 Bacteria 661
9 Ga0058861_11910142 3300004800 Bacteria 516
10 Ga0058861_12044408 3300004800 Bacteria 1385
11 Ga0058860_11515064 3300004801 Bacteria 787
12 Ga0058860_11963796 3300004801 Bacteria 869
13 Ga0058860_12229996 3300004801 Bacteria 727
14 Ga0058862_10016850 3300004803 Bacteria 2924
15 Ga0058862_12307542 3300004803 Bacteria 612
16 Ga0070683_100748084 3300005329 Bacteria 937
17 Ga0070683_100763833 3300005329 Bacteria 926
18 Ga0070690_100327006 3300005330 Bacteria 1106
19 Ga0070680_100056650 3300005336 Bacteria 3204
20 Ga0070682_100582992 3300005337 Bacteria 880
21 Ga0070689_100731501 3300005340 Bacteria 866
22 Ga0070691_10063694 3300005341 Bacteria 1778
23 Ga0070687_100325523 3300005343 Bacteria 983
24 Ga0070687_100536678 3300005343 Bacteria 793
25 Ga0070692_10026471 3300005345 Bacteria 2867
26 Ga0070692_10352404 3300005345 Bacteria 915
27 Ga0070692_10416834 3300005345 Bacteria 851
28 Ga0070692_10697529 3300005345 Bacteria 683
29 Ga0070692_10954449 3300005345 Bacteria 596
30 Ga0070692_10961923 3300005345 Bacteria 594
31 Ga0070674_100188831 3300005356 Bacteria 1583
32 Ga0070673_100542378 3300005364 Bacteria 1056
33 Ga0070688_100192775 3300005365 Bacteria 1421
34 Ga0070667_100930438 3300005367 Bacteria 810
35 Ga0070701_10166564 3300005438 Bacteria 1280
36 Ga0070701_10580794 3300005438 Bacteria 739
37 Ga0070700_100808643 3300005441 Bacteria 755
38 Ga0070708_100284538 3300005445 Bacteria 1556
39 Ga0070708_101184557 3300005445 Bacteria 715
40 Ga0070681_10034374 3300005458 Bacteria 5089
41 Ga0070681_10053425 3300005458 Bacteria 4026
42 Ga0070681_10440471 3300005458 Bacteria 1215
43 Ga0070681_10693290 3300005458 Bacteria 934
44 Ga0070706_100433955 3300005467 Bacteria 1223
45 Ga0070707_100032771 3300005468 Bacteria 4951
46 Ga0070707_100308766 3300005468 Bacteria 1537
47 Ga0070707_100403239 3300005468 Bacteria 1327
48 Ga0070698_100044978 3300005471 Bacteria 4519
49 Ga0070698_100189887 3300005471 Bacteria 1992
50 Ga0070698_100535018 3300005471 Bacteria 1110
51 Ga0070698_101156962 3300005471 Bacteria 723
52 Ga0070699_100202634 3300005518 Bacteria 1765
53 Ga0070699_100215701 3300005518 Bacteria 1709
54 Ga0070679_100197058 3300005530 Bacteria 1981
55 Ga0070684_100643153 3300005535 Bacteria 987
56 Ga0070684_102089000 3300005535 Bacteria 535
57 Ga0070697_100363009 3300005536 Bacteria 1252
58 Ga0070686_100076592 3300005544 Bacteria 2203
59 Ga0070686_100966179 3300005544 Bacteria 697
60 Ga0070695_100046885 3300005545 Bacteria 2758
61 Ga0070695_101347685 3300005545 Bacteria 590
62 Ga0070696_101491520 3300005546 Bacteria 579
63 Ga0070693_100158461 3300005547 Bacteria 1440
64 Ga0070704_100643428 3300005549 Bacteria 935
65 Ga0070704_101085434 3300005549 Bacteria 726
66 Ga0068855_101697720 3300005563 Bacteria 644
67 Ga0070664_100097239 3300005564 Bacteria 2556
68 Ga0070664_101638004 3300005564 Bacteria 610
69 Ga0068857_100079419 3300005577 Bacteria 2928
70 Ga0068857_100303574 3300005577 Bacteria 1472
71 Ga0068856_100003080 3300005614 Bacteria 17026
72 Ga0068856_101391990 3300005614 Bacteria 716
73 Ga0068863_100024921 3300005841 Bacteria 5706
74 Ga0068863_102646140 3300005841 Bacteria 511
75 Ga0075428_100174817 3300006844 Bacteria 2326
76 Ga0075433_10124141 3300006852 Bacteria 2293
77 Ga0075434_100169179 3300006871 Bacteria 2205
78 Ga0075434_100409208 3300006871 Bacteria 1377
79 Ga0075434_100478747 3300006871 Bacteria 1266
80 Ga0075429_100012038 3300006880 Bacteria 7496
81 Ga0075436_100530740 3300006914 Bacteria 863
82 Ga0075435_100061649 3300007076 Bacteria 3043
83 Ga0099794_10051470 3300007265 Bacteria 1983
84 Ga0111539_10433107 3300009094 Bacteria 1531
85 Ga0105245_10288254 3300009098 Bacteria 1607
86 Ga0105245_10808317 3300009098 Bacteria 976
87 Ga0105245_10873836 3300009098 Bacteria 940
88 Ga0114129_10032319 3300009147 Bacteria 7396
89 Ga0114129_10250376 3300009147 Bacteria 2378
90 Ga0114129_10492862 3300009147 Bacteria 1601
91 Ga0114129_10528127 3300009147 Bacteria 1538
92 Ga0114129_11450141 3300009147 Bacteria 845
93 Ga0105243_10137867 3300009148 Bacteria 2078
94 Ga0105242_10202811 3300009176 Bacteria 1763
95 Ga0105242_10509568 3300009176 Bacteria 1146
96 Ga0105249_10196775 3300009553 Bacteria 1970
97 Ga0105239_11706906 3300010375 Bacteria 729
98 Ga0105246_10087556 3300011119 Bacteria 2236
99 Ga0105246_10150180 3300011119 Bacteria 1763
100 Ga0105246_10321783 3300011119 Bacteria 1257
101 Ga0154010_173837 3300013062 Bacteria 515
102 Ga0157369_10516145 3300013105 Bacteria 1236
103 Ga0157378_11015360 3300013297 Bacteria 864
104 Ga0157378_11171976 3300013297 Bacteria 807
105 Ga0157378_11481632 3300013297 Bacteria 723
106 Ga0163162_10962707 3300013306 Bacteria 964
107 Ga0157372_11854899 3300013307 Bacteria 693
108 Ga0157380_10238574 3300014326 Bacteria 1638
109 Ga0157377_10048672 3300014745 Bacteria 2380
110 Ga0157376_10747660 3300014969 Bacteria 987
111 Ga0197907_10093496 3300020069 Bacteria 659
112 Ga0197907_10154325 3300020069 Bacteria 705
113 Ga0197907_10252772 3300020069 Bacteria 3893
114 Ga0197907_10269474 3300020069 Bacteria 1198
115 Ga0197907_10367232 3300020069 Bacteria 812
116 Ga0197907_10538618 3300020069 Bacteria 687
117 Ga0197907_10971794 3300020069 Bacteria 1249
118 Ga0197907_11474923 3300020069 Bacteria 951
119 Ga0206356_10069329 3300020070 Bacteria 1376
120 Ga0206356_10204839 3300020070 Bacteria 731
121 Ga0206356_10974274 3300020070 Bacteria 1330
122 Ga0206356_11604834 3300020070 Bacteria 760
123 Ga0206356_11715450 3300020070 Bacteria 1145
124 Ga0206349_1092110 3300020075 Bacteria 755
125 Ga0206349_1264343 3300020075 Bacteria 616
126 Ga0206349_1438528 3300020075 Bacteria 1090
127 Ga0206349_1649908 3300020075 Bacteria 709
128 Ga0206355_1094291 3300020076 Bacteria 830
129 Ga0206355_1195409 3300020076 Bacteria 757
130 Ga0206355_1276443 3300020076 Bacteria 611
131 Ga0206355_1582374 3300020076 Bacteria 1323
132 Ga0206355_1698176 3300020076 Bacteria 1634
133 Ga0206351_10126038 3300020077 Bacteria 611
134 Ga0206351_10177577 3300020077 Bacteria 799
135 Ga0206351_10623440 3300020077 Bacteria 513
136 Ga0206351_10766954 3300020077 Bacteria 958
137 Ga0206351_11004892 3300020077 Bacteria 755
138 Ga0206352_10124340 3300020078 Bacteria 614
139 Ga0206352_10416611 3300020078 Bacteria 950
140 Ga0206352_10532168 3300020078 Bacteria 830
141 Ga0206352_10998698 3300020078 Bacteria 727
142 Ga0206352_11002200 3300020078 Bacteria 600
143 Ga0206352_11256098 3300020078 Bacteria 1180
144 Ga0206350_10006052 3300020080 Bacteria 1204
145 Ga0206350_10051417 3300020080 Bacteria 776
146 Ga0206350_10192683 3300020080 Bacteria 1886
147 Ga0206350_10690478 3300020080 Bacteria 979
148 Ga0206350_11405114 3300020080 Bacteria 808
149 Ga0206354_10565914 3300020081 Bacteria 942
150 Ga0206354_10808528 3300020081 Bacteria 3222
151 Ga0206354_10905553 3300020081 Bacteria 1366
152 Ga0206354_11118243 3300020081 Bacteria 779
153 Ga0206353_10115998 3300020082 Bacteria 1391
154 Ga0206353_10315189 3300020082 Bacteria 688
155 Ga0206353_10470459 3300020082 Bacteria 661
156 Ga0206353_10999105 3300020082 Bacteria 3046
157 Ga0206353_11017824 3300020082 Bacteria 570
158 Ga0206353_11020322 3300020082 Bacteria 665
159 Ga0206353_11697222 3300020082 Bacteria 1010
160 Ga0154015_1143752 3300020610 Bacteria 784
161 Ga0154015_1162876 3300020610 Bacteria 616
162 Ga0154015_1183546 3300020610 Bacteria 3796
163 Ga0154015_1434376 3300020610 Bacteria 1166
164 Ga0154015_1593158 3300020610 Bacteria 615
165 Ga0154015_1600242 3300020610 Bacteria 562
166 Ga0224712_10024695 3300022467 Bacteria 2103
167 Ga0224712_10161222 3300022467 Bacteria 1000
168 Ga0224712_10174542 3300022467 Bacteria 965
169 Ga0224712_10197197 3300022467 Bacteria 914
170 Ga0224712_10293062 3300022467 Bacteria 759
171 Ga0224712_10297974 3300022467 Bacteria 754
172 Ga0224712_10349022 3300022467 Bacteria 699
173 Ga0207653_10002676 3300025885 Bacteria 5657
174 Ga0207688_10207817 3300025901 Bacteria 1175
175 Ga0207684_10008180 3300025910 Bacteria 9316
176 Ga0207684_10037204 3300025910 Bacteria 4130
177 Ga0207707_10035774 3300025912 Bacteria 4343
178 Ga0207707_10195320 3300025912 Bacteria 1765
179 Ga0207660_10041632 3300025917 Bacteria 3220
180 Ga0207662_10020862 3300025918 Bacteria 3740
181 Ga0207662_10058365 3300025918 Bacteria 2310
182 Ga0207662_10224582 3300025918 Bacteria 1224
183 Ga0207652_10011932 3300025921 Bacteria 7012
184 Ga0207646_10002570 3300025922 Bacteria 21439
185 Ga0207646_10168780 3300025922 Bacteria 1976
186 Ga0207646_10294258 3300025922 Bacteria 1467
187 Ga0207646_10362100 3300025922 Bacteria 1310
188 Ga0207659_11172917 3300025926 Bacteria 660
189 Ga0207644_10424459 3300025931 Bacteria 1090
190 Ga0207686_10125162 3300025934 Bacteria 1755
191 Ga0207686_10378568 3300025934 Bacteria 1073
192 Ga0207689_10593902 3300025942 Bacteria 931
193 Ga0207661_10675741 3300025944 Bacteria 949
194 Ga0207651_10774051 3300025960 Bacteria 849
195 Ga0207708_10088215 3300026075 Bacteria 2389
196 Ga0207702_10197673 3300026078 Unclassified 1862
197 Ga0207641_10018124 3300026088 Bacteria 5769
198 Ga0207641_10465396 3300026088 Bacteria 1224
199 Ga0207648_11161437 3300026089 Bacteria 725
200 Ga0207676_10489441 3300026095 Bacteria 1166
201 Ga0207674_10084528 3300026116 Bacteria 3171
202 Ga0207675_100058279 3300026118 Bacteria 3604
203 Ga0207675_100343404 3300026118 Bacteria 1462
204 Ga0207675_100886749 3300026118 Bacteria 908
205 Ga0210000_1011630 3300027462 Bacteria 1305
206 Ga0268265_10364405 3300028380 Bacteria 1324
207 Ga0265334_10208181 3300028573 Bacteria 678
208 Ga0265323_10047345 3300028653 Bacteria 1538
209 Ga0265323_10136118 3300028653 Bacteria 793
210 Ga0265322_10016276 3300028654 Bacteria 2146
211 Ga0265322_10135378 3300028654 Bacteria 703
212 Ga0310981_1031241 3300029285 Bacteria 750
213 Ga0265330_10000448 3300031235 Bacteria 27585
214 Ga0265330_10006140 3300031235 Bacteria 5950
215 Ga0265330_10081343 3300031235 Bacteria 1395
216 Ga0265329_10000002 3300031242 Bacteria 121896
217 Ga0265316_10000017 3300031344 Bacteria 198446
218 Ga0265316_10080842 3300031344 Bacteria 2492
219 Ga0265316_10898105 3300031344 Unclassified 619
220 Ga0265314_10001844 3300031711 Bacteria 22765
221 Ga0265342_10001365 3300031712 Bacteria 22838
222 Ga0265342_10198455 3300031712 Unclassified 1092
223 Ga0316576_10214036 3300031727 Bacteria 1450
224 Ga0316578_10126485 3300031728 Bacteria 1537
225 Ga0316578_10166405 3300031728 Bacteria 1329
226 Ga0307405_10975435 3300031731 Bacteria 722
227 Ga0316577_10031162 3300031733 Bacteria 2979
228 Ga0307410_10463384 3300031852 Bacteria 1036
229 Ga0307406_10438722 3300031901 Bacteria 1045
230 Ga0307407_10177973 3300031903 Bacteria 1407
231 Ga0307412_10329406 3300031911 Bacteria 1218
232 Ga0307412_10511072 3300031911 Bacteria 1002
233 Ga0307409_100659630 3300031995 Bacteria 1041
234 Ga0307416_100016869 3300032002 Bacteria 5090
235 Ga0307416_100149910 3300032002 Bacteria 2137
236 Ga0307416_103855675 3300032002 Bacteria 502
237 Ga0307411_10591022 3300032005 Bacteria 953
238 Ga0307411_10800089 3300032005 Bacteria 830
239 Ga0307415_100164076 3300032126 Bacteria 1725
240 Ga0307415_100295631 3300032126 Bacteria 1339
241 Ga0316593_10003678 3300032168 Bacteria 3839
242 Ga0316593_10137620 3300032168 Bacteria 884
243 Ga0316592_1043741 3300033524 Bacteria 995
244 Ga0316586_1023770 3300033527 Bacteria 1025
245 Ga0316596_1140889 3300033541 Bacteria 660
246 Ga0373930_0167069 3300034816 Bacteria 559
247 Ga0373932_0284036 3300035112 Bacteria 613
248 Ga0373960_0132976 3300035121 Bacteria 836
249 Ga0316574_0048148 3300035398 Bacteria 2646
250 Ga0373947_1060449 3300035725 Bacteria 553
251 Ga0316582_0044586 3300036647 Bacteria 2789
252 Ga0373925_0353755 3300037068 Bacteria 1193
253 Ga0436360_1159830 3300039438 Bacteria 694
254 Ga0436362_0073990 3300039453 Bacteria 1132
255 Ga0451791_0167706 3300041451 Bacteria 513
256 Ga0451795_0786766 3300041456 Bacteria 1710
257 Ga0451837_1734014 3300041494 Bacteria 589
258 Ga0451852_08977 3300041508 Bacteria 719
259 Ga0451852_19387 3300041508 Bacteria 646
260 Ga0451852_22466 3300041508 Bacteria 554
261 Ga0451577_0000003 3300042876 Bacteria 921850
262 Ga0451577_0010367 3300042876 Bacteria 8916
263 Ga0451577_0134017 3300042876 Bacteria 2223
264 Ga0466972_0009174 3300044658 Bacteria 4968
265 Ga0453683_0029221 3300044673 Bacteria 3487
266 Ga0453683_1047788 3300044673 Bacteria 543
267 Ga0466965_0002895 3300044683 Bacteria 7411
268 Ga0453684_0000018 3300044712 Bacteria 921850
269 Ga0453684_0000777 3300044712 Bacteria 110019
270 Ga0453684_0043202 3300044712 Bacteria 6062
271 Ga0453684_0051716 3300044712 Bacteria 5382
272 Ga0453684_0105596 3300044712 Bacteria 3434
273 Ga0453684_0115958 3300044712 Bacteria 3245
274 Ga0453684_0275723 3300044712 Bacteria 1920
275 Ga0453684_0301163 3300044712 Bacteria 1822
276 Ga0453684_0383972 3300044712 Bacteria 1576
277 Ga0453684_0638923 3300044712 Bacteria 1162
278 Ga0453684_0988734 3300044712 Bacteria 895
279 Ga0453684_1382495 3300044712 Bacteria 731
280 Ga0466968_0045346 3300044735 Bacteria 1865
281 Ga0466960_0006893 3300044901 Bacteria 4582
282 Ga0451576_0000055 3300045051 Bacteria 304830
283 Ga0451576_0000063 3300045051 Bacteria 278985
284 Ga0451576_0000202 3300045051 Bacteria 149973
285 Ga0451576_0004064 3300045051 Bacteria 19377
286 Ga0451576_0024386 3300045051 Bacteria 6534
287 Ga0451576_0040717 3300045051 Bacteria 4915
288 Ga0451576_0097979 3300045051 Bacteria 3049
289 Ga0451576_0113020 3300045051 Bacteria 2827
290 Ga0451576_0126649 3300045051 Bacteria 2661
291 Ga0451576_0228583 3300045051 Bacteria 1943
292 Ga0451576_0286752 3300045051 Bacteria 1721
293 Ga0451576_1390036 3300045051 Bacteria 731
294 Ga0495629_0269778 3300046459 Bacteria 1169
295 Ga0495618_0000743 3300046514 Bacteria 22768
296 Ga0495640_0222739 3300046533 Bacteria 1189
297 Ga0495634_0324066 3300046642 Bacteria 927
298 Ga0495635_0007400 3300046663 Bacteria 7663
299 Ga0495646_0533195 3300046680 Bacteria 601
300 Ga0495604_0720276 3300047317 Bacteria 632
301 Ga0495684_0272473 3300047471 Bacteria 1224
302 Ga0496104_1006295 3300048907 Bacteria 737
303 Ga0496109_0037498 3300048912 Bacteria 4379
304 Ga0496109_0497132 3300048912 Bacteria 1151
305 Ga0501308_048981 3300049128 Bacteria 614
306 Ga0501308_049232 3300049128 Bacteria 613
307 Ga0501309_040146 3300049129 Bacteria 713
308 Ga0501309_048922 3300049129 Bacteria 661
309 Ga0501309_068200 3300049129 Bacteria 581
310 Ga0501309_094244 3300049129 Bacteria 513
311 Ga0501310_035599 3300049130 Bacteria 676
312 Ga0501310_047973 3300049130 Bacteria 611
313 Ga0501343_008242 3300049132 Bacteria 830
314 Ga0501345_02940 3300049134 Bacteria 720
315 Ga0501304_025086 3300049160 Bacteria 610
316 Ga0501305_022747 3300049161 Bacteria 934
317 Ga0501305_083825 3300049161 Bacteria 576
318 Ga0501307_032807 3300049162 Bacteria 727
319 Ga0501307_048865 3300049162 Bacteria 632
320 Ga0501342_02115 3300049163 Bacteria 662
321 Ga0501312_076171 3300049528 Bacteria 601
322 Ga0501314_028347 3300049530 Bacteria 613
323 Ga0501314_029033 3300049530 Bacteria 608
324 Ga0501315_036602 3300049531 Bacteria 728
325 Ga0501315_069356 3300049531 Bacteria 582
326 Ga0501316_054874 3300049532 Bacteria 580
327 Ga0501316_076469 3300049532 Bacteria 513
328 Ga0501317_010320 3300049533 Bacteria 1114
329 Ga0501317_023795 3300049533 Bacteria 848
330 Ga0501317_036090 3300049533 Bacteria 738
331 Ga0501317_038978 3300049533 Bacteria 719
332 Ga0501317_048128 3300049533 Bacteria 670
333 Ga0501318_018507 3300049534 Bacteria 861
334 Ga0501318_028731 3300049534 Bacteria 746
335 Ga0501318_033465 3300049534 Bacteria 709
336 Ga0501318_050319 3300049534 Bacteria 618
337 Ga0501318_070350 3300049534 Bacteria 552
338 Ga0501320_013857 3300049536 Bacteria 865
339 Ga0501321_024204 3300049537 Bacteria 775
340 Ga0501322_016962 3300049538 Bacteria 613
341 Ga0501323_021256 3300049539 Bacteria 857
342 Ga0501323_024763 3300049539 Bacteria 813
343 Ga0501324_027433 3300049540 Bacteria 608
344 Ga0501325_006113 3300049541 Bacteria 980
345 Ga0501325_012726 3300049541 Bacteria 796
346 Ga0501326_08305 3300049542 Bacteria 602
347 Ga0501328_04319 3300049544 Bacteria 687
348 Ga0501330_004985 3300049546 Bacteria 836
349 Ga0501331_04037 3300049547 Bacteria 809
350 Ga0501333_015730 3300049549 Bacteria 575
351 Ga0501335_014945 3300049551 Bacteria 788
352 Ga0501337_018718 3300049553 Bacteria 553
353 Ga0501340_003877 3300049556 Bacteria 924
354 Ga0501340_007715 3300049556 Bacteria 747
355 Ga0501038_1264083 3300049574 Bacteria 534
356 Ga0501041_0599225 3300049577 Bacteria 703
357 Ga0501068_0413838 3300049584 Bacteria 870
358 Ga0501073_0297912 3300049589 Bacteria 1113
359 Ga0501075_0984540 3300049591 Bacteria 641
360 Ga0501209_047935 3300049656 Bacteria 1156
361 Ga0501217_167285 3300049661 Bacteria 667
362 Ga0501233_064736 3300049668 Bacteria 915
363 nmdc:mga00v17_425883_c1 3300050491 Bacteria 862
364 nmdc:mga0yw44_524508_c1 3300050492 Bacteria 804
365 nmdc:mga05p37_122660_c1 3300050507 Bacteria 3192
366 nmdc:mga05p37_381417_c1 3300050507 Bacteria 1652
367 nmdc:mga05p37_834227_c1 3300050507 Bacteria 1003
368 nmdc:mga05p37_896621_c1 3300050507 Bacteria 957
369 nmdc:mga09592_28886_c1 3300050508 Bacteria 4611
370 nmdc:mga06r32_1480305_c1 3300050510 Bacteria 619
371 nmdc:mga06r32_1669913_c1 3300050510 Bacteria 574
372 nmdc:mga08y16_629245_c1 3300050511 Bacteria 1079
373 nmdc:mga08y16_72821_c1 3300050511 Bacteria 3580
374 nmdc:mga0n895_135242_c1 3300050512 Bacteria 2492
375 nmdc:mga0n895_535964_c1 3300050512 Bacteria 1177
376 nmdc:mga0rr50_718750_c1 3300050513 Bacteria 852
377 nmdc:mga0rr50_855306_c1 3300050513 Bacteria 776
378 nmdc:mga08x19_15486_c1 3300050514 Bacteria 4640
379 nmdc:mga0a205_189682_c1 3300050515 Bacteria 1587
380 nmdc:mga0a205_42329_c1 3300050515 Bacteria 4388
381 Ga0500568_0007885 3300053139 Bacteria 5186
382 Ga0501084_1108124 3300054114 Bacteria 665
383 Ga0590077_058558 3300059426 Bacteria 872
384 Ga0587066_070881 3300059490 Bacteria 734
385 Ga0587073_0157410 3300059492 Bacteria 648
386 Ga0587073_0176318 3300059492 Bacteria 624
387 Ga0587080_058013 3300059503 Bacteria 747
388 Ga0587083_0109909 3300059505 Bacteria 699
389 Ga0587086_019268 3300059507 Bacteria 917
390 Ga0587088_120993 3300059508 Bacteria 606
391 Ga0587089_039286 3300059509 Bacteria 727
392 Ga0587090_051992 3300059510 Bacteria 753
393 Ga0587108_021951 3300059653 Bacteria 612
394 Ga0587114_018230 3300059655 Bacteria 961
395 Ga0587111_0019403 3300060346 Bacteria 1289
396 Ga0501082_1232331 3300060353 Bacteria 654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046680 Ga0495646_0533195 Ga0495646_0533195_15_437 115
2 3300009098 Ga0105245_10288254 Ga0105245_102882543 121
3 3300028573 Ga0265334_10208181 Ga0265334_102081812 121
4 3300028654 Ga0265322_10135378 Ga0265322_101353781 121
5 3300049574 Ga0501038_1264083 Ga0501038_1264083_81_515 121
6 3300049589 Ga0501073_0297912 Ga0501073_0297912_344_778 121
7 3300059492 Ga0587073_0176318 Ga0587073_0176318_43_528 121
8 3300011119 Ga0105246_10087556 Ga0105246_100875562 122
9 3300014969 Ga0157376_10747660 Ga0157376_107476602 122
10 3300037068 Ga0373925_0353755 Ga0373925_0353755_651_1094 122
11 3300046459 Ga0495629_0269778 Ga0495629_0269778_225_668 122
12 3300046514 Ga0495618_0000743 Ga0495618_0000743_10161_10604 122
13 3300046533 Ga0495640_0222739 Ga0495640_0222739_383_826 122
14 3300046642 Ga0495634_0324066 Ga0495634_0324066_203_646 122
15 3300046663 Ga0495635_0007400 Ga0495635_0007400_7059_7502 122
16 3300047317 Ga0495604_0720276 Ga0495604_0720276_172_615 122
17 3300047471 Ga0495684_0272473 Ga0495684_0272473_748_1191 122
18 3300050491 nmdc:mga00v17_425883_c1 nmdc:mga00v17_425883_c1_40_468 122
19 3300050492 nmdc:mga0yw44_524508_c1 nmdc:mga0yw44_524508_c1_135_584 122
20 3300050511 nmdc:mga08y16_72821_c1 nmdc:mga08y16_72821_c1_2557_3006 122
21 3300020077 Ga0206351_10126038 Ga0206351_101260381 123
22 3300044712 Ga0453684_1382495 Ga0453684_1382495_137_562 123
23 3300059653 Ga0587108_021951 Ga0587108_021951_41_538 123
24 3300009098 Ga0105245_10873836 Ga0105245_108738361 130
25 3300048912 Ga0496109_0037498 Ga0496109_0037498_3447_3848 130
26 3300039438 Ga0436360_1159830 Ga0436360_1159830_191_607 133
27 3300005530 Ga0070679_100197058 Ga0070679_1001970583 135
28 3300026118 Ga0207675_100886749 Ga0207675_1008867491 135
29 3300032168 Ga0316593_10003678 Ga0316593_100036782 135
30 3300045051 Ga0451576_0000055 Ga0451576_0000055_241271_241678 135
31 3300005468 Ga0070707_100308766 Ga0070707_1003087663 136
32 3300005544 Ga0070686_100076592 Ga0070686_1000765924 136
33 3300025922 Ga0207646_10294258 Ga0207646_102942581 136
34 3300035112 Ga0373932_0284036 Ga0373932_0284036_105_521 136
35 3300042876 Ga0451577_0134017 Ga0451577_0134017_921_1337 136
36 3300044712 Ga0453684_0051716 Ga0453684_0051716_4646_5059 136
37 3300044712 Ga0453684_0115958 Ga0453684_0115958_2211_2627 136
38 3300045051 Ga0451576_0000202 Ga0451576_0000202_73197_73613 136
39 3300045051 Ga0451576_1390036 Ga0451576_1390036_80_490 136
40 3300050514 nmdc:mga08x19_15486_c1 nmdc:mga08x19_15486_c1_3989_4411 136
41 3300005614 Ga0068856_100003080 Ga0068856_10000308012 137
42 3300009147 Ga0114129_10528127 Ga0114129_105281272 137
43 3300013297 Ga0157378_11015360 Ga0157378_110153601 137
44 3300026078 Ga0207702_10197673 Ga0207702_101976732 137
45 3300028653 Ga0265323_10136118 Ga0265323_101361182 137
46 3300031727 Ga0316576_10214036 Ga0316576_102140362 137
47 3300031728 Ga0316578_10126485 Ga0316578_101264852 137
48 3300031728 Ga0316578_10166405 Ga0316578_101664052 137
49 3300031733 Ga0316577_10031162 Ga0316577_100311622 137
50 3300034816 Ga0373930_0167069 Ga0373930_0167069_125_541 137
51 3300035725 Ga0373947_1060449 Ga0373947_1060449_86_499 137
52 3300041456 Ga0451795_0786766 Ga0451795_0786766_761_1174 137
53 3300041494 Ga0451837_1734014 Ga0451837_1734014_93_506 137
54 3300041508 Ga0451852_08977 Ga0451852_08977_101_517 137
55 3300041508 Ga0451852_19387 Ga0451852_19387_218_631 137
56 3300041508 Ga0451852_22466 Ga0451852_22466_29_445 137
57 3300042876 Ga0451577_0000003 Ga0451577_0000003_531484_531906 137
58 3300042876 Ga0451577_0010367 Ga0451577_0010367_1764_2177 137
59 3300044712 Ga0453684_0000018 Ga0453684_0000018_408293_408715 137
60 3300044712 Ga0453684_0000777 Ga0453684_0000777_33106_33528 137
61 3300044712 Ga0453684_0043202 Ga0453684_0043202_2996_3415 137
62 3300044712 Ga0453684_0105596 Ga0453684_0105596_1598_2011 137
63 3300044712 Ga0453684_0638923 Ga0453684_0638923_10_432 137
64 3300044712 Ga0453684_0988734 Ga0453684_0988734_323_736 137
65 3300045051 Ga0451576_0024386 Ga0451576_0024386_4651_5073 137
66 3300045051 Ga0451576_0113020 Ga0451576_0113020_836_1252 137
67 3300045051 Ga0451576_0228583 Ga0451576_0228583_1291_1713 137
68 3300045051 Ga0451576_0286752 Ga0451576_0286752_78_491 137
69 3300049532 Ga0501316_076469 Ga0501316_076469_16_429 137
70 3300053139 Ga0500568_0007885 Ga0500568_0007885_1887_2303 137
71 3300059492 Ga0587073_0157410 Ga0587073_0157410_160_573 137
72 3300004799 Ga0058863_10089294 Ga0058863_100892942 138
73 3300004799 Ga0058863_11343003 Ga0058863_113430033 138
74 3300004800 Ga0058861_10010842 Ga0058861_100108422 138
75 3300005329 Ga0070683_100748084 Ga0070683_1007480842 138
76 3300005330 Ga0070690_100327006 Ga0070690_1003270062 138
77 3300005337 Ga0070682_100582992 Ga0070682_1005829921 138
78 3300005340 Ga0070689_100731501 Ga0070689_1007315012 138
79 3300005341 Ga0070691_10063694 Ga0070691_100636943 138
80 3300005343 Ga0070687_100325523 Ga0070687_1003255233 138
81 3300005343 Ga0070687_100536678 Ga0070687_1005366781 138
82 3300005345 Ga0070692_10026471 Ga0070692_100264711 138
83 3300005345 Ga0070692_10352404 Ga0070692_103524041 138
84 3300005345 Ga0070692_10416834 Ga0070692_104168342 138
85 3300005345 Ga0070692_10697529 Ga0070692_106975291 138
86 3300005345 Ga0070692_10954449 Ga0070692_109544491 138
87 3300005345 Ga0070692_10961923 Ga0070692_109619232 138
88 3300005356 Ga0070674_100188831 Ga0070674_1001888312 138
89 3300005364 Ga0070673_100542378 Ga0070673_1005423781 138
90 3300005365 Ga0070688_100192775 Ga0070688_1001927751 138
91 3300005367 Ga0070667_100930438 Ga0070667_1009304381 138
92 3300005438 Ga0070701_10166564 Ga0070701_101665643 138
93 3300005438 Ga0070701_10580794 Ga0070701_105807941 138
94 3300005441 Ga0070700_100808643 Ga0070700_1008086431 138
95 3300005445 Ga0070708_100284538 Ga0070708_1002845382 138
96 3300005445 Ga0070708_101184557 Ga0070708_1011845571 138
97 3300005458 Ga0070681_10034374 Ga0070681_100343742 138
98 3300005458 Ga0070681_10440471 Ga0070681_104404711 138
99 3300005458 Ga0070681_10693290 Ga0070681_106932902 138
100 3300005467 Ga0070706_100433955 Ga0070706_1004339551 138
101 3300005468 Ga0070707_100032771 Ga0070707_1000327716 138
102 3300005468 Ga0070707_100403239 Ga0070707_1004032393 138
103 3300005471 Ga0070698_100044978 Ga0070698_1000449782 138
104 3300005471 Ga0070698_100189887 Ga0070698_1001898873 138
105 3300005471 Ga0070698_100535018 Ga0070698_1005350181 138
106 3300005471 Ga0070698_101156962 Ga0070698_1011569621 138
107 3300005518 Ga0070699_100202634 Ga0070699_1002026343 138
108 3300005518 Ga0070699_100215701 Ga0070699_1002157012 138
109 3300005535 Ga0070684_102089000 Ga0070684_1020890001 138
110 3300005536 Ga0070697_100363009 Ga0070697_1003630092 138
111 3300005544 Ga0070686_100966179 Ga0070686_1009661791 138
112 3300005545 Ga0070695_100046885 Ga0070695_1000468853 138
113 3300005545 Ga0070695_101347685 Ga0070695_1013476851 138
114 3300005546 Ga0070696_101491520 Ga0070696_1014915201 138
115 3300005547 Ga0070693_100158461 Ga0070693_1001584612 138
116 3300005549 Ga0070704_100643428 Ga0070704_1006434281 138
117 3300005549 Ga0070704_101085434 Ga0070704_1010854342 138
118 3300005563 Ga0068855_101697720 Ga0068855_1016977201 138
119 3300005564 Ga0070664_100097239 Ga0070664_1000972392 138
120 3300005564 Ga0070664_101638004 Ga0070664_1016380042 138
121 3300005577 Ga0068857_100079419 Ga0068857_1000794191 138
122 3300005577 Ga0068857_100303574 Ga0068857_1003035741 138
123 3300005614 Ga0068856_101391990 Ga0068856_1013919901 138
124 3300005841 Ga0068863_102646140 Ga0068863_1026461401 138
125 3300006844 Ga0075428_100174817 Ga0075428_1001748173 138
126 3300006852 Ga0075433_10124141 Ga0075433_101241413 138
127 3300006871 Ga0075434_100169179 Ga0075434_1001691793 138
128 3300006871 Ga0075434_100409208 Ga0075434_1004092082 138
129 3300006871 Ga0075434_100478747 Ga0075434_1004787471 138
130 3300006880 Ga0075429_100012038 Ga0075429_1000120386 138
131 3300006914 Ga0075436_100530740 Ga0075436_1005307401 138
132 3300007076 Ga0075435_100061649 Ga0075435_1000616492 138
133 3300007265 Ga0099794_10051470 Ga0099794_100514701 138
134 3300009094 Ga0111539_10433107 Ga0111539_104331072 138
135 3300009098 Ga0105245_10808317 Ga0105245_108083172 138
136 3300009147 Ga0114129_10032319 Ga0114129_100323196 138
137 3300009147 Ga0114129_10250376 Ga0114129_102503763 138
138 3300009147 Ga0114129_10492862 Ga0114129_104928623 138
139 3300009148 Ga0105243_10137867 Ga0105243_101378672 138
140 3300009176 Ga0105242_10202811 Ga0105242_102028112 138
141 3300009176 Ga0105242_10509568 Ga0105242_105095682 138
142 3300009553 Ga0105249_10196775 Ga0105249_101967752 138
143 3300010375 Ga0105239_11706906 Ga0105239_117069061 138
144 3300011119 Ga0105246_10150180 Ga0105246_101501802 138
145 3300011119 Ga0105246_10321783 Ga0105246_103217831 138
146 3300013062 Ga0154010_173837 Ga0154010_1738371 138
147 3300013105 Ga0157369_10516145 Ga0157369_105161451 138
148 3300013297 Ga0157378_11171976 Ga0157378_111719761 138
149 3300013297 Ga0157378_11481632 Ga0157378_114816321 138
150 3300013306 Ga0163162_10962707 Ga0163162_109627072 138
151 3300013307 Ga0157372_11854899 Ga0157372_118548991 138
152 3300014326 Ga0157380_10238574 Ga0157380_102385743 138
153 3300014745 Ga0157377_10048672 Ga0157377_100486723 138
154 3300020069 Ga0197907_10269474 Ga0197907_102694741 138
155 3300020069 Ga0197907_10367232 Ga0197907_103672322 138
156 3300020069 Ga0197907_10971794 Ga0197907_109717942 138
157 3300020069 Ga0197907_11474923 Ga0197907_114749232 138
158 3300020070 Ga0206356_10204839 Ga0206356_102048391 138
159 3300020070 Ga0206356_11604834 Ga0206356_116048342 138
160 3300020070 Ga0206356_11715450 Ga0206356_117154502 138
161 3300020075 Ga0206349_1092110 Ga0206349_10921101 138
162 3300020075 Ga0206349_1438528 Ga0206349_14385282 138
163 3300020075 Ga0206349_1649908 Ga0206349_16499082 138
164 3300020076 Ga0206355_1195409 Ga0206355_11954091 138
165 3300020076 Ga0206355_1582374 Ga0206355_15823741 138
166 3300020076 Ga0206355_1698176 Ga0206355_16981762 138
167 3300020077 Ga0206351_11004892 Ga0206351_110048921 138
168 3300020078 Ga0206352_10124340 Ga0206352_101243401 138
169 3300020078 Ga0206352_10532168 Ga0206352_105321681 138
170 3300020078 Ga0206352_10998698 Ga0206352_109986981 138
171 3300020078 Ga0206352_11002200 Ga0206352_110022001 138
172 3300020080 Ga0206350_10051417 Ga0206350_100514172 138
173 3300020080 Ga0206350_10690478 Ga0206350_106904782 138
174 3300020080 Ga0206350_11405114 Ga0206350_114051141 138
175 3300020081 Ga0206354_10565914 Ga0206354_105659141 138
176 3300020081 Ga0206354_10905553 Ga0206354_109055533 138
177 3300020082 Ga0206353_10115998 Ga0206353_101159982 138
178 3300020082 Ga0206353_10470459 Ga0206353_104704591 138
179 3300020082 Ga0206353_11020322 Ga0206353_110203221 138
180 3300020610 Ga0154015_1143752 Ga0154015_11437521 138
181 3300020610 Ga0154015_1434376 Ga0154015_14343762 138
182 3300022467 Ga0224712_10161222 Ga0224712_101612221 138
183 3300022467 Ga0224712_10174542 Ga0224712_101745421 138
184 3300022467 Ga0224712_10293062 Ga0224712_102930621 138
185 3300022467 Ga0224712_10297974 Ga0224712_102979742 138
186 3300025885 Ga0207653_10002676 Ga0207653_100026764 138
187 3300025901 Ga0207688_10207817 Ga0207688_102078171 138
188 3300025910 Ga0207684_10008180 Ga0207684_100081804 138
189 3300025910 Ga0207684_10037204 Ga0207684_100372043 138
190 3300025912 Ga0207707_10195320 Ga0207707_101953203 138
191 3300025918 Ga0207662_10020862 Ga0207662_100208624 138
192 3300025918 Ga0207662_10058365 Ga0207662_100583653 138
193 3300025918 Ga0207662_10224582 Ga0207662_102245822 138
194 3300025922 Ga0207646_10002570 Ga0207646_1000257018 138
195 3300025922 Ga0207646_10168780 Ga0207646_101687802 138
196 3300025922 Ga0207646_10362100 Ga0207646_103621003 138
197 3300025926 Ga0207659_11172917 Ga0207659_111729171 138
198 3300025931 Ga0207644_10424459 Ga0207644_104244592 138
199 3300025934 Ga0207686_10125162 Ga0207686_101251622 138
200 3300025934 Ga0207686_10378568 Ga0207686_103785682 138
201 3300025942 Ga0207689_10593902 Ga0207689_105939022 138
202 3300025960 Ga0207651_10774051 Ga0207651_107740512 138
203 3300026075 Ga0207708_10088215 Ga0207708_100882153 138
204 3300026088 Ga0207641_10465396 Ga0207641_104653962 138
205 3300026089 Ga0207648_11161437 Ga0207648_111614371 138
206 3300026116 Ga0207674_10084528 Ga0207674_100845282 138
207 3300026118 Ga0207675_100058279 Ga0207675_1000582793 138
208 3300026118 Ga0207675_100343404 Ga0207675_1003434042 138
209 3300027462 Ga0210000_1011630 Ga0210000_10116302 138
210 3300028380 Ga0268265_10364405 Ga0268265_103644052 138
211 3300028653 Ga0265323_10047345 Ga0265323_100473452 138
212 3300032002 Ga0307416_103855675 Ga0307416_1038556751 138
213 3300032005 Ga0307411_10800089 Ga0307411_108000891 138
214 3300032126 Ga0307415_100295631 Ga0307415_1002956311 138
215 3300033524 Ga0316592_1043741 Ga0316592_10437411 138
216 3300033527 Ga0316586_1023770 Ga0316586_10237702 138
217 3300033541 Ga0316596_1140889 Ga0316596_11408891 138
218 3300035121 Ga0373960_0132976 Ga0373960_0132976_57_488 138
219 3300035398 Ga0316574_0048148 Ga0316574_0048148_1945_2376 138
220 3300036647 Ga0316582_0044586 Ga0316582_0044586_283_714 138
221 3300039453 Ga0436362_0073990 Ga0436362_0073990_377_799 138
222 3300041451 Ga0451791_0167706 Ga0451791_0167706_44_475 138
223 3300044658 Ga0466972_0009174 Ga0466972_0009174_1130_1564 138
224 3300044673 Ga0453683_0029221 Ga0453683_0029221_2036_2455 138
225 3300044673 Ga0453683_1047788 Ga0453683_1047788_66_503 138
226 3300044683 Ga0466965_0002895 Ga0466965_0002895_1121_1555 138
227 3300044712 Ga0453684_0383972 Ga0453684_0383972_632_1051 138
228 3300044735 Ga0466968_0045346 Ga0466968_0045346_1101_1535 138
229 3300044901 Ga0466960_0006893 Ga0466960_0006893_1136_1570 138
230 3300045051 Ga0451576_0097979 Ga0451576_0097979_457_876 138
231 3300048907 Ga0496104_1006295 Ga0496104_1006295_23_454 138
232 3300048912 Ga0496109_0497132 Ga0496109_0497132_366_797 138
233 3300050507 nmdc:mga05p37_122660_c1 nmdc:mga05p37_122660_c1_1643_2080 138
234 3300050507 nmdc:mga05p37_381417_c1 nmdc:mga05p37_381417_c1_380_817 138
235 3300050507 nmdc:mga05p37_834227_c1 nmdc:mga05p37_834227_c1_452_883 138
236 3300050507 nmdc:mga05p37_896621_c1 nmdc:mga05p37_896621_c1_451_885 138
237 3300050508 nmdc:mga09592_28886_c1 nmdc:mga09592_28886_c1_1392_1829 138
238 3300050511 nmdc:mga08y16_629245_c1 nmdc:mga08y16_629245_c1_579_1016 138
239 3300050512 nmdc:mga0n895_135242_c1 nmdc:mga0n895_135242_c1_1669_2103 138
240 3300050512 nmdc:mga0n895_535964_c1 nmdc:mga0n895_535964_c1_697_1131 138
241 3300050513 nmdc:mga0rr50_718750_c1 nmdc:mga0rr50_718750_c1_114_551 138
242 3300050513 nmdc:mga0rr50_855306_c1 nmdc:mga0rr50_855306_c1_266_700 138
243 3300050515 nmdc:mga0a205_189682_c1 nmdc:mga0a205_189682_c1_518_952 138
244 3300050515 nmdc:mga0a205_42329_c1 nmdc:mga0a205_42329_c1_1143_1580 138
245 3300059507 Ga0587086_019268 Ga0587086_019268_208_639 138
246 3300059655 Ga0587114_018230 Ga0587114_018230_43_477 138
247 3300060346 Ga0587111_0019403 Ga0587111_0019403_643_1062 138
248 3300005841 Ga0068863_100024921 Ga0068863_1000249216 139
249 3300026088 Ga0207641_10018124 Ga0207641_100181243 139
250 3300026095 Ga0207676_10489441 Ga0207676_104894412 139
251 3300028654 Ga0265322_10016276 Ga0265322_100162762 139
252 3300031235 Ga0265330_10000448 Ga0265330_100004482 139
253 3300031235 Ga0265330_10006140 Ga0265330_100061405 139
254 3300031235 Ga0265330_10081343 Ga0265330_100813432 139
255 3300031242 Ga0265329_10000002 Ga0265329_1000000251 139
256 3300031344 Ga0265316_10000017 Ga0265316_10000017117 139
257 3300031344 Ga0265316_10080842 Ga0265316_100808423 139
258 3300031344 Ga0265316_10898105 Ga0265316_108981051 139
259 3300031711 Ga0265314_10001844 Ga0265314_1000184414 139
260 3300031712 Ga0265342_10001365 Ga0265342_100013652 139
261 3300031712 Ga0265342_10198455 Ga0265342_101984551 139
262 3300032168 Ga0316593_10137620 Ga0316593_101376202 139
263 3300044712 Ga0453684_0275723 Ga0453684_0275723_433_852 139
264 3300044712 Ga0453684_0301163 Ga0453684_0301163_320_745 139
265 3300045051 Ga0451576_0000063 Ga0451576_0000063_258013_258435 139
266 3300045051 Ga0451576_0004064 Ga0451576_0004064_3794_4222 139
267 3300045051 Ga0451576_0040717 Ga0451576_0040717_4341_4769 139
268 3300045051 Ga0451576_0126649 Ga0451576_0126649_300_725 139
269 3300004801 Ga0058860_12229996 Ga0058860_122299961 140
270 3300029285 Ga0310981_1031241 Ga0310981_10312411 140
271 3300031731 Ga0307405_10975435 Ga0307405_109754351 140
272 3300031852 Ga0307410_10463384 Ga0307410_104633841 140
273 3300031901 Ga0307406_10438722 Ga0307406_104387222 140
274 3300031903 Ga0307407_10177973 Ga0307407_101779732 140
275 3300031911 Ga0307412_10329406 Ga0307412_103294062 140
276 3300031911 Ga0307412_10511072 Ga0307412_105110722 140
277 3300031995 Ga0307409_100659630 Ga0307409_1006596301 140
278 3300032002 Ga0307416_100016869 Ga0307416_1000168692 140
279 3300032002 Ga0307416_100149910 Ga0307416_1001499102 140
280 3300032126 Ga0307415_100164076 Ga0307415_1001640763 140
281 3300049128 Ga0501308_048981 Ga0501308_048981_111_533 140
282 3300049129 Ga0501309_048922 Ga0501309_048922_193_648 140
283 3300049129 Ga0501309_068200 Ga0501309_068200_74_529 140
284 3300049129 Ga0501309_094244 Ga0501309_094244_60_482 140
285 3300049130 Ga0501310_035599 Ga0501310_035599_142_597 140
286 3300049132 Ga0501343_008242 Ga0501343_008242_199_621 140
287 3300049134 Ga0501345_02940 Ga0501345_02940_96_518 140
288 3300049160 Ga0501304_025086 Ga0501304_025086_81_536 140
289 3300049161 Ga0501305_083825 Ga0501305_083825_107_529 140
290 3300049162 Ga0501307_032807 Ga0501307_032807_79_534 140
291 3300049163 Ga0501342_02115 Ga0501342_02115_77_499 140
292 3300049528 Ga0501312_076171 Ga0501312_076171_98_520 140
293 3300049530 Ga0501314_028347 Ga0501314_028347_109_531 140
294 3300049530 Ga0501314_029033 Ga0501314_029033_78_533 140
295 3300049531 Ga0501315_036602 Ga0501315_036602_109_531 140
296 3300049531 Ga0501315_069356 Ga0501315_069356_81_536 140
297 3300049532 Ga0501316_054874 Ga0501316_054874_107_529 140
298 3300049533 Ga0501317_010320 Ga0501317_010320_351_773 140
299 3300049533 Ga0501317_036090 Ga0501317_036090_14_436 140
300 3300049533 Ga0501317_038978 Ga0501317_038978_14_436 140
301 3300049533 Ga0501317_048128 Ga0501317_048128_136_591 140
302 3300049534 Ga0501318_018507 Ga0501318_018507_277_699 140
303 3300049534 Ga0501318_033465 Ga0501318_033465_56_511 140
304 3300049534 Ga0501318_070350 Ga0501318_070350_42_464 140
305 3300049536 Ga0501320_013857 Ga0501320_013857_271_693 140
306 3300049537 Ga0501321_024204 Ga0501321_024204_214_669 140
307 3300049538 Ga0501322_016962 Ga0501322_016962_111_533 140
308 3300049539 Ga0501323_021256 Ga0501323_021256_331_786 140
309 3300049540 Ga0501324_027433 Ga0501324_027433_108_530 140
310 3300049541 Ga0501325_006113 Ga0501325_006113_341_763 140
311 3300049542 Ga0501326_08305 Ga0501326_08305_108_530 140
312 3300049546 Ga0501330_004985 Ga0501330_004985_243_665 140
313 3300049547 Ga0501331_04037 Ga0501331_04037_143_598 140
314 3300049549 Ga0501333_015730 Ga0501333_015730_109_531 140
315 3300049551 Ga0501335_014945 Ga0501335_014945_219_674 140
316 3300049553 Ga0501337_018718 Ga0501337_018718_26_481 140
317 3300049556 Ga0501340_003877 Ga0501340_003877_236_691 140
318 3300049556 Ga0501340_007715 Ga0501340_007715_116_538 140
319 3300049656 Ga0501209_047935 Ga0501209_047935_567_1022 140
320 3300049661 Ga0501217_167285 Ga0501217_167285_49_504 140
321 3300049668 Ga0501233_064736 Ga0501233_064736_195_650 140
322 3300059426 Ga0590077_058558 Ga0590077_058558_181_603 140
323 3300003162 Ga0006778J45830_1055955 Ga0006778J45830_10559551 141
324 3300003735 Ga0006780_1027817 Ga0006780_10278171 141
325 3300004798 Ga0058859_11541496 Ga0058859_115414963 141
326 3300004799 Ga0058863_11685326 Ga0058863_116853261 141
327 3300004800 Ga0058861_11600259 Ga0058861_116002591 141
328 3300004800 Ga0058861_11910142 Ga0058861_119101421 141
329 3300004800 Ga0058861_12044408 Ga0058861_120444081 141
330 3300004801 Ga0058860_11515064 Ga0058860_115150641 141
331 3300004801 Ga0058860_11963796 Ga0058860_119637961 141
332 3300004803 Ga0058862_10016850 Ga0058862_100168502 141
333 3300004803 Ga0058862_12307542 Ga0058862_123075421 141
334 3300005329 Ga0070683_100763833 Ga0070683_1007638331 141
335 3300005336 Ga0070680_100056650 Ga0070680_1000566502 141
336 3300005458 Ga0070681_10053425 Ga0070681_100534254 141
337 3300005535 Ga0070684_100643153 Ga0070684_1006431531 141
338 3300009147 Ga0114129_11450141 Ga0114129_114501411 141
339 3300020069 Ga0197907_10093496 Ga0197907_100934961 141
340 3300020069 Ga0197907_10154325 Ga0197907_101543251 141
341 3300020069 Ga0197907_10252772 Ga0197907_102527721 141
342 3300020069 Ga0197907_10538618 Ga0197907_105386181 141
343 3300020070 Ga0206356_10069329 Ga0206356_100693291 141
344 3300020070 Ga0206356_10974274 Ga0206356_109742742 141
345 3300020075 Ga0206349_1264343 Ga0206349_12643431 141
346 3300020076 Ga0206355_1094291 Ga0206355_10942912 141
347 3300020076 Ga0206355_1276443 Ga0206355_12764431 141
348 3300020077 Ga0206351_10177577 Ga0206351_101775771 141
349 3300020077 Ga0206351_10623440 Ga0206351_106234401 141
350 3300020077 Ga0206351_10766954 Ga0206351_107669542 141
351 3300020078 Ga0206352_10416611 Ga0206352_104166112 141
352 3300020078 Ga0206352_11256098 Ga0206352_112560981 141
353 3300020080 Ga0206350_10006052 Ga0206350_100060522 141
354 3300020080 Ga0206350_10192683 Ga0206350_101926832 141
355 3300020081 Ga0206354_10808528 Ga0206354_108085283 141
356 3300020081 Ga0206354_11118243 Ga0206354_111182431 141
357 3300020082 Ga0206353_10315189 Ga0206353_103151891 141
358 3300020082 Ga0206353_10999105 Ga0206353_109991052 141
359 3300020082 Ga0206353_11017824 Ga0206353_110178241 141
360 3300020082 Ga0206353_11697222 Ga0206353_116972222 141
361 3300020610 Ga0154015_1162876 Ga0154015_11628761 141
362 3300020610 Ga0154015_1183546 Ga0154015_11835462 141
363 3300020610 Ga0154015_1593158 Ga0154015_15931581 141
364 3300020610 Ga0154015_1600242 Ga0154015_16002421 141
365 3300022467 Ga0224712_10024695 Ga0224712_100246953 141
366 3300022467 Ga0224712_10197197 Ga0224712_101971971 141
367 3300022467 Ga0224712_10349022 Ga0224712_103490221 141
368 3300025912 Ga0207707_10035774 Ga0207707_100357744 141
369 3300025917 Ga0207660_10041632 Ga0207660_100416322 141
370 3300025921 Ga0207652_10011932 Ga0207652_100119324 141
371 3300025944 Ga0207661_10675741 Ga0207661_106757411 141
372 3300032005 Ga0307411_10591022 Ga0307411_105910222 141
373 3300049128 Ga0501308_049232 Ga0501308_049232_76_540 141
374 3300049129 Ga0501309_040146 Ga0501309_040146_232_696 141
375 3300049130 Ga0501310_047973 Ga0501310_047973_74_538 141
376 3300049161 Ga0501305_022747 Ga0501305_022747_428_859 141
377 3300049162 Ga0501307_048865 Ga0501307_048865_12_476 141
378 3300049533 Ga0501317_023795 Ga0501317_023795_76_540 141
379 3300049534 Ga0501318_028731 Ga0501318_028731_214_639 141
380 3300049534 Ga0501318_050319 Ga0501318_050319_55_480 141
381 3300049539 Ga0501323_024763 Ga0501323_024763_276_740 141
382 3300049541 Ga0501325_012726 Ga0501325_012726_114_545 141
383 3300049544 Ga0501328_04319 Ga0501328_04319_57_488 141
384 3300049577 Ga0501041_0599225 Ga0501041_0599225_122_553 141
385 3300049584 Ga0501068_0413838 Ga0501068_0413838_263_694 141
386 3300049591 Ga0501075_0984540 Ga0501075_0984540_194_625 141
387 3300050510 nmdc:mga06r32_1480305_c1 nmdc:mga06r32_1480305_c1_161_592 141
388 3300050510 nmdc:mga06r32_1669913_c1 nmdc:mga06r32_1669913_c1_62_490 141
389 3300054114 Ga0501084_1108124 Ga0501084_1108124_107_538 141
390 3300059490 Ga0587066_070881 Ga0587066_070881_75_500 141
391 3300059503 Ga0587080_058013 Ga0587080_058013_65_490 141
392 3300059505 Ga0587083_0109909 Ga0587083_0109909_93_518 141
393 3300059508 Ga0587088_120993 Ga0587088_120993_39_464 141
394 3300059509 Ga0587089_039286 Ga0587089_039286_213_638 141
395 3300059510 Ga0587090_051992 Ga0587090_051992_227_652 141
396 3300060353 Ga0501082_1232331 Ga0501082_1232331_89_520 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00164

Ribosom_S12_S23

Ribosomal protein S12/S23

54

165

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t2a-assembly1.cif.gz_AS cryoem structure of the leishmania donovani 80s ribosome at 2.9 angstrom resolution 0.8774 44 117
8bsi-assembly1.cif.gz_SO giardia ribosome chimeric hybrid-like gdp+pi bound state (b1) 0.8751 44 117
6th6-assembly1.cif.gz_Ao cryo-em structure of t. kodakarensis 70s ribosome 0.8661 44 117
7r81-assembly1.cif.gz_Y2 structure of the translating neurospora crassa ribosome arrested by cycloheximide 0.8661 44 117
7oyb-assembly1.cif.gz_X2 cryo-em structure of the 6 hpf zebrafish embryo 80s ribosome 0.8648 44 116
ID Description Score Start End Superfamily
af_A0A0P0XT53_109_185_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8331 44 98 2.40.50.140
2rcnA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8043 44 119 2.40.50.140
2rcnA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7677 44 119 2.40.50.140
2eifA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7636 44 118 2.40.50.140
af_Q20447_594_687_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.7582 47 77 2.40.30.10
ID Description Score Start End GO Terms
AF-Q841U0-F1-model_v4 30S ribosomal protein S12 0.9315 43 116 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A399SKY8-F1-model_v4 30S ribosomal protein S12 0.9089 17 120 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A399SKY8-F1-model_v4 30S ribosomal protein S12 0.8991 17 120 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-C1BMQ0-F1-model_v4 Small ribosomal subunit protein uS12m 0.8988 41 116 GO:0003735
GO:0006412
GO:0015935
AF-A0A7J6RNF1-F1-model_v4 37S ribosomal protein S12, mitochondrial 0.8961 43 120 GO:0003735
GO:0006412
GO:0015935

Feature Viewer

pLDDT pTM Quality
79.08 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map