F433644
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 396 | 358 | 792 | 567 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2551306086|2551690218 |
| Length | 656 |
| Sequence | ALATDYDGTLADYGAVRPETLETLKRLKESGRKLLLVTGRELPDLKSVFPEIDVFDKVVVENGALLYTPETGEERLLAPSPPEAFIERLKEKGVDRMSVGRSIVATWEPFQTAALEAINELGLELEIIFNKGAVMVLPTGVNKATGLKAALKEMGLSFLNVVGVGDAENDHALLRMCGCGAAVANALPALKDTADVVLEGVRGAGVEQLMNRIMESDYALCASARHQVPIGEDDEGQVEIGPQDVLLIAGSSGIGKSRLATALAERLRERHFQLCIFDPEGDYEGLEGAVTVGNGSVAPTGREVLELLANPDDNVVVSATGVEPNERPEFFANLMPDLSALRARTGRPHWLIIDEAHHLMPAARDSASLALSDDRSGMIMITVHPDSVSPDALKEITAVAALGPKARDVIATICSVFDEALPAGLDASFGEDEVLFWRRTPPTPVRRIKAEQPREARKRHTRKYAEGRLGEEASFYFRGPKNEMNLRAHNLTMFLQIAEGIDDRTWEHHLRRGDYSKWFEERIGDEELAGEAAGIEEDRSLSPAESRQRLXPAAGVERTTSLLFRLLLRGGAAAVGAFRTFVEPLGAFPKVGPLLCFCLFLFLGGAFAQAGGGLLALCRRGLFDTHGSHSSLSETQIERAQIFLCSSADEGSCGLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 26 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 27 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 33 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 41 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 60 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 61 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 62 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 63 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 81 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 83 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 84 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 85 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 86 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 87 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 88 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 89 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 90 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 91 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 92 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 93 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 94 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 95 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 113 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 114 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 115 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 116 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 117 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 118 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 126 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 128 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 134 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 135 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 136 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 137 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 138 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 139 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 140 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 141 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 142 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 143 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 144 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 145 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 146 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 147 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 148 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 149 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 150 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 151 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 152 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 153 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 154 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 155 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 156 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 157 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 158 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 159 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 160 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 161 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 162 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 163 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 164 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 165 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 166 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 167 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 168 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 169 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 170 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 171 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 172 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 173 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 174 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 175 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 176 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 177 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 178 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 179 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 180 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 181 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 182 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 183 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 184 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 185 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 186 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 187 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 188 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 189 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 190 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 191 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 192 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 193 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 194 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 195 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 196 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 197 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 198 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 199 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 200 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 201 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 202 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 203 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 204 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 205 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 206 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 207 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 208 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 209 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 210 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 211 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 212 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 213 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 214 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 215 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 216 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 217 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 218 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 219 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 220 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 221 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 222 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 223 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 224 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 225 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 226 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 227 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 228 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 229 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 230 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 231 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 232 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 233 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 234 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 235 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 236 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 237 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 238 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 239 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 240 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 241 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 242 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 243 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 244 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 245 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 246 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 247 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 248 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 249 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 250 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 251 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 252 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 253 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 254 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 255 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 256 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 257 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 258 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 259 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 260 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 261 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 262 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 263 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 264 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 265 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 266 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 267 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 268 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 269 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 270 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 271 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 272 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 273 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 274 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 275 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 276 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 277 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 278 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 279 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 280 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 281 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 282 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 283 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 284 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 285 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 286 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 287 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 288 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 289 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 290 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 291 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 292 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 293 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 294 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 295 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 296 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 297 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 298 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 299 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 300 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 301 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 302 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 303 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 304 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 305 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 306 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 307 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 308 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 309 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 310 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 311 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 312 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 313 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 314 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 315 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 316 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 317 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 318 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 319 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 320 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 321 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 322 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 323 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 324 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 325 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 326 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 327 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 328 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 329 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 330 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 331 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 332 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 333 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 334 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 335 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 336 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 337 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 338 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 339 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 340 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 341 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 342 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 343 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 344 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 345 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 346 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 347 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 348 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 349 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 350 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 351 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 352 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 353 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 354 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 355 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 356 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 357 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 358 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 43.43 |
| Metatranscriptomes | 0.25 |
| Isolates | 56.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.01 |
| Nodule | 51.52 |
| Rhizoplane | 1.01 |
| Rhizosphere | 38.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_581576 | 2162886007 | Bacteria | 7298 |
| 2 | JGI25406J46586_10001045 | 3300003203 | Bacteria | 12953 |
| 3 | JGI25406J46586_10004550 | 3300003203 | Bacteria | 6455 |
| 4 | JGI25404J52841_10000071 | 3300003659 | Bacteria | 9078 |
| 5 | Ga0058859_11744552 | 3300004798 | Bacteria | 3801 |
| 6 | Ga0065704_10000460 | 3300005289 | Bacteria | 24815 |
| 7 | Ga0065712_10081384 | 3300005290 | Bacteria | 2984 |
| 8 | Ga0070676_10024920 | 3300005328 | Bacteria | 3375 |
| 9 | Ga0070670_100000658 | 3300005331 | Bacteria | 26869 |
| 10 | Ga0070677_10023824 | 3300005333 | Bacteria | 2270 |
| 11 | Ga0068869_100016719 | 3300005334 | Bacteria | 4951 |
| 12 | Ga0068868_100000429 | 3300005338 | Bacteria | 28175 |
| 13 | Ga0068868_100021719 | 3300005338 | Bacteria | 4836 |
| 14 | Ga0070661_100000062 | 3300005344 | Bacteria | 85485 |
| 15 | Ga0070661_100000887 | 3300005344 | Bacteria | 21498 |
| 16 | Ga0070675_100000530 | 3300005354 | Bacteria | 26046 |
| 17 | Ga0070675_100045163 | 3300005354 | Bacteria | 3605 |
| 18 | Ga0070671_100000974 | 3300005355 | Bacteria | 20979 |
| 19 | Ga0070671_100025627 | 3300005355 | Bacteria | 4840 |
| 20 | Ga0070673_100011889 | 3300005364 | Bacteria | 5960 |
| 21 | Ga0070700_100047722 | 3300005441 | Bacteria | 2651 |
| 22 | Ga0068867_100007334 | 3300005459 | Bacteria | 7804 |
| 23 | Ga0070672_100000444 | 3300005543 | Bacteria | 24200 |
| 24 | Ga0070672_100028072 | 3300005543 | Bacteria | 4205 |
| 25 | Ga0070665_100113984 | 3300005548 | Bacteria | 2706 |
| 26 | Ga0070664_100000035 | 3300005564 | Bacteria | 81750 |
| 27 | Ga0070664_100000551 | 3300005564 | Bacteria | 28654 |
| 28 | Ga0068857_100066716 | 3300005577 | Bacteria | 3203 |
| 29 | Ga0068852_100000789 | 3300005616 | Bacteria | 20824 |
| 30 | Ga0068859_100016014 | 3300005617 | Bacteria | 7535 |
| 31 | Ga0068864_100010574 | 3300005618 | Bacteria | 7631 |
| 32 | Ga0068866_10027060 | 3300005718 | Bacteria | 2715 |
| 33 | Ga0068861_100004009 | 3300005719 | Bacteria | 9862 |
| 34 | Ga0068851_10019724 | 3300005834 | Bacteria | 3259 |
| 35 | Ga0068860_100013487 | 3300005843 | Bacteria | 8015 |
| 36 | Ga0068862_100076225 | 3300005844 | Bacteria | 2902 |
| 37 | Ga0068862_100078142 | 3300005844 | Bacteria | 2867 |
| 38 | Ga0081455_10000039 | 3300005937 | Bacteria | 135506 |
| 39 | Ga0081455_10015764 | 3300005937 | Bacteria | 7321 |
| 40 | Ga0081455_10020309 | 3300005937 | Bacteria | 6261 |
| 41 | Ga0081538_10027194 | 3300005981 | Bacteria | 3974 |
| 42 | Ga0081540_1002766 | 3300005983 | Bacteria | 14234 |
| 43 | Ga0081540_1003841 | 3300005983 | Bacteria | 11746 |
| 44 | Ga0081540_1007998 | 3300005983 | Bacteria | 7444 |
| 45 | Ga0081539_10000006 | 3300005985 | Bacteria | 534555 |
| 46 | Ga0081539_10001054 | 3300005985 | Bacteria | 50478 |
| 47 | Ga0081539_10010706 | 3300005985 | Bacteria | 7394 |
| 48 | Ga0075366_10007096 | 3300006195 | Bacteria | 6169 |
| 49 | Ga0097621_100000779 | 3300006237 | Bacteria | 22344 |
| 50 | Ga0068871_100001096 | 3300006358 | Bacteria | 18190 |
| 51 | Ga0075430_100014151 | 3300006846 | Bacteria | 6801 |
| 52 | Ga0068865_100001993 | 3300006881 | Bacteria | 12057 |
| 53 | Ga0097620_100016014 | 3300006931 | Bacteria | 7535 |
| 54 | Ga0079104_1002834 | 3300006946 | Bacteria | 8719 |
| 55 | Ga0105244_10000616 | 3300009036 | Bacteria | 31571 |
| 56 | Ga0111539_10093687 | 3300009094 | Bacteria | 3528 |
| 57 | Ga0105245_10041267 | 3300009098 | Bacteria | 4113 |
| 58 | Ga0114129_10120699 | 3300009147 | Bacteria | 3609 |
| 59 | Ga0105243_10017753 | 3300009148 | Bacteria | 5383 |
| 60 | Ga0105237_10000042 | 3300009545 | Bacteria | 181280 |
| 61 | Ga0105246_10047948 | 3300011119 | Bacteria | 2919 |
| 62 | Ga0157373_10009869 | 3300013100 | Bacteria | 7035 |
| 63 | Ga0157369_10000251 | 3300013105 | Bacteria | 73814 |
| 64 | Ga0157374_10002042 | 3300013296 | Bacteria | 16963 |
| 65 | Ga0157378_10002224 | 3300013297 | Bacteria | 17210 |
| 66 | Ga0157378_10015856 | 3300013297 | Bacteria | 6599 |
| 67 | Ga0163162_10022581 | 3300013306 | Bacteria | 6203 |
| 68 | Ga0163162_10034202 | 3300013306 | Bacteria | 5056 |
| 69 | Ga0157375_10001457 | 3300013308 | Bacteria | 20349 |
| 70 | Ga0157375_10027315 | 3300013308 | Bacteria | 5334 |
| 71 | Ga0157375_10051064 | 3300013308 | Bacteria | 4059 |
| 72 | Ga0157375_10137518 | 3300013308 | Bacteria | 2568 |
| 73 | Ga0157380_10016418 | 3300014326 | Bacteria | 5461 |
| 74 | Ga0157377_10047434 | 3300014745 | Bacteria | 2407 |
| 75 | Ga0157379_10035971 | 3300014968 | Bacteria | 4416 |
| 76 | Ga0182006_1000730 | 3300015261 | Bacteria | 22661 |
| 77 | Ga0163161_10049956 | 3300017792 | Bacteria | 3024 |
| 78 | Ga0214544_1000169 | 3300021320 | Bacteria | 101212 |
| 79 | Ga0214542_1000131 | 3300021321 | Bacteria | 107074 |
| 80 | Ga0214543_1000028 | 3300021327 | Bacteria | 214029 |
| 81 | Ga0214543_1002177 | 3300021327 | Bacteria | 38571 |
| 82 | Ga0213876_10005556 | 3300021384 | Bacteria | 6918 |
| 83 | Ga0207655_1000070 | 3300025728 | Bacteria | 239196 |
| 84 | Ga0207671_10000847 | 3300025914 | Bacteria | 38847 |
| 85 | Ga0207649_10000010 | 3300025920 | Bacteria | 284354 |
| 86 | Ga0207649_10016632 | 3300025920 | Bacteria | 4153 |
| 87 | Ga0207650_10000744 | 3300025925 | Bacteria | 25123 |
| 88 | Ga0207650_10091514 | 3300025925 | Bacteria | 2325 |
| 89 | Ga0207659_10001754 | 3300025926 | Bacteria | 12835 |
| 90 | Ga0207644_10000981 | 3300025931 | Bacteria | 18213 |
| 91 | Ga0207644_10034563 | 3300025931 | Bacteria | 3538 |
| 92 | Ga0207686_10008553 | 3300025934 | Bacteria | 5530 |
| 93 | Ga0207704_10035374 | 3300025938 | Bacteria | 2861 |
| 94 | Ga0207691_10000535 | 3300025940 | Bacteria | 37955 |
| 95 | Ga0207691_10141298 | 3300025940 | Bacteria | 2122 |
| 96 | Ga0207689_10010359 | 3300025942 | Bacteria | 8032 |
| 97 | Ga0207661_10020045 | 3300025944 | Bacteria | 4994 |
| 98 | Ga0207679_10000022 | 3300025945 | Bacteria | 219036 |
| 99 | Ga0207679_10003256 | 3300025945 | Bacteria | 10031 |
| 100 | Ga0207651_10076474 | 3300025960 | Bacteria | 2393 |
| 101 | Ga0207708_10142658 | 3300026075 | Bacteria | 1880 |
| 102 | Ga0207648_10001572 | 3300026089 | Bacteria | 25025 |
| 103 | Ga0207648_10004099 | 3300026089 | Bacteria | 15087 |
| 104 | Ga0207674_10106593 | 3300026116 | Bacteria | 2780 |
| 105 | Ga0207698_10000710 | 3300026142 | Bacteria | 19262 |
| 106 | Ga0209281_1000426 | 3300027111 | Bacteria | 62651 |
| 107 | Ga0268265_10007276 | 3300028380 | Bacteria | 7480 |
| 108 | Ga0268265_10122114 | 3300028380 | Bacteria | 2148 |
| 109 | Ga0265334_10023255 | 3300028573 | Unclassified | 2521 |
| 110 | Ga0307410_10099530 | 3300031852 | Bacteria | 2081 |
| 111 | Ga0307412_10003028 | 3300031911 | Bacteria | 9305 |
| 112 | Ga0307409_100102320 | 3300031995 | Bacteria | 2380 |
| 113 | Ga0307411_10006185 | 3300032005 | Bacteria | 5961 |
| 114 | Ga0395900_0028577 | 3300037418 | Bacteria | 5714 |
| 115 | Ga0436364_0134120 | 3300037853 | Bacteria | 7669 |
| 116 | Ga0436364_0890864 | 3300037853 | Bacteria | 67172 |
| 117 | Ga0436364_1025004 | 3300037853 | Bacteria | 2700 |
| 118 | Ga0436365_1218614 | 3300039437 | Bacteria | 23452 |
| 119 | Ga0436365_1289272 | 3300039437 | Bacteria | 4443 |
| 120 | Ga0439436_0014167 | 3300041404 | Bacteria | 2409 |
| 121 | Ga0439438_001045 | 3300041405 | Bacteria | 12327 |
| 122 | Ga0439466_0007217 | 3300041411 | Bacteria | 4205 |
| 123 | Ga0439452_000124 | 3300042010 | Bacteria | 59201 |
| 124 | Ga0439460_0000074 | 3300042461 | Bacteria | 15152 |
| 125 | Ga0495627_000009 | 3300046453 | Bacteria | 463964 |
| 126 | Ga0495627_000014 | 3300046453 | Bacteria | 326114 |
| 127 | Ga0495590_0000898 | 3300046457 | Bacteria | 13323 |
| 128 | Ga0495638_0000088 | 3300046460 | Bacteria | 152517 |
| 129 | Ga0495583_0001020 | 3300046506 | Bacteria | 31872 |
| 130 | Ga0495631_0000457 | 3300046518 | Bacteria | 27703 |
| 131 | Ga0495632_0013972 | 3300046519 | Bacteria | 4559 |
| 132 | Ga0495632_0015842 | 3300046519 | Bacteria | 4211 |
| 133 | Ga0495643_0011715 | 3300046522 | Bacteria | 5324 |
| 134 | Ga0495644_0000005 | 3300046523 | Bacteria | 135313 |
| 135 | Ga0495654_0000270 | 3300046530 | Bacteria | 47176 |
| 136 | Ga0495609_0000079 | 3300046538 | Bacteria | 118997 |
| 137 | Ga0495611_0000953 | 3300046648 | Bacteria | 15482 |
| 138 | Ga0495661_0000284 | 3300046665 | Bacteria | 57616 |
| 139 | Ga0495671_0003763 | 3300046692 | Bacteria | 9217 |
| 140 | Ga0495671_0015300 | 3300046692 | Bacteria | 4114 |
| 141 | Ga0495649_0000060 | 3300046694 | Bacteria | 97624 |
| 142 | Ga0495672_0000687 | 3300047320 | Bacteria | 37704 |
| 143 | Ga0495672_0001666 | 3300047320 | Bacteria | 21550 |
| 144 | Ga0495672_0004513 | 3300047320 | Bacteria | 11363 |
| 145 | Ga0495683_0043418 | 3300047323 | Bacteria | 2263 |
| 146 | Ga0495673_0009387 | 3300047469 | Bacteria | 5415 |
| 147 | Ga0496109_0070836 | 3300048912 | Bacteria | 3200 |
| 148 | Ga0496110_0006320 | 3300048913 | Bacteria | 9358 |
| 149 | Ga0496110_0028350 | 3300048913 | Bacteria | 4808 |
| 150 | Ga0496111_0018582 | 3300048914 | Bacteria | 4817 |
| 151 | Ga0496124_0000276 | 3300048927 | Bacteria | 98406 |
| 152 | Ga0496125_0000410 | 3300048928 | Bacteria | 80395 |
| 153 | Ga0496126_0000692 | 3300048929 | Bacteria | 61735 |
| 154 | Ga0495678_002466 | 3300049459 | Bacteria | 12505 |
| 155 | Ga0501042_0016694 | 3300049578 | Bacteria | 5046 |
| 156 | Ga0501046_0044093 | 3300049580 | Bacteria | 3548 |
| 157 | Ga0501048_0052564 | 3300049582 | Bacteria | 2900 |
| 158 | Ga0501074_0029054 | 3300049590 | Bacteria | 4005 |
| 159 | Ga0501075_0105575 | 3300049591 | Bacteria | 2141 |
| 160 | Ga0501076_0135272 | 3300049592 | Bacteria | 2001 |
| 161 | Ga0501222_000145 | 3300049662 | Bacteria | 14849 |
| 162 | Ga0501080_0015188 | 3300049742 | Bacteria | 7096 |
| 163 | nmdc:mga03683_14516_c1 | 3300050489 | Bacteria | 2916 |
| 164 | nmdc:mga05p37_40914_c1 | 3300050507 | Bacteria | 5691 |
| 165 | nmdc:mga05p37_75144_c1 | 3300050507 | Bacteria | 4160 |
| 166 | nmdc:mga09592_9074_c1 | 3300050508 | Bacteria | 8085 |
| 167 | nmdc:mga0qj67_67692_c1 | 3300050509 | Bacteria | 2845 |
| 168 | nmdc:mga06r32_107379_c1 | 3300050510 | Bacteria | 2743 |
| 169 | nmdc:mga08y16_220343_c1 | 3300050511 | Unclassified | 1964 |
| 170 | nmdc:mga08y16_66557_c1 | 3300050511 | Bacteria | 3760 |
| 171 | Ga0500573_0000823 | 3300053140 | Bacteria | 13982 |
| 172 | Ga0500616_0030701 | 3300053153 | Bacteria | 2949 |
| 173 | Ga0530510_0007166 | 3300061734 | Bacteria | 7760 |
| 174 | 2551690218 | 2551306086 | Bacteria | 6843938 |
| 175 | 2509110933 | 2508501122 | Bacteria | 6292184 |
| 176 | 2509117286 | 2508501123 | Bacteria | 6283661 |
| 177 | 2509376325 | 2509276019 | Bacteria | 6802256 |
| 178 | 2509398349 | 2509276022 | Bacteria | 6200534 |
| 179 | 2510304337 | 2510065057 | Bacteria | 6649661 |
| 180 | 2511502108 | 2511231052 | Bacteria | 6974333 |
| 181 | 2512533482 | 2512047086 | Bacteria | 6850303 |
| 182 | 2513582498 | 2513237086 | Bacteria | 7265287 |
| 183 | 2513618059 | 2513237091 | Bacteria | 6900273 |
| 184 | 2513885444 | 2513237140 | Bacteria | 7076289 |
| 185 | 2513903220 | 2513237143 | Bacteria | 6664116 |
| 186 | 2515608887 | 2515154107 | Bacteria | 6795637 |
| 187 | 2516893486 | 2516653046 | Bacteria | 6989037 |
| 188 | 2524448683 | 2524023207 | Bacteria | 6813453 |
| 189 | 2551680092 | 2551306084 | Bacteria | 8942552 |
| 190 | 2551684435 | 2551306085 | Bacteria | 7347181 |
| 191 | 2551704300 | 2551306087 | Bacteria | 7351905 |
| 192 | 2551713936 | 2551306089 | Bacteria | 7162724 |
| 193 | 2551722624 | 2551306090 | Bacteria | 7953713 |
| 194 | 2551725851 | 2551306091 | Bacteria | 7086830 |
| 195 | 2551738716 | 2551306092 | Bacteria | 6992595 |
| 196 | 2551741460 | 2551306093 | Bacteria | 7064773 |
| 197 | 2558867850 | 2558860100 | Bacteria | 8458965 |
| 198 | 2621299683 | 2619619299 | Bacteria | 6649820 |
| 199 | 2644088800 | 2643221614 | Bacteria | 4260023 |
| 200 | 2644284289 | 2643221650 | Bacteria | 7029547 |
| 201 | 2644345569 | 2643221661 | Bacteria | 4267604 |
| 202 | 2644365573 | 2643221666 | Bacteria | 4265935 |
| 203 | 2657681381 | 2657244999 | Bacteria | 5946535 |
| 204 | 2692315681 | 2690316117 | Bacteria | 6800650 |
| 205 | 2738669683 | 2738541265 | Bacteria | 6594665 |
| 206 | 2738748076 | 2738541282 | Bacteria | 6593925 |
| 207 | 2738857118 | 2738541303 | Bacteria | 6591772 |
| 208 | 2753460348 | 2751185821 | Bacteria | 6189929 |
| 209 | 2792580637 | 2791355082 | Bacteria | 5973319 |
| 210 | 2792620318 | 2791355091 | Bacteria | 6135441 |
| 211 | 2792626265 | 2791355092 | Bacteria | 6248105 |
| 212 | 2792639208 | 2791355094 | Bacteria | 7011481 |
| 213 | 2804752576 | 2802429268 | Bacteria | 6094027 |
| 214 | 2808958572 | 2808606382 | Bacteria | 6841132 |
| 215 | 2817491035 | 2816332298 | Bacteria | 6852809 |
| 216 | 2825651524 | 2825651385 | Bacteria | 6715909 |
| 217 | 2847419259 | 2847417321 | Bacteria | 6913799 |
| 218 | 2848994286 | 2848992105 | Bacteria | 6810864 |
| 219 | 2850081291 | 2850079185 | Bacteria | 6848280 |
| 220 | 2855826209 | 2855825444 | Bacteria | 6785811 |
| 221 | 2855841554 | 2855839649 | Bacteria | 7135830 |
| 222 | 2855875943 | 2855872281 | Bacteria | 6964271 |
| 223 | 2856326245 | 2856320880 | Bacteria | 7263508 |
| 224 | 2858801662 | 2858800743 | Bacteria | 6603254 |
| 225 | 2869284132 | 2869278585 | Bacteria | 7077053 |
| 226 | 2874144756 | 2874139085 | Bacteria | 7021506 |
| 227 | 2878743874 | 2878738818 | Bacteria | 7136951 |
| 228 | 2888342176 | 2888337043 | Bacteria | 6629336 |
| 229 | 2896385844 | 2896384573 | Bacteria | 7700774 |
| 230 | 2913039831 | 2913036834 | Bacteria | 6704877 |
| 231 | 2913299507 | 2913295892 | Bacteria | 6333755 |
| 232 | 2915987410 | 2915986958 | Bacteria | 6739310 |
| 233 | 2915997780 | 2915993759 | Bacteria | 7016183 |
| 234 | 2916002652 | 2916000859 | Bacteria | 6865702 |
| 235 | 2916007880 | 2916007675 | Bacteria | 6898660 |
| 236 | 2916020156 | 2916014648 | Bacteria | 6946486 |
| 237 | 2916027859 | 2916021584 | Bacteria | 6854472 |
| 238 | 2916029169 | 2916028427 | Bacteria | 6748433 |
| 239 | 2916039498 | 2916035215 | Bacteria | 6755766 |
| 240 | 2916043775 | 2916041962 | Bacteria | 6820487 |
| 241 | 2916052428 | 2916048683 | Bacteria | 6543552 |
| 242 | 2916058859 | 2916055098 | Bacteria | 6758838 |
| 243 | 2916075246 | 2916068649 | Bacteria | 6943657 |
| 244 | 2916080524 | 2916076590 | Bacteria | 6596108 |
| 245 | 2920761777 | 2920760137 | Bacteria | 7427611 |
| 246 | 2921205636 | 2921201388 | Bacteria | 6926299 |
| 247 | 2921210823 | 2921208531 | Bacteria | 6745326 |
| 248 | 2921240861 | 2921237296 | Bacteria | 6876710 |
| 249 | 2921244789 | 2921244191 | Bacteria | 6568419 |
| 250 | 2921260569 | 2921257292 | Bacteria | 6808382 |
| 251 | 2921267690 | 2921263974 | Bacteria | 6864552 |
| 252 | 2921287902 | 2921282425 | Bacteria | 6826397 |
| 253 | 2921289509 | 2921289301 | Bacteria | 7316391 |
| 254 | 2921301479 | 2921296804 | Bacteria | 7176999 |
| 255 | 2924148669 | 2924144063 | Bacteria | 6883928 |
| 256 | 2924151388 | 2924150972 | Bacteria | 7169444 |
| 257 | 2924162050 | 2924158325 | Bacteria | 7188855 |
| 258 | 2924166053 | 2924165586 | Bacteria | 7260590 |
| 259 | 2924176154 | 2924172951 | Bacteria | 6749356 |
| 260 | 2924180110 | 2924179722 | Bacteria | 6843264 |
| 261 | 2924190698 | 2924186466 | Bacteria | 6876637 |
| 262 | 2924199714 | 2924193448 | Bacteria | 6955718 |
| 263 | 2924203581 | 2924200457 | Bacteria | 6757188 |
| 264 | 2924212730 | 2924207177 | Bacteria | 6917007 |
| 265 | 2924219624 | 2924214083 | Bacteria | 7080103 |
| 266 | 2924223744 | 2924221636 | Bacteria | 7113495 |
| 267 | 2924232192 | 2924228884 | Bacteria | 6633132 |
| 268 | 2924721092 | 2924718760 | Bacteria | 6331356 |
| 269 | 2924781791 | 2924776078 | Bacteria | 7492003 |
| 270 | 2937000273 | 2936996657 | Bacteria | 6298727 |
| 271 | 2937008374 | 2937002841 | Bacteria | 6934057 |
| 272 | 2937014744 | 2937009748 | Bacteria | 6746052 |
| 273 | 2937018611 | 2937016420 | Bacteria | 6782579 |
| 274 | 2937027059 | 2937023124 | Bacteria | 6815156 |
| 275 | 2937046187 | 2937042894 | Bacteria | 6741576 |
| 276 | 2937051330 | 2937049772 | Bacteria | 6757901 |
| 277 | 2937062456 | 2937056579 | Bacteria | 7107896 |
| 278 | 2937069164 | 2937063883 | Bacteria | 7199456 |
| 279 | 2937075085 | 2937071275 | Bacteria | 6984483 |
| 280 | 2937093846 | 2937091812 | Bacteria | 6979387 |
| 281 | 2937100281 | 2937098957 | Bacteria | 7249374 |
| 282 | 2937110663 | 2937106411 | Bacteria | 6947143 |
| 283 | 2937117048 | 2937113482 | Bacteria | 6505872 |
| 284 | 2937124619 | 2937119839 | Bacteria | 6597547 |
| 285 | 2937127698 | 2937126314 | Bacteria | 6771275 |
| 286 | 2937884881 | 2937877337 | Bacteria | 7246526 |
| 287 | 2937978153 | 2937972304 | Bacteria | 7532020 |
| 288 | 2957382720 | 2957382221 | Bacteria | 6737050 |
| 289 | 2957392989 | 2957388812 | Bacteria | 6778072 |
| 290 | 2957398903 | 2957395598 | Bacteria | 6822399 |
| 291 | 2957408124 | 2957402308 | Bacteria | 6741770 |
| 292 | 2957410823 | 2957408893 | Bacteria | 6558585 |
| 293 | 2957421850 | 2957415311 | Bacteria | 6991633 |
| 294 | 2957425636 | 2957422303 | Bacteria | 7172205 |
| 295 | 2957436347 | 2957430029 | Bacteria | 7022557 |
| 296 | 2957450112 | 2957443900 | Bacteria | 6869977 |
| 297 | 2957456104 | 2957450854 | Bacteria | 6765715 |
| 298 | 2957460840 | 2957457609 | Bacteria | 6967680 |
| 299 | 2957468698 | 2957464669 | Bacteria | 6568877 |
| 300 | 2957475672 | 2957471148 | Bacteria | 6797643 |
| 301 | 2957481547 | 2957478035 | Bacteria | 6756658 |
| 302 | 2957487608 | 2957484790 | Bacteria | 6703082 |
| 303 | 2957492354 | 2957491536 | Bacteria | 6695180 |
| 304 | 2957502363 | 2957498199 | Bacteria | 7126688 |
| 305 | 2957507383 | 2957505466 | Bacteria | 7253085 |
| 306 | 2958040521 | 2958034702 | Bacteria | 6989922 |
| 307 | 2958055369 | 2958041894 | Bacteria | 13082850 |
| 308 | 2958068330 | 2958064165 | Bacteria | 7158582 |
| 309 | 2958092190 | 2958084443 | Bacteria | 7312792 |
| 310 | 2958096843 | 2958092219 | Bacteria | 6861151 |
| 311 | 2958148049 | 2958144490 | Bacteria | 6677056 |
| 312 | 2960590174 | 2960584000 | Bacteria | 6864594 |
| 313 | 2960602548 | 2960597568 | Bacteria | 6550735 |
| 314 | 2960609122 | 2960603979 | Bacteria | 6898737 |
| 315 | 2960616243 | 2960610863 | Bacteria | 6691244 |
| 316 | 2960623220 | 2960617483 | Bacteria | 6727748 |
| 317 | 2960627919 | 2960624210 | Bacteria | 6875384 |
| 318 | 2960640831 | 2960637947 | Bacteria | 7296468 |
| 319 | 2960650180 | 2960645483 | Bacteria | 7211087 |
| 320 | 2960653195 | 2960652885 | Bacteria | 7083688 |
| 321 | 2960661451 | 2960660292 | Bacteria | 7041660 |
| 322 | 2960670037 | 2960667422 | Bacteria | 6763020 |
| 323 | 2960678878 | 2960674078 | Bacteria | 6609048 |
| 324 | 2960690562 | 2960687367 | Bacteria | 6535474 |
| 325 | 2964609957 | 2964607997 | Bacteria | 7101408 |
| 326 | 2964615704 | 2964615318 | Bacteria | 6809089 |
| 327 | 2964626411 | 2964621998 | Bacteria | 6834995 |
| 328 | 2964633955 | 2964628898 | Bacteria | 7083044 |
| 329 | 2964638478 | 2964636051 | Bacteria | 7091832 |
| 330 | 2964648017 | 2964643177 | Bacteria | 6820887 |
| 331 | 2964653378 | 2964649959 | Bacteria | 6675118 |
| 332 | 2964662709 | 2964656573 | Bacteria | 7100150 |
| 333 | 2964667546 | 2964663802 | Bacteria | 7019362 |
| 334 | 2964676471 | 2964670856 | Bacteria | 6851364 |
| 335 | 2964684527 | 2964678106 | Bacteria | 6792020 |
| 336 | 2964689442 | 2964685014 | Bacteria | 6839111 |
| 337 | 2964697106 | 2964691889 | Bacteria | 6802758 |
| 338 | 2964703689 | 2964698721 | Bacteria | 6765331 |
| 339 | 2964711979 | 2964705432 | Bacteria | 7114648 |
| 340 | 2964718998 | 2964712639 | Bacteria | 6695970 |
| 341 | 2964720610 | 2964719344 | Bacteria | 7286602 |
| 342 | 2967669835 | 2967664464 | Bacteria | 6948836 |
| 343 | 2967674335 | 2967671571 | Bacteria | 7021409 |
| 344 | 2967679846 | 2967678726 | Bacteria | 7264382 |
| 345 | 2967696433 | 2967693043 | Bacteria | 6804451 |
| 346 | 2967703801 | 2967699805 | Bacteria | 6854538 |
| 347 | 2967709116 | 2967706974 | Bacteria | 7186053 |
| 348 | 2967719656 | 2967714385 | Bacteria | 7000047 |
| 349 | 2967727256 | 2967721400 | Bacteria | 7073753 |
| 350 | 2967741513 | 2967735183 | Bacteria | 6827012 |
| 351 | 2967754182 | 2967748971 | Bacteria | 6733771 |
| 352 | 2967759749 | 2967755722 | Bacteria | 6814706 |
| 353 | 2967766989 | 2967762386 | Bacteria | 6923502 |
| 354 | 2967773364 | 2967769361 | Bacteria | 6587838 |
| 355 | 2967778620 | 2967775926 | Bacteria | 6738189 |
| 356 | 2968021853 | 2968016561 | Bacteria | 7022047 |
| 357 | 2970024020 | 2970019648 | Bacteria | 7072033 |
| 358 | 2970039924 | 2970033650 | Bacteria | 7118744 |
| 359 | 2970047323 | 2970040964 | Bacteria | 6731123 |
| 360 | 2970049915 | 2970047711 | Bacteria | 7088379 |
| 361 | 2970056514 | 2970054988 | Bacteria | 6611507 |
| 362 | 2970066507 | 2970061556 | Bacteria | 7099761 |
| 363 | 2970074185 | 2970068827 | Bacteria | 7123112 |
| 364 | 2970080927 | 2970076120 | Bacteria | 6697332 |
| 365 | 2970087414 | 2970082768 | Bacteria | 6183754 |
| 366 | 2970094100 | 2970088815 | Bacteria | 6933825 |
| 367 | 2970101606 | 2970095765 | Bacteria | 6936963 |
| 368 | 2970106780 | 2970102677 | Bacteria | 6812532 |
| 369 | 2970114760 | 2970109326 | Bacteria | 6863976 |
| 370 | 2970121050 | 2970116247 | Bacteria | 6501857 |
| 371 | 2970132440 | 2970129317 | Bacteria | 6806560 |
| 372 | 2970139394 | 2970136068 | Bacteria | 7207982 |
| 373 | 2970150628 | 2970149975 | Bacteria | 6779706 |
| 374 | 2970158540 | 2970156795 | Bacteria | 7168044 |
| 375 | 2970168812 | 2970164137 | Bacteria | 6861252 |
| 376 | 2970173922 | 2970170962 | Bacteria | 6876229 |
| 377 | 2970179742 | 2970177841 | Bacteria | 6768001 |
| 378 | 2970189683 | 2970184632 | Bacteria | 7054431 |
| 379 | 2970196461 | 2970191845 | Bacteria | 7032787 |
| 380 | 2970474443 | 2970469710 | Bacteria | 6969209 |
| 381 | 2970598744 | 2970593180 | Bacteria | 7073582 |
| 382 | 2977522591 | 2977516862 | Bacteria | 6940108 |
| 383 | 2977528684 | 2977523885 | Bacteria | 6960446 |
| 384 | 2977543924 | 2977537788 | Bacteria | 6929320 |
| 385 | 2977555340 | 2977551784 | Bacteria | 7125765 |
| 386 | 2977561752 | 2977558990 | Bacteria | 6863948 |
| 387 | 2977572122 | 2977565890 | Bacteria | 6901543 |
| 388 | 2977576191 | 2977572785 | Bacteria | 6763888 |
| 389 | 2977584824 | 2977579622 | Bacteria | 6772100 |
| 390 | 2988729019 | 2988728565 | Bacteria | 6124362 |
| 391 | 2996353852 | 2996348954 | Bacteria | 7239054 |
| 392 | 3004280520 | 3004275668 | Bacteria | 7114440 |
| 393 | 643826150 | 643692032 | Bacteria | 6891900 |
| 394 | 648740824 | 648276728 | Bacteria | 6968865 |
| 395 | 8003994008 | 8003992118 | Bacteria | 7266902 |
| 396 | 8049295161 | 8049293176 | Bacteria | 6128433 |
| 397 | SwRhRL2b_contig_581576 | |||
| 398 | JGI25406J46586_10001045 | |||
| 399 | JGI25406J46586_10004550 | |||
| 400 | JGI25404J52841_10000071 | |||
| 401 | Ga0058859_11744552 | |||
| 402 | Ga0065704_10000460 | |||
| 403 | Ga0065712_10081384 | |||
| 404 | Ga0070676_10024920 | |||
| 405 | Ga0070670_100000658 | |||
| 406 | Ga0070677_10023824 | |||
| 407 | Ga0068869_100016719 | |||
| 408 | Ga0068868_100000429 | |||
| 409 | Ga0068868_100021719 | |||
| 410 | Ga0070661_100000062 | |||
| 411 | Ga0070661_100000887 | |||
| 412 | Ga0070675_100000530 | |||
| 413 | Ga0070675_100045163 | |||
| 414 | Ga0070671_100000974 | |||
| 415 | Ga0070671_100025627 | |||
| 416 | Ga0070673_100011889 | |||
| 417 | Ga0070700_100047722 | |||
| 418 | Ga0068867_100007334 | |||
| 419 | Ga0070672_100000444 | |||
| 420 | Ga0070672_100028072 | |||
| 421 | Ga0070665_100113984 | |||
| 422 | Ga0070664_100000035 | |||
| 423 | Ga0070664_100000551 | |||
| 424 | Ga0068857_100066716 | |||
| 425 | Ga0068852_100000789 | |||
| 426 | Ga0068859_100016014 | |||
| 427 | Ga0068864_100010574 | |||
| 428 | Ga0068866_10027060 | |||
| 429 | Ga0068861_100004009 | |||
| 430 | Ga0068851_10019724 | |||
| 431 | Ga0068860_100013487 | |||
| 432 | Ga0068862_100076225 | |||
| 433 | Ga0068862_100078142 | |||
| 434 | Ga0081455_10000039 | |||
| 435 | Ga0081455_10015764 | |||
| 436 | Ga0081455_10020309 | |||
| 437 | Ga0081538_10027194 | |||
| 438 | Ga0081540_1002766 | |||
| 439 | Ga0081540_1003841 | |||
| 440 | Ga0081540_1007998 | |||
| 441 | Ga0081539_10000006 | |||
| 442 | Ga0081539_10001054 | |||
| 443 | Ga0081539_10010706 | |||
| 444 | Ga0075366_10007096 | |||
| 445 | Ga0097621_100000779 | |||
| 446 | Ga0068871_100001096 | |||
| 447 | Ga0075430_100014151 | |||
| 448 | Ga0068865_100001993 | |||
| 449 | Ga0097620_100016014 | |||
| 450 | Ga0079104_1002834 | |||
| 451 | Ga0105244_10000616 | |||
| 452 | Ga0111539_10093687 | |||
| 453 | Ga0105245_10041267 | |||
| 454 | Ga0114129_10120699 | |||
| 455 | Ga0105243_10017753 | |||
| 456 | Ga0105237_10000042 | |||
| 457 | Ga0105246_10047948 | |||
| 458 | Ga0157373_10009869 | |||
| 459 | Ga0157369_10000251 | |||
| 460 | Ga0157374_10002042 | |||
| 461 | Ga0157378_10002224 | |||
| 462 | Ga0157378_10015856 | |||
| 463 | Ga0163162_10022581 | |||
| 464 | Ga0163162_10034202 | |||
| 465 | Ga0157375_10001457 | |||
| 466 | Ga0157375_10027315 | |||
| 467 | Ga0157375_10051064 | |||
| 468 | Ga0157375_10137518 | |||
| 469 | Ga0157380_10016418 | |||
| 470 | Ga0157377_10047434 | |||
| 471 | Ga0157379_10035971 | |||
| 472 | Ga0182006_1000730 | |||
| 473 | Ga0163161_10049956 | |||
| 474 | Ga0214544_1000169 | |||
| 475 | Ga0214542_1000131 | |||
| 476 | Ga0214543_1000028 | |||
| 477 | Ga0214543_1002177 | |||
| 478 | Ga0213876_10005556 | |||
| 479 | Ga0207655_1000070 | |||
| 480 | Ga0207671_10000847 | |||
| 481 | Ga0207649_10000010 | |||
| 482 | Ga0207649_10016632 | |||
| 483 | Ga0207650_10000744 | |||
| 484 | Ga0207650_10091514 | |||
| 485 | Ga0207659_10001754 | |||
| 486 | Ga0207644_10000981 | |||
| 487 | Ga0207644_10034563 | |||
| 488 | Ga0207686_10008553 | |||
| 489 | Ga0207704_10035374 | |||
| 490 | Ga0207691_10000535 | |||
| 491 | Ga0207691_10141298 | |||
| 492 | Ga0207689_10010359 | |||
| 493 | Ga0207661_10020045 | |||
| 494 | Ga0207679_10000022 | |||
| 495 | Ga0207679_10003256 | |||
| 496 | Ga0207651_10076474 | |||
| 497 | Ga0207708_10142658 | |||
| 498 | Ga0207648_10001572 | |||
| 499 | Ga0207648_10004099 | |||
| 500 | Ga0207674_10106593 | |||
| 501 | Ga0207698_10000710 | |||
| 502 | Ga0209281_1000426 | |||
| 503 | Ga0268265_10007276 | |||
| 504 | Ga0268265_10122114 | |||
| 505 | Ga0265334_10023255 | |||
| 506 | Ga0307410_10099530 | |||
| 507 | Ga0307412_10003028 | |||
| 508 | Ga0307409_100102320 | |||
| 509 | Ga0307411_10006185 | |||
| 510 | Ga0395900_0028577 | |||
| 511 | Ga0436364_0134120 | |||
| 512 | Ga0436364_0890864 | |||
| 513 | Ga0436364_1025004 | |||
| 514 | Ga0436365_1218614 | |||
| 515 | Ga0436365_1289272 | |||
| 516 | Ga0439436_0014167 | |||
| 517 | Ga0439438_001045 | |||
| 518 | Ga0439466_0007217 | |||
| 519 | Ga0439452_000124 | |||
| 520 | Ga0439460_0000074 | |||
| 521 | Ga0495627_000009 | |||
| 522 | Ga0495627_000014 | |||
| 523 | Ga0495590_0000898 | |||
| 524 | Ga0495638_0000088 | |||
| 525 | Ga0495583_0001020 | |||
| 526 | Ga0495631_0000457 | |||
| 527 | Ga0495632_0013972 | |||
| 528 | Ga0495632_0015842 | |||
| 529 | Ga0495643_0011715 | |||
| 530 | Ga0495644_0000005 | |||
| 531 | Ga0495654_0000270 | |||
| 532 | Ga0495609_0000079 | |||
| 533 | Ga0495611_0000953 | |||
| 534 | Ga0495661_0000284 | |||
| 535 | Ga0495671_0003763 | |||
| 536 | Ga0495671_0015300 | |||
| 537 | Ga0495649_0000060 | |||
| 538 | Ga0495672_0000687 | |||
| 539 | Ga0495672_0001666 | |||
| 540 | Ga0495672_0004513 | |||
| 541 | Ga0495683_0043418 | |||
| 542 | Ga0495673_0009387 | |||
| 543 | Ga0496109_0070836 | |||
| 544 | Ga0496110_0006320 | |||
| 545 | Ga0496110_0028350 | |||
| 546 | Ga0496111_0018582 | |||
| 547 | Ga0496124_0000276 | |||
| 548 | Ga0496125_0000410 | |||
| 549 | Ga0496126_0000692 | |||
| 550 | Ga0495678_002466 | |||
| 551 | Ga0501042_0016694 | |||
| 552 | Ga0501046_0044093 | |||
| 553 | Ga0501048_0052564 | |||
| 554 | Ga0501074_0029054 | |||
| 555 | Ga0501075_0105575 | |||
| 556 | Ga0501076_0135272 | |||
| 557 | Ga0501222_000145 | |||
| 558 | Ga0501080_0015188 | |||
| 559 | nmdc:mga03683_14516_c1 | |||
| 560 | nmdc:mga05p37_40914_c1 | |||
| 561 | nmdc:mga05p37_75144_c1 | |||
| 562 | nmdc:mga09592_9074_c1 | |||
| 563 | nmdc:mga0qj67_67692_c1 | |||
| 564 | nmdc:mga06r32_107379_c1 | |||
| 565 | nmdc:mga08y16_220343_c1 | |||
| 566 | nmdc:mga08y16_66557_c1 | |||
| 567 | Ga0500573_0000823 | |||
| 568 | Ga0500616_0030701 | |||
| 569 | Ga0530510_0007166 | |||
| 570 | 2551690218 | |||
| 571 | 2509110933 | |||
| 572 | 2509117286 | |||
| 573 | 2509376325 | |||
| 574 | 2509398349 | |||
| 575 | 2510304337 | |||
| 576 | 2511502108 | |||
| 577 | 2512533482 | |||
| 578 | 2513582498 | |||
| 579 | 2513618059 | |||
| 580 | 2513885444 | |||
| 581 | 2513903220 | |||
| 582 | 2515608887 | |||
| 583 | 2516893486 | |||
| 584 | 2524448683 | |||
| 585 | 2551680092 | |||
| 586 | 2551684435 | |||
| 587 | 2551704300 | |||
| 588 | 2551713936 | |||
| 589 | 2551722624 | |||
| 590 | 2551725851 | |||
| 591 | 2551738716 | |||
| 592 | 2551741460 | |||
| 593 | 2558867850 | |||
| 594 | 2621299683 | |||
| 595 | 2644088800 | |||
| 596 | 2644284289 | |||
| 597 | 2644345569 | |||
| 598 | 2644365573 | |||
| 599 | 2657681381 | |||
| 600 | 2692315681 | |||
| 601 | 2738669683 | |||
| 602 | 2738748076 | |||
| 603 | 2738857118 | |||
| 604 | 2753460348 | |||
| 605 | 2792580637 | |||
| 606 | 2792620318 | |||
| 607 | 2792626265 | |||
| 608 | 2792639208 | |||
| 609 | 2804752576 | |||
| 610 | 2808958572 | |||
| 611 | 2817491035 | |||
| 612 | 2825651524 | |||
| 613 | 2847419259 | |||
| 614 | 2848994286 | |||
| 615 | 2850081291 | |||
| 616 | 2855826209 | |||
| 617 | 2855841554 | |||
| 618 | 2855875943 | |||
| 619 | 2856326245 | |||
| 620 | 2858801662 | |||
| 621 | 2869284132 | |||
| 622 | 2874144756 | |||
| 623 | 2878743874 | |||
| 624 | 2888342176 | |||
| 625 | 2896385844 | |||
| 626 | 2913039831 | |||
| 627 | 2913299507 | |||
| 628 | 2915987410 | |||
| 629 | 2915997780 | |||
| 630 | 2916002652 | |||
| 631 | 2916007880 | |||
| 632 | 2916020156 | |||
| 633 | 2916027859 | |||
| 634 | 2916029169 | |||
| 635 | 2916039498 | |||
| 636 | 2916043775 | |||
| 637 | 2916052428 | |||
| 638 | 2916058859 | |||
| 639 | 2916075246 | |||
| 640 | 2916080524 | |||
| 641 | 2920761777 | |||
| 642 | 2921205636 | |||
| 643 | 2921210823 | |||
| 644 | 2921240861 | |||
| 645 | 2921244789 | |||
| 646 | 2921260569 | |||
| 647 | 2921267690 | |||
| 648 | 2921287902 | |||
| 649 | 2921289509 | |||
| 650 | 2921301479 | |||
| 651 | 2924148669 | |||
| 652 | 2924151388 | |||
| 653 | 2924162050 | |||
| 654 | 2924166053 | |||
| 655 | 2924176154 | |||
| 656 | 2924180110 | |||
| 657 | 2924190698 | |||
| 658 | 2924199714 | |||
| 659 | 2924203581 | |||
| 660 | 2924212730 | |||
| 661 | 2924219624 | |||
| 662 | 2924223744 | |||
| 663 | 2924232192 | |||
| 664 | 2924721092 | |||
| 665 | 2924781791 | |||
| 666 | 2937000273 | |||
| 667 | 2937008374 | |||
| 668 | 2937014744 | |||
| 669 | 2937018611 | |||
| 670 | 2937027059 | |||
| 671 | 2937046187 | |||
| 672 | 2937051330 | |||
| 673 | 2937062456 | |||
| 674 | 2937069164 | |||
| 675 | 2937075085 | |||
| 676 | 2937093846 | |||
| 677 | 2937100281 | |||
| 678 | 2937110663 | |||
| 679 | 2937117048 | |||
| 680 | 2937124619 | |||
| 681 | 2937127698 | |||
| 682 | 2937884881 | |||
| 683 | 2937978153 | |||
| 684 | 2957382720 | |||
| 685 | 2957392989 | |||
| 686 | 2957398903 | |||
| 687 | 2957408124 | |||
| 688 | 2957410823 | |||
| 689 | 2957421850 | |||
| 690 | 2957425636 | |||
| 691 | 2957436347 | |||
| 692 | 2957450112 | |||
| 693 | 2957456104 | |||
| 694 | 2957460840 | |||
| 695 | 2957468698 | |||
| 696 | 2957475672 | |||
| 697 | 2957481547 | |||
| 698 | 2957487608 | |||
| 699 | 2957492354 | |||
| 700 | 2957502363 | |||
| 701 | 2957507383 | |||
| 702 | 2958040521 | |||
| 703 | 2958055369 | |||
| 704 | 2958068330 | |||
| 705 | 2958092190 | |||
| 706 | 2958096843 | |||
| 707 | 2958148049 | |||
| 708 | 2960590174 | |||
| 709 | 2960602548 | |||
| 710 | 2960609122 | |||
| 711 | 2960616243 | |||
| 712 | 2960623220 | |||
| 713 | 2960627919 | |||
| 714 | 2960640831 | |||
| 715 | 2960650180 | |||
| 716 | 2960653195 | |||
| 717 | 2960661451 | |||
| 718 | 2960670037 | |||
| 719 | 2960678878 | |||
| 720 | 2960690562 | |||
| 721 | 2964609957 | |||
| 722 | 2964615704 | |||
| 723 | 2964626411 | |||
| 724 | 2964633955 | |||
| 725 | 2964638478 | |||
| 726 | 2964648017 | |||
| 727 | 2964653378 | |||
| 728 | 2964662709 | |||
| 729 | 2964667546 | |||
| 730 | 2964676471 | |||
| 731 | 2964684527 | |||
| 732 | 2964689442 | |||
| 733 | 2964697106 | |||
| 734 | 2964703689 | |||
| 735 | 2964711979 | |||
| 736 | 2964718998 | |||
| 737 | 2964720610 | |||
| 738 | 2967669835 | |||
| 739 | 2967674335 | |||
| 740 | 2967679846 | |||
| 741 | 2967696433 | |||
| 742 | 2967703801 | |||
| 743 | 2967709116 | |||
| 744 | 2967719656 | |||
| 745 | 2967727256 | |||
| 746 | 2967741513 | |||
| 747 | 2967754182 | |||
| 748 | 2967759749 | |||
| 749 | 2967766989 | |||
| 750 | 2967773364 | |||
| 751 | 2967778620 | |||
| 752 | 2968021853 | |||
| 753 | 2970024020 | |||
| 754 | 2970039924 | |||
| 755 | 2970047323 | |||
| 756 | 2970049915 | |||
| 757 | 2970056514 | |||
| 758 | 2970066507 | |||
| 759 | 2970074185 | |||
| 760 | 2970080927 | |||
| 761 | 2970087414 | |||
| 762 | 2970094100 | |||
| 763 | 2970101606 | |||
| 764 | 2970106780 | |||
| 765 | 2970114760 | |||
| 766 | 2970121050 | |||
| 767 | 2970132440 | |||
| 768 | 2970139394 | |||
| 769 | 2970150628 | |||
| 770 | 2970158540 | |||
| 771 | 2970168812 | |||
| 772 | 2970173922 | |||
| 773 | 2970179742 | |||
| 774 | 2970189683 | |||
| 775 | 2970196461 | |||
| 776 | 2970474443 | |||
| 777 | 2970598744 | |||
| 778 | 2977522591 | |||
| 779 | 2977528684 | |||
| 780 | 2977543924 | |||
| 781 | 2977555340 | |||
| 782 | 2977561752 | |||
| 783 | 2977572122 | |||
| 784 | 2977576191 | |||
| 785 | 2977584824 | |||
| 786 | 2988729019 | |||
| 787 | 2996353852 | |||
| 788 | 3004280520 | |||
| 789 | 643826150 | |||
| 790 | 648740824 | |||
| 791 | 8003994008 | |||
| 792 | 8049295161 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wr8-assembly1.cif.gz_A | crystal structure of hypothetical protein ph1421 from pyrococcus horikoshii. | 0.8867 | 3 | 220 |
| 3niw-assembly1.cif.gz_A | crystal structure of a haloacid dehalogenase-like hydrolase from bacteroides thetaiotaomicron | 0.8501 | 3 | 217 |
| 1wr8-assembly1.cif.gz_A | crystal structure of hypothetical protein ph1421 from pyrococcus horikoshii. | 0.84 | 3 | 220 |
| 2b30-assembly2.cif.gz_D | initial crystallographic structural analysis of a putative had/cof-like hydrolase from plasmodium vivax | 0.8315 | 2 | 219 |
| 1kyt-assembly1.cif.gz_A | crystal structure of thermoplasma acidophilum 0175 (apc014) | 0.8194 | 1 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wr8A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9201 | 3 | 220 | 3.40.50.1000 |
| af_A0A0P0VTU7_76_213_1.20.1110.10 | Mainly Alpha;Up-down Bundle;Calcium-transporting ATPase, transmembrane domain;Calcium-transporting ATPase, transmembrane domain | 0.9148 | 166 | 204 | 1.20.1110.10 |
| af_A0A1D6GSK2_41_144_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9039 | 166 | 204 | 3.40.50.1000 |
| 1wr8A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8876 | 3 | 220 | 3.40.50.1000 |
| 3l7yA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8719 | 3 | 219 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535U5B8-F1-model_v4 | HAD family phosphatase | 0.9897 | 1 | 181 |
GO:0000287
GO:0005829 GO:0016791 |
| AF-A0A257XAE7-F1-model_v4 | Haloacid dehalogenase | 0.9825 | 2 | 219 |
GO:0000287
GO:0005829 GO:0016791 |
| AF-K9T061-F1-model_v4 | HAD-superfamily hydrolase, subfamily IIB | 0.9819 | 1 | 219 |
GO:0000287
GO:0005829 GO:0016791 |
| AF-A0A436IM95-F1-model_v4 | deleted | 0.9816 | 1 | 201 |
|
| AF-A0A535U5B8-F1-model_v4 | HAD family phosphatase | 0.9789 | 1 | 181 |
GO:0000287
GO:0005829 GO:0016791 |