F433644

General Info

Members Datasets Scaffolds Average Seq Length
396 358 792 567

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306086|2551690218
Length 656
Sequence ALATDYDGTLADYGAVRPETLETLKRLKESGRKLLLVTGRELPDLKSVFPEIDVFDKVVVENGALLYTPETGEERLLAPSPPEAFIERLKEKGVDRMSVGRSIVATWEPFQTAALEAINELGLELEIIFNKGAVMVLPTGVNKATGLKAALKEMGLSFLNVVGVGDAENDHALLRMCGCGAAVANALPALKDTADVVLEGVRGAGVEQLMNRIMESDYALCASARHQVPIGEDDEGQVEIGPQDVLLIAGSSGIGKSRLATALAERLRERHFQLCIFDPEGDYEGLEGAVTVGNGSVAPTGREVLELLANPDDNVVVSATGVEPNERPEFFANLMPDLSALRARTGRPHWLIIDEAHHLMPAARDSASLALSDDRSGMIMITVHPDSVSPDALKEITAVAALGPKARDVIATICSVFDEALPAGLDASFGEDEVLFWRRTPPTPVRRIKAEQPREARKRHTRKYAEGRLGEEASFYFRGPKNEMNLRAHNLTMFLQIAEGIDDRTWEHHLRRGDYSKWFEERIGDEELAGEAAGIEEDRSLSPAESRQRLXPAAGVERTTSLLFRLLLRGGAAAVGAFRTFVEPLGAFPKVGPLLCFCLFLFLGGAFAQAGGGLLALCRRGLFDTHGSHSSLSETQIERAQIFLCSSADEGSCGLP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
60 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
61 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
91 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
92 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
93 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
94 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
95 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
111 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
136 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
137 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
138 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
139 2509276019 Ensifer aridi TW10 Isolate Nodule
140 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
141 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
142 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
143 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
144 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
145 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
146 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
147 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
148 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
149 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
150 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
151 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
152 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
153 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
154 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
155 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
156 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
157 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
158 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
159 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
160 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
161 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
162 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
163 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
164 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
165 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
166 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
167 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
168 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
169 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
170 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
171 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
172 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
173 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
174 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
175 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
176 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
177 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
178 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
179 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
180 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
181 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
182 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
183 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
184 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
185 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
186 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
187 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
188 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
189 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
190 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
191 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
192 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
193 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
194 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
195 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
196 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
197 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
198 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
199 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
200 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
201 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
202 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
203 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
204 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
205 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
206 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
207 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
208 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
209 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
210 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
211 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
212 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
213 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
214 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
215 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
216 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
217 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
218 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
219 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
220 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
221 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
222 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
223 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
224 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
225 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
226 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
227 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
228 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
229 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
230 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
231 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
232 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
233 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
234 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
235 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
236 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
237 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
238 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
239 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
240 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
241 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
242 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
243 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
244 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
245 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
246 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
247 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
248 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
249 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
250 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
251 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
252 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
253 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
254 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
255 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
256 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
257 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
258 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
259 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
260 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
261 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
262 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
263 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
264 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
265 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
266 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
267 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
268 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
269 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
270 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
271 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
272 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
273 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
274 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
275 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
276 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
277 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
278 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
279 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
280 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
281 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
282 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
283 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
284 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
285 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
286 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
287 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
288 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
289 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
290 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
291 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
292 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
293 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
294 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
295 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
296 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
297 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
298 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
299 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
300 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
301 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
302 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
303 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
304 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
305 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
306 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
307 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
308 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
309 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
310 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
311 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
312 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
313 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
314 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
315 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
316 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
317 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
318 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
319 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
320 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
321 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
322 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
323 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
324 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
325 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
326 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
327 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
328 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
329 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
330 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
331 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
332 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
333 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
334 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
335 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
336 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
337 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
338 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
339 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
340 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
341 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
342 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
343 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
344 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
345 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
346 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
347 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
348 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
349 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
350 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
351 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
352 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
353 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
354 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
355 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
356 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
357 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
358 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.43
Metatranscriptomes 0.25
Isolates 56.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 51.52
Rhizoplane 1.01
Rhizosphere 38.89
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_581576 2162886007 Bacteria 7298
2 JGI25406J46586_10001045 3300003203 Bacteria 12953
3 JGI25406J46586_10004550 3300003203 Bacteria 6455
4 JGI25404J52841_10000071 3300003659 Bacteria 9078
5 Ga0058859_11744552 3300004798 Bacteria 3801
6 Ga0065704_10000460 3300005289 Bacteria 24815
7 Ga0065712_10081384 3300005290 Bacteria 2984
8 Ga0070676_10024920 3300005328 Bacteria 3375
9 Ga0070670_100000658 3300005331 Bacteria 26869
10 Ga0070677_10023824 3300005333 Bacteria 2270
11 Ga0068869_100016719 3300005334 Bacteria 4951
12 Ga0068868_100000429 3300005338 Bacteria 28175
13 Ga0068868_100021719 3300005338 Bacteria 4836
14 Ga0070661_100000062 3300005344 Bacteria 85485
15 Ga0070661_100000887 3300005344 Bacteria 21498
16 Ga0070675_100000530 3300005354 Bacteria 26046
17 Ga0070675_100045163 3300005354 Bacteria 3605
18 Ga0070671_100000974 3300005355 Bacteria 20979
19 Ga0070671_100025627 3300005355 Bacteria 4840
20 Ga0070673_100011889 3300005364 Bacteria 5960
21 Ga0070700_100047722 3300005441 Bacteria 2651
22 Ga0068867_100007334 3300005459 Bacteria 7804
23 Ga0070672_100000444 3300005543 Bacteria 24200
24 Ga0070672_100028072 3300005543 Bacteria 4205
25 Ga0070665_100113984 3300005548 Bacteria 2706
26 Ga0070664_100000035 3300005564 Bacteria 81750
27 Ga0070664_100000551 3300005564 Bacteria 28654
28 Ga0068857_100066716 3300005577 Bacteria 3203
29 Ga0068852_100000789 3300005616 Bacteria 20824
30 Ga0068859_100016014 3300005617 Bacteria 7535
31 Ga0068864_100010574 3300005618 Bacteria 7631
32 Ga0068866_10027060 3300005718 Bacteria 2715
33 Ga0068861_100004009 3300005719 Bacteria 9862
34 Ga0068851_10019724 3300005834 Bacteria 3259
35 Ga0068860_100013487 3300005843 Bacteria 8015
36 Ga0068862_100076225 3300005844 Bacteria 2902
37 Ga0068862_100078142 3300005844 Bacteria 2867
38 Ga0081455_10000039 3300005937 Bacteria 135506
39 Ga0081455_10015764 3300005937 Bacteria 7321
40 Ga0081455_10020309 3300005937 Bacteria 6261
41 Ga0081538_10027194 3300005981 Bacteria 3974
42 Ga0081540_1002766 3300005983 Bacteria 14234
43 Ga0081540_1003841 3300005983 Bacteria 11746
44 Ga0081540_1007998 3300005983 Bacteria 7444
45 Ga0081539_10000006 3300005985 Bacteria 534555
46 Ga0081539_10001054 3300005985 Bacteria 50478
47 Ga0081539_10010706 3300005985 Bacteria 7394
48 Ga0075366_10007096 3300006195 Bacteria 6169
49 Ga0097621_100000779 3300006237 Bacteria 22344
50 Ga0068871_100001096 3300006358 Bacteria 18190
51 Ga0075430_100014151 3300006846 Bacteria 6801
52 Ga0068865_100001993 3300006881 Bacteria 12057
53 Ga0097620_100016014 3300006931 Bacteria 7535
54 Ga0079104_1002834 3300006946 Bacteria 8719
55 Ga0105244_10000616 3300009036 Bacteria 31571
56 Ga0111539_10093687 3300009094 Bacteria 3528
57 Ga0105245_10041267 3300009098 Bacteria 4113
58 Ga0114129_10120699 3300009147 Bacteria 3609
59 Ga0105243_10017753 3300009148 Bacteria 5383
60 Ga0105237_10000042 3300009545 Bacteria 181280
61 Ga0105246_10047948 3300011119 Bacteria 2919
62 Ga0157373_10009869 3300013100 Bacteria 7035
63 Ga0157369_10000251 3300013105 Bacteria 73814
64 Ga0157374_10002042 3300013296 Bacteria 16963
65 Ga0157378_10002224 3300013297 Bacteria 17210
66 Ga0157378_10015856 3300013297 Bacteria 6599
67 Ga0163162_10022581 3300013306 Bacteria 6203
68 Ga0163162_10034202 3300013306 Bacteria 5056
69 Ga0157375_10001457 3300013308 Bacteria 20349
70 Ga0157375_10027315 3300013308 Bacteria 5334
71 Ga0157375_10051064 3300013308 Bacteria 4059
72 Ga0157375_10137518 3300013308 Bacteria 2568
73 Ga0157380_10016418 3300014326 Bacteria 5461
74 Ga0157377_10047434 3300014745 Bacteria 2407
75 Ga0157379_10035971 3300014968 Bacteria 4416
76 Ga0182006_1000730 3300015261 Bacteria 22661
77 Ga0163161_10049956 3300017792 Bacteria 3024
78 Ga0214544_1000169 3300021320 Bacteria 101212
79 Ga0214542_1000131 3300021321 Bacteria 107074
80 Ga0214543_1000028 3300021327 Bacteria 214029
81 Ga0214543_1002177 3300021327 Bacteria 38571
82 Ga0213876_10005556 3300021384 Bacteria 6918
83 Ga0207655_1000070 3300025728 Bacteria 239196
84 Ga0207671_10000847 3300025914 Bacteria 38847
85 Ga0207649_10000010 3300025920 Bacteria 284354
86 Ga0207649_10016632 3300025920 Bacteria 4153
87 Ga0207650_10000744 3300025925 Bacteria 25123
88 Ga0207650_10091514 3300025925 Bacteria 2325
89 Ga0207659_10001754 3300025926 Bacteria 12835
90 Ga0207644_10000981 3300025931 Bacteria 18213
91 Ga0207644_10034563 3300025931 Bacteria 3538
92 Ga0207686_10008553 3300025934 Bacteria 5530
93 Ga0207704_10035374 3300025938 Bacteria 2861
94 Ga0207691_10000535 3300025940 Bacteria 37955
95 Ga0207691_10141298 3300025940 Bacteria 2122
96 Ga0207689_10010359 3300025942 Bacteria 8032
97 Ga0207661_10020045 3300025944 Bacteria 4994
98 Ga0207679_10000022 3300025945 Bacteria 219036
99 Ga0207679_10003256 3300025945 Bacteria 10031
100 Ga0207651_10076474 3300025960 Bacteria 2393
101 Ga0207708_10142658 3300026075 Bacteria 1880
102 Ga0207648_10001572 3300026089 Bacteria 25025
103 Ga0207648_10004099 3300026089 Bacteria 15087
104 Ga0207674_10106593 3300026116 Bacteria 2780
105 Ga0207698_10000710 3300026142 Bacteria 19262
106 Ga0209281_1000426 3300027111 Bacteria 62651
107 Ga0268265_10007276 3300028380 Bacteria 7480
108 Ga0268265_10122114 3300028380 Bacteria 2148
109 Ga0265334_10023255 3300028573 Unclassified 2521
110 Ga0307410_10099530 3300031852 Bacteria 2081
111 Ga0307412_10003028 3300031911 Bacteria 9305
112 Ga0307409_100102320 3300031995 Bacteria 2380
113 Ga0307411_10006185 3300032005 Bacteria 5961
114 Ga0395900_0028577 3300037418 Bacteria 5714
115 Ga0436364_0134120 3300037853 Bacteria 7669
116 Ga0436364_0890864 3300037853 Bacteria 67172
117 Ga0436364_1025004 3300037853 Bacteria 2700
118 Ga0436365_1218614 3300039437 Bacteria 23452
119 Ga0436365_1289272 3300039437 Bacteria 4443
120 Ga0439436_0014167 3300041404 Bacteria 2409
121 Ga0439438_001045 3300041405 Bacteria 12327
122 Ga0439466_0007217 3300041411 Bacteria 4205
123 Ga0439452_000124 3300042010 Bacteria 59201
124 Ga0439460_0000074 3300042461 Bacteria 15152
125 Ga0495627_000009 3300046453 Bacteria 463964
126 Ga0495627_000014 3300046453 Bacteria 326114
127 Ga0495590_0000898 3300046457 Bacteria 13323
128 Ga0495638_0000088 3300046460 Bacteria 152517
129 Ga0495583_0001020 3300046506 Bacteria 31872
130 Ga0495631_0000457 3300046518 Bacteria 27703
131 Ga0495632_0013972 3300046519 Bacteria 4559
132 Ga0495632_0015842 3300046519 Bacteria 4211
133 Ga0495643_0011715 3300046522 Bacteria 5324
134 Ga0495644_0000005 3300046523 Bacteria 135313
135 Ga0495654_0000270 3300046530 Bacteria 47176
136 Ga0495609_0000079 3300046538 Bacteria 118997
137 Ga0495611_0000953 3300046648 Bacteria 15482
138 Ga0495661_0000284 3300046665 Bacteria 57616
139 Ga0495671_0003763 3300046692 Bacteria 9217
140 Ga0495671_0015300 3300046692 Bacteria 4114
141 Ga0495649_0000060 3300046694 Bacteria 97624
142 Ga0495672_0000687 3300047320 Bacteria 37704
143 Ga0495672_0001666 3300047320 Bacteria 21550
144 Ga0495672_0004513 3300047320 Bacteria 11363
145 Ga0495683_0043418 3300047323 Bacteria 2263
146 Ga0495673_0009387 3300047469 Bacteria 5415
147 Ga0496109_0070836 3300048912 Bacteria 3200
148 Ga0496110_0006320 3300048913 Bacteria 9358
149 Ga0496110_0028350 3300048913 Bacteria 4808
150 Ga0496111_0018582 3300048914 Bacteria 4817
151 Ga0496124_0000276 3300048927 Bacteria 98406
152 Ga0496125_0000410 3300048928 Bacteria 80395
153 Ga0496126_0000692 3300048929 Bacteria 61735
154 Ga0495678_002466 3300049459 Bacteria 12505
155 Ga0501042_0016694 3300049578 Bacteria 5046
156 Ga0501046_0044093 3300049580 Bacteria 3548
157 Ga0501048_0052564 3300049582 Bacteria 2900
158 Ga0501074_0029054 3300049590 Bacteria 4005
159 Ga0501075_0105575 3300049591 Bacteria 2141
160 Ga0501076_0135272 3300049592 Bacteria 2001
161 Ga0501222_000145 3300049662 Bacteria 14849
162 Ga0501080_0015188 3300049742 Bacteria 7096
163 nmdc:mga03683_14516_c1 3300050489 Bacteria 2916
164 nmdc:mga05p37_40914_c1 3300050507 Bacteria 5691
165 nmdc:mga05p37_75144_c1 3300050507 Bacteria 4160
166 nmdc:mga09592_9074_c1 3300050508 Bacteria 8085
167 nmdc:mga0qj67_67692_c1 3300050509 Bacteria 2845
168 nmdc:mga06r32_107379_c1 3300050510 Bacteria 2743
169 nmdc:mga08y16_220343_c1 3300050511 Unclassified 1964
170 nmdc:mga08y16_66557_c1 3300050511 Bacteria 3760
171 Ga0500573_0000823 3300053140 Bacteria 13982
172 Ga0500616_0030701 3300053153 Bacteria 2949
173 Ga0530510_0007166 3300061734 Bacteria 7760
174 2551690218 2551306086 Bacteria 6843938
175 2509110933 2508501122 Bacteria 6292184
176 2509117286 2508501123 Bacteria 6283661
177 2509376325 2509276019 Bacteria 6802256
178 2509398349 2509276022 Bacteria 6200534
179 2510304337 2510065057 Bacteria 6649661
180 2511502108 2511231052 Bacteria 6974333
181 2512533482 2512047086 Bacteria 6850303
182 2513582498 2513237086 Bacteria 7265287
183 2513618059 2513237091 Bacteria 6900273
184 2513885444 2513237140 Bacteria 7076289
185 2513903220 2513237143 Bacteria 6664116
186 2515608887 2515154107 Bacteria 6795637
187 2516893486 2516653046 Bacteria 6989037
188 2524448683 2524023207 Bacteria 6813453
189 2551680092 2551306084 Bacteria 8942552
190 2551684435 2551306085 Bacteria 7347181
191 2551704300 2551306087 Bacteria 7351905
192 2551713936 2551306089 Bacteria 7162724
193 2551722624 2551306090 Bacteria 7953713
194 2551725851 2551306091 Bacteria 7086830
195 2551738716 2551306092 Bacteria 6992595
196 2551741460 2551306093 Bacteria 7064773
197 2558867850 2558860100 Bacteria 8458965
198 2621299683 2619619299 Bacteria 6649820
199 2644088800 2643221614 Bacteria 4260023
200 2644284289 2643221650 Bacteria 7029547
201 2644345569 2643221661 Bacteria 4267604
202 2644365573 2643221666 Bacteria 4265935
203 2657681381 2657244999 Bacteria 5946535
204 2692315681 2690316117 Bacteria 6800650
205 2738669683 2738541265 Bacteria 6594665
206 2738748076 2738541282 Bacteria 6593925
207 2738857118 2738541303 Bacteria 6591772
208 2753460348 2751185821 Bacteria 6189929
209 2792580637 2791355082 Bacteria 5973319
210 2792620318 2791355091 Bacteria 6135441
211 2792626265 2791355092 Bacteria 6248105
212 2792639208 2791355094 Bacteria 7011481
213 2804752576 2802429268 Bacteria 6094027
214 2808958572 2808606382 Bacteria 6841132
215 2817491035 2816332298 Bacteria 6852809
216 2825651524 2825651385 Bacteria 6715909
217 2847419259 2847417321 Bacteria 6913799
218 2848994286 2848992105 Bacteria 6810864
219 2850081291 2850079185 Bacteria 6848280
220 2855826209 2855825444 Bacteria 6785811
221 2855841554 2855839649 Bacteria 7135830
222 2855875943 2855872281 Bacteria 6964271
223 2856326245 2856320880 Bacteria 7263508
224 2858801662 2858800743 Bacteria 6603254
225 2869284132 2869278585 Bacteria 7077053
226 2874144756 2874139085 Bacteria 7021506
227 2878743874 2878738818 Bacteria 7136951
228 2888342176 2888337043 Bacteria 6629336
229 2896385844 2896384573 Bacteria 7700774
230 2913039831 2913036834 Bacteria 6704877
231 2913299507 2913295892 Bacteria 6333755
232 2915987410 2915986958 Bacteria 6739310
233 2915997780 2915993759 Bacteria 7016183
234 2916002652 2916000859 Bacteria 6865702
235 2916007880 2916007675 Bacteria 6898660
236 2916020156 2916014648 Bacteria 6946486
237 2916027859 2916021584 Bacteria 6854472
238 2916029169 2916028427 Bacteria 6748433
239 2916039498 2916035215 Bacteria 6755766
240 2916043775 2916041962 Bacteria 6820487
241 2916052428 2916048683 Bacteria 6543552
242 2916058859 2916055098 Bacteria 6758838
243 2916075246 2916068649 Bacteria 6943657
244 2916080524 2916076590 Bacteria 6596108
245 2920761777 2920760137 Bacteria 7427611
246 2921205636 2921201388 Bacteria 6926299
247 2921210823 2921208531 Bacteria 6745326
248 2921240861 2921237296 Bacteria 6876710
249 2921244789 2921244191 Bacteria 6568419
250 2921260569 2921257292 Bacteria 6808382
251 2921267690 2921263974 Bacteria 6864552
252 2921287902 2921282425 Bacteria 6826397
253 2921289509 2921289301 Bacteria 7316391
254 2921301479 2921296804 Bacteria 7176999
255 2924148669 2924144063 Bacteria 6883928
256 2924151388 2924150972 Bacteria 7169444
257 2924162050 2924158325 Bacteria 7188855
258 2924166053 2924165586 Bacteria 7260590
259 2924176154 2924172951 Bacteria 6749356
260 2924180110 2924179722 Bacteria 6843264
261 2924190698 2924186466 Bacteria 6876637
262 2924199714 2924193448 Bacteria 6955718
263 2924203581 2924200457 Bacteria 6757188
264 2924212730 2924207177 Bacteria 6917007
265 2924219624 2924214083 Bacteria 7080103
266 2924223744 2924221636 Bacteria 7113495
267 2924232192 2924228884 Bacteria 6633132
268 2924721092 2924718760 Bacteria 6331356
269 2924781791 2924776078 Bacteria 7492003
270 2937000273 2936996657 Bacteria 6298727
271 2937008374 2937002841 Bacteria 6934057
272 2937014744 2937009748 Bacteria 6746052
273 2937018611 2937016420 Bacteria 6782579
274 2937027059 2937023124 Bacteria 6815156
275 2937046187 2937042894 Bacteria 6741576
276 2937051330 2937049772 Bacteria 6757901
277 2937062456 2937056579 Bacteria 7107896
278 2937069164 2937063883 Bacteria 7199456
279 2937075085 2937071275 Bacteria 6984483
280 2937093846 2937091812 Bacteria 6979387
281 2937100281 2937098957 Bacteria 7249374
282 2937110663 2937106411 Bacteria 6947143
283 2937117048 2937113482 Bacteria 6505872
284 2937124619 2937119839 Bacteria 6597547
285 2937127698 2937126314 Bacteria 6771275
286 2937884881 2937877337 Bacteria 7246526
287 2937978153 2937972304 Bacteria 7532020
288 2957382720 2957382221 Bacteria 6737050
289 2957392989 2957388812 Bacteria 6778072
290 2957398903 2957395598 Bacteria 6822399
291 2957408124 2957402308 Bacteria 6741770
292 2957410823 2957408893 Bacteria 6558585
293 2957421850 2957415311 Bacteria 6991633
294 2957425636 2957422303 Bacteria 7172205
295 2957436347 2957430029 Bacteria 7022557
296 2957450112 2957443900 Bacteria 6869977
297 2957456104 2957450854 Bacteria 6765715
298 2957460840 2957457609 Bacteria 6967680
299 2957468698 2957464669 Bacteria 6568877
300 2957475672 2957471148 Bacteria 6797643
301 2957481547 2957478035 Bacteria 6756658
302 2957487608 2957484790 Bacteria 6703082
303 2957492354 2957491536 Bacteria 6695180
304 2957502363 2957498199 Bacteria 7126688
305 2957507383 2957505466 Bacteria 7253085
306 2958040521 2958034702 Bacteria 6989922
307 2958055369 2958041894 Bacteria 13082850
308 2958068330 2958064165 Bacteria 7158582
309 2958092190 2958084443 Bacteria 7312792
310 2958096843 2958092219 Bacteria 6861151
311 2958148049 2958144490 Bacteria 6677056
312 2960590174 2960584000 Bacteria 6864594
313 2960602548 2960597568 Bacteria 6550735
314 2960609122 2960603979 Bacteria 6898737
315 2960616243 2960610863 Bacteria 6691244
316 2960623220 2960617483 Bacteria 6727748
317 2960627919 2960624210 Bacteria 6875384
318 2960640831 2960637947 Bacteria 7296468
319 2960650180 2960645483 Bacteria 7211087
320 2960653195 2960652885 Bacteria 7083688
321 2960661451 2960660292 Bacteria 7041660
322 2960670037 2960667422 Bacteria 6763020
323 2960678878 2960674078 Bacteria 6609048
324 2960690562 2960687367 Bacteria 6535474
325 2964609957 2964607997 Bacteria 7101408
326 2964615704 2964615318 Bacteria 6809089
327 2964626411 2964621998 Bacteria 6834995
328 2964633955 2964628898 Bacteria 7083044
329 2964638478 2964636051 Bacteria 7091832
330 2964648017 2964643177 Bacteria 6820887
331 2964653378 2964649959 Bacteria 6675118
332 2964662709 2964656573 Bacteria 7100150
333 2964667546 2964663802 Bacteria 7019362
334 2964676471 2964670856 Bacteria 6851364
335 2964684527 2964678106 Bacteria 6792020
336 2964689442 2964685014 Bacteria 6839111
337 2964697106 2964691889 Bacteria 6802758
338 2964703689 2964698721 Bacteria 6765331
339 2964711979 2964705432 Bacteria 7114648
340 2964718998 2964712639 Bacteria 6695970
341 2964720610 2964719344 Bacteria 7286602
342 2967669835 2967664464 Bacteria 6948836
343 2967674335 2967671571 Bacteria 7021409
344 2967679846 2967678726 Bacteria 7264382
345 2967696433 2967693043 Bacteria 6804451
346 2967703801 2967699805 Bacteria 6854538
347 2967709116 2967706974 Bacteria 7186053
348 2967719656 2967714385 Bacteria 7000047
349 2967727256 2967721400 Bacteria 7073753
350 2967741513 2967735183 Bacteria 6827012
351 2967754182 2967748971 Bacteria 6733771
352 2967759749 2967755722 Bacteria 6814706
353 2967766989 2967762386 Bacteria 6923502
354 2967773364 2967769361 Bacteria 6587838
355 2967778620 2967775926 Bacteria 6738189
356 2968021853 2968016561 Bacteria 7022047
357 2970024020 2970019648 Bacteria 7072033
358 2970039924 2970033650 Bacteria 7118744
359 2970047323 2970040964 Bacteria 6731123
360 2970049915 2970047711 Bacteria 7088379
361 2970056514 2970054988 Bacteria 6611507
362 2970066507 2970061556 Bacteria 7099761
363 2970074185 2970068827 Bacteria 7123112
364 2970080927 2970076120 Bacteria 6697332
365 2970087414 2970082768 Bacteria 6183754
366 2970094100 2970088815 Bacteria 6933825
367 2970101606 2970095765 Bacteria 6936963
368 2970106780 2970102677 Bacteria 6812532
369 2970114760 2970109326 Bacteria 6863976
370 2970121050 2970116247 Bacteria 6501857
371 2970132440 2970129317 Bacteria 6806560
372 2970139394 2970136068 Bacteria 7207982
373 2970150628 2970149975 Bacteria 6779706
374 2970158540 2970156795 Bacteria 7168044
375 2970168812 2970164137 Bacteria 6861252
376 2970173922 2970170962 Bacteria 6876229
377 2970179742 2970177841 Bacteria 6768001
378 2970189683 2970184632 Bacteria 7054431
379 2970196461 2970191845 Bacteria 7032787
380 2970474443 2970469710 Bacteria 6969209
381 2970598744 2970593180 Bacteria 7073582
382 2977522591 2977516862 Bacteria 6940108
383 2977528684 2977523885 Bacteria 6960446
384 2977543924 2977537788 Bacteria 6929320
385 2977555340 2977551784 Bacteria 7125765
386 2977561752 2977558990 Bacteria 6863948
387 2977572122 2977565890 Bacteria 6901543
388 2977576191 2977572785 Bacteria 6763888
389 2977584824 2977579622 Bacteria 6772100
390 2988729019 2988728565 Bacteria 6124362
391 2996353852 2996348954 Bacteria 7239054
392 3004280520 3004275668 Bacteria 7114440
393 643826150 643692032 Bacteria 6891900
394 648740824 648276728 Bacteria 6968865
395 8003994008 8003992118 Bacteria 7266902
396 8049295161 8049293176 Bacteria 6128433
397 SwRhRL2b_contig_581576
398 JGI25406J46586_10001045
399 JGI25406J46586_10004550
400 JGI25404J52841_10000071
401 Ga0058859_11744552
402 Ga0065704_10000460
403 Ga0065712_10081384
404 Ga0070676_10024920
405 Ga0070670_100000658
406 Ga0070677_10023824
407 Ga0068869_100016719
408 Ga0068868_100000429
409 Ga0068868_100021719
410 Ga0070661_100000062
411 Ga0070661_100000887
412 Ga0070675_100000530
413 Ga0070675_100045163
414 Ga0070671_100000974
415 Ga0070671_100025627
416 Ga0070673_100011889
417 Ga0070700_100047722
418 Ga0068867_100007334
419 Ga0070672_100000444
420 Ga0070672_100028072
421 Ga0070665_100113984
422 Ga0070664_100000035
423 Ga0070664_100000551
424 Ga0068857_100066716
425 Ga0068852_100000789
426 Ga0068859_100016014
427 Ga0068864_100010574
428 Ga0068866_10027060
429 Ga0068861_100004009
430 Ga0068851_10019724
431 Ga0068860_100013487
432 Ga0068862_100076225
433 Ga0068862_100078142
434 Ga0081455_10000039
435 Ga0081455_10015764
436 Ga0081455_10020309
437 Ga0081538_10027194
438 Ga0081540_1002766
439 Ga0081540_1003841
440 Ga0081540_1007998
441 Ga0081539_10000006
442 Ga0081539_10001054
443 Ga0081539_10010706
444 Ga0075366_10007096
445 Ga0097621_100000779
446 Ga0068871_100001096
447 Ga0075430_100014151
448 Ga0068865_100001993
449 Ga0097620_100016014
450 Ga0079104_1002834
451 Ga0105244_10000616
452 Ga0111539_10093687
453 Ga0105245_10041267
454 Ga0114129_10120699
455 Ga0105243_10017753
456 Ga0105237_10000042
457 Ga0105246_10047948
458 Ga0157373_10009869
459 Ga0157369_10000251
460 Ga0157374_10002042
461 Ga0157378_10002224
462 Ga0157378_10015856
463 Ga0163162_10022581
464 Ga0163162_10034202
465 Ga0157375_10001457
466 Ga0157375_10027315
467 Ga0157375_10051064
468 Ga0157375_10137518
469 Ga0157380_10016418
470 Ga0157377_10047434
471 Ga0157379_10035971
472 Ga0182006_1000730
473 Ga0163161_10049956
474 Ga0214544_1000169
475 Ga0214542_1000131
476 Ga0214543_1000028
477 Ga0214543_1002177
478 Ga0213876_10005556
479 Ga0207655_1000070
480 Ga0207671_10000847
481 Ga0207649_10000010
482 Ga0207649_10016632
483 Ga0207650_10000744
484 Ga0207650_10091514
485 Ga0207659_10001754
486 Ga0207644_10000981
487 Ga0207644_10034563
488 Ga0207686_10008553
489 Ga0207704_10035374
490 Ga0207691_10000535
491 Ga0207691_10141298
492 Ga0207689_10010359
493 Ga0207661_10020045
494 Ga0207679_10000022
495 Ga0207679_10003256
496 Ga0207651_10076474
497 Ga0207708_10142658
498 Ga0207648_10001572
499 Ga0207648_10004099
500 Ga0207674_10106593
501 Ga0207698_10000710
502 Ga0209281_1000426
503 Ga0268265_10007276
504 Ga0268265_10122114
505 Ga0265334_10023255
506 Ga0307410_10099530
507 Ga0307412_10003028
508 Ga0307409_100102320
509 Ga0307411_10006185
510 Ga0395900_0028577
511 Ga0436364_0134120
512 Ga0436364_0890864
513 Ga0436364_1025004
514 Ga0436365_1218614
515 Ga0436365_1289272
516 Ga0439436_0014167
517 Ga0439438_001045
518 Ga0439466_0007217
519 Ga0439452_000124
520 Ga0439460_0000074
521 Ga0495627_000009
522 Ga0495627_000014
523 Ga0495590_0000898
524 Ga0495638_0000088
525 Ga0495583_0001020
526 Ga0495631_0000457
527 Ga0495632_0013972
528 Ga0495632_0015842
529 Ga0495643_0011715
530 Ga0495644_0000005
531 Ga0495654_0000270
532 Ga0495609_0000079
533 Ga0495611_0000953
534 Ga0495661_0000284
535 Ga0495671_0003763
536 Ga0495671_0015300
537 Ga0495649_0000060
538 Ga0495672_0000687
539 Ga0495672_0001666
540 Ga0495672_0004513
541 Ga0495683_0043418
542 Ga0495673_0009387
543 Ga0496109_0070836
544 Ga0496110_0006320
545 Ga0496110_0028350
546 Ga0496111_0018582
547 Ga0496124_0000276
548 Ga0496125_0000410
549 Ga0496126_0000692
550 Ga0495678_002466
551 Ga0501042_0016694
552 Ga0501046_0044093
553 Ga0501048_0052564
554 Ga0501074_0029054
555 Ga0501075_0105575
556 Ga0501076_0135272
557 Ga0501222_000145
558 Ga0501080_0015188
559 nmdc:mga03683_14516_c1
560 nmdc:mga05p37_40914_c1
561 nmdc:mga05p37_75144_c1
562 nmdc:mga09592_9074_c1
563 nmdc:mga0qj67_67692_c1
564 nmdc:mga06r32_107379_c1
565 nmdc:mga08y16_220343_c1
566 nmdc:mga08y16_66557_c1
567 Ga0500573_0000823
568 Ga0500616_0030701
569 Ga0530510_0007166
570 2551690218
571 2509110933
572 2509117286
573 2509376325
574 2509398349
575 2510304337
576 2511502108
577 2512533482
578 2513582498
579 2513618059
580 2513885444
581 2513903220
582 2515608887
583 2516893486
584 2524448683
585 2551680092
586 2551684435
587 2551704300
588 2551713936
589 2551722624
590 2551725851
591 2551738716
592 2551741460
593 2558867850
594 2621299683
595 2644088800
596 2644284289
597 2644345569
598 2644365573
599 2657681381
600 2692315681
601 2738669683
602 2738748076
603 2738857118
604 2753460348
605 2792580637
606 2792620318
607 2792626265
608 2792639208
609 2804752576
610 2808958572
611 2817491035
612 2825651524
613 2847419259
614 2848994286
615 2850081291
616 2855826209
617 2855841554
618 2855875943
619 2856326245
620 2858801662
621 2869284132
622 2874144756
623 2878743874
624 2888342176
625 2896385844
626 2913039831
627 2913299507
628 2915987410
629 2915997780
630 2916002652
631 2916007880
632 2916020156
633 2916027859
634 2916029169
635 2916039498
636 2916043775
637 2916052428
638 2916058859
639 2916075246
640 2916080524
641 2920761777
642 2921205636
643 2921210823
644 2921240861
645 2921244789
646 2921260569
647 2921267690
648 2921287902
649 2921289509
650 2921301479
651 2924148669
652 2924151388
653 2924162050
654 2924166053
655 2924176154
656 2924180110
657 2924190698
658 2924199714
659 2924203581
660 2924212730
661 2924219624
662 2924223744
663 2924232192
664 2924721092
665 2924781791
666 2937000273
667 2937008374
668 2937014744
669 2937018611
670 2937027059
671 2937046187
672 2937051330
673 2937062456
674 2937069164
675 2937075085
676 2937093846
677 2937100281
678 2937110663
679 2937117048
680 2937124619
681 2937127698
682 2937884881
683 2937978153
684 2957382720
685 2957392989
686 2957398903
687 2957408124
688 2957410823
689 2957421850
690 2957425636
691 2957436347
692 2957450112
693 2957456104
694 2957460840
695 2957468698
696 2957475672
697 2957481547
698 2957487608
699 2957492354
700 2957502363
701 2957507383
702 2958040521
703 2958055369
704 2958068330
705 2958092190
706 2958096843
707 2958148049
708 2960590174
709 2960602548
710 2960609122
711 2960616243
712 2960623220
713 2960627919
714 2960640831
715 2960650180
716 2960653195
717 2960661451
718 2960670037
719 2960678878
720 2960690562
721 2964609957
722 2964615704
723 2964626411
724 2964633955
725 2964638478
726 2964648017
727 2964653378
728 2964662709
729 2964667546
730 2964676471
731 2964684527
732 2964689442
733 2964697106
734 2964703689
735 2964711979
736 2964718998
737 2964720610
738 2967669835
739 2967674335
740 2967679846
741 2967696433
742 2967703801
743 2967709116
744 2967719656
745 2967727256
746 2967741513
747 2967754182
748 2967759749
749 2967766989
750 2967773364
751 2967778620
752 2968021853
753 2970024020
754 2970039924
755 2970047323
756 2970049915
757 2970056514
758 2970066507
759 2970074185
760 2970080927
761 2970087414
762 2970094100
763 2970101606
764 2970106780
765 2970114760
766 2970121050
767 2970132440
768 2970139394
769 2970150628
770 2970158540
771 2970168812
772 2970173922
773 2970179742
774 2970189683
775 2970196461
776 2970474443
777 2970598744
778 2977522591
779 2977528684
780 2977543924
781 2977555340
782 2977561752
783 2977572122
784 2977576191
785 2977584824
786 2988729019
787 2996353852
788 3004280520
789 643826150
790 648740824
791 8003994008
792 8049295161

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

116

210

0.92

PF05116

S6PP

Sucrose-6F-phosphate phosphohydrolase

107

199

0.88

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

2

106

0.86

PF13401

AAA_22

AAA domain

240

385

0.79

PF01935

DUF87

Helicase HerA, central domain

243

465

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wr8-assembly1.cif.gz_A crystal structure of hypothetical protein ph1421 from pyrococcus horikoshii. 0.8867 3 220
3niw-assembly1.cif.gz_A crystal structure of a haloacid dehalogenase-like hydrolase from bacteroides thetaiotaomicron 0.8501 3 217
1wr8-assembly1.cif.gz_A crystal structure of hypothetical protein ph1421 from pyrococcus horikoshii. 0.84 3 220
2b30-assembly2.cif.gz_D initial crystallographic structural analysis of a putative had/cof-like hydrolase from plasmodium vivax 0.8315 2 219
1kyt-assembly1.cif.gz_A crystal structure of thermoplasma acidophilum 0175 (apc014) 0.8194 1 218
ID Description Score Start End Superfamily
1wr8A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9201 3 220 3.40.50.1000
af_A0A0P0VTU7_76_213_1.20.1110.10 Mainly Alpha;Up-down Bundle;Calcium-transporting ATPase, transmembrane domain;Calcium-transporting ATPase, transmembrane domain 0.9148 166 204 1.20.1110.10
af_A0A1D6GSK2_41_144_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9039 166 204 3.40.50.1000
1wr8A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8876 3 220 3.40.50.1000
3l7yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8719 3 219 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A535U5B8-F1-model_v4 HAD family phosphatase 0.9897 1 181 GO:0000287
GO:0005829
GO:0016791
AF-A0A257XAE7-F1-model_v4 Haloacid dehalogenase 0.9825 2 219 GO:0000287
GO:0005829
GO:0016791
AF-K9T061-F1-model_v4 HAD-superfamily hydrolase, subfamily IIB 0.9819 1 219 GO:0000287
GO:0005829
GO:0016791
AF-A0A436IM95-F1-model_v4 deleted 0.9816 1 201
AF-A0A535U5B8-F1-model_v4 HAD family phosphatase 0.9789 1 181 GO:0000287
GO:0005829
GO:0016791

Map