F433646
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 396 | 171 | 792 | 151 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221664|2644356055 |
| Length | 179 |
| Sequence | KAAISAGPASPARGAAPRLAPGLPPSLAPSLARRCLLHAAAALPLLALVRPACATPEELRAAIAAYTGGAVPATGKVTFDIAKLIDNGNAVPVTITVDSPMTAAAHVTGIAIFNERNPETDIARFTLGPRSGKAEVSTRIRLATSQKLVAVARLSDGSYWQQAMDVIVALAACIEGEAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 27 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 28 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 29 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 30 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 31 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 37 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 38 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 40 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 41 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 42 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 43 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 44 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 45 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 46 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 48 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 62 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 64 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 65 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 66 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 67 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 68 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 69 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 70 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 71 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 72 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 73 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 74 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 75 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 76 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 77 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 78 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 79 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 80 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 133 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 134 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 136 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 137 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 138 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 139 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 140 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 141 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 142 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 143 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 147 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 148 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 149 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 150 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 151 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 152 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 153 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 154 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 155 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 156 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 157 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 158 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 159 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 160 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 161 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 162 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 163 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 164 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 165 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 166 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 167 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 168 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 169 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 170 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 171 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.96 |
| Metatranscriptomes | 0.25 |
| Isolates | 3.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 30.05 |
| Nodule | 0.76 |
| Rhizoplane | 1.77 |
| Rhizosphere | 58.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000025 | 3300002705 | Bacteria | 136287 |
| 2 | JGI25154J39366_1000045 | 3300002738 | Bacteria | 136302 |
| 3 | JGI25157J39369_1000034 | 3300002741 | Bacteria | 136301 |
| 4 | JGI25150J39212_1011038 | 3300002774 | Bacteria | 1653 |
| 5 | JGI25150J39212_1016409 | 3300002774 | Bacteria | 1216 |
| 6 | JGI25159J45721_1000348 | 3300002987 | Bacteria | 21410 |
| 7 | JGI25159J45721_1009889 | 3300002987 | Bacteria | 2480 |
| 8 | JGI25159J45721_1030755 | 3300002987 | Bacteria | 868 |
| 9 | JGI25151J46595_10011919 | 3300003187 | Bacteria | 3974 |
| 10 | rootH1_10095860 | 3300003316 | Bacteria | 1026 |
| 11 | JGI25160J50197_1000379 | 3300003354 | Bacteria | 29058 |
| 12 | JGI25160J50197_1000400 | 3300003354 | Bacteria | 27971 |
| 13 | JGI25160J50197_1051698 | 3300003354 | Bacteria | 868 |
| 14 | JGI25161J50226_1000222 | 3300003374 | Bacteria | 35113 |
| 15 | JGI25161J50226_1000247 | 3300003374 | Bacteria | 32339 |
| 16 | Ga0055526_1000306 | 3300003771 | Bacteria | 40960 |
| 17 | Ga0055526_1001433 | 3300003771 | Bacteria | 16981 |
| 18 | Ga0055526_1039082 | 3300003771 | Bacteria | 1213 |
| 19 | Ga0055526_1053003 | 3300003771 | Bacteria | 911 |
| 20 | Ga0055537_1000008 | 3300003773 | Bacteria | 142572 |
| 21 | Ga0055537_1000119 | 3300003773 | Bacteria | 59684 |
| 22 | Ga0055537_1017485 | 3300003773 | Bacteria | 1177 |
| 23 | Ga0055537_1023836 | 3300003773 | Bacteria | 869 |
| 24 | Ga0055537_1027546 | 3300003773 | Bacteria | 762 |
| 25 | Ga0055524_1000075 | 3300003775 | Bacteria | 121897 |
| 26 | Ga0055524_1007019 | 3300003775 | Bacteria | 4838 |
| 27 | Ga0055524_1017662 | 3300003775 | Bacteria | 2509 |
| 28 | Ga0055524_1044388 | 3300003775 | Bacteria | 1081 |
| 29 | Ga0055536_1006581 | 3300003781 | Bacteria | 5382 |
| 30 | Ga0055534_1000047 | 3300003784 | Bacteria | 94932 |
| 31 | Ga0055534_1000809 | 3300003784 | Bacteria | 14478 |
| 32 | Ga0055534_1017776 | 3300003784 | Bacteria | 1250 |
| 33 | Ga0055528_1000049 | 3300003790 | Bacteria | 94814 |
| 34 | Ga0055528_1000272 | 3300003790 | Bacteria | 43798 |
| 35 | Ga0055530_10000152 | 3300003791 | Bacteria | 62435 |
| 36 | Ga0055530_10001546 | 3300003791 | Bacteria | 16531 |
| 37 | Ga0055530_10029756 | 3300003791 | Bacteria | 1455 |
| 38 | Ga0055540_1000160 | 3300003792 | Bacteria | 66881 |
| 39 | Ga0055531_10000366 | 3300003794 | Bacteria | 43612 |
| 40 | Ga0055531_10000652 | 3300003794 | Bacteria | 29887 |
| 41 | Ga0055531_10007406 | 3300003794 | Bacteria | 6001 |
| 42 | Ga0055531_10059006 | 3300003794 | Bacteria | 951 |
| 43 | Ga0055543_1000185 | 3300004625 | Bacteria | 50666 |
| 44 | Ga0055543_1000925 | 3300004625 | Bacteria | 13667 |
| 45 | Ga0065165_1000167 | 3300005262 | Bacteria | 115630 |
| 46 | Ga0065165_1001481 | 3300005262 | Bacteria | 24964 |
| 47 | Ga0065165_1017928 | 3300005262 | Bacteria | 2585 |
| 48 | Ga0065165_1033251 | 3300005262 | Bacteria | 1606 |
| 49 | Ga0065165_1046968 | 3300005262 | Bacteria | 1249 |
| 50 | Ga0068869_100793449 | 3300005334 | Bacteria | 813 |
| 51 | Ga0070678_100443635 | 3300005456 | Bacteria | 1135 |
| 52 | Ga0070662_100531911 | 3300005457 | Bacteria | 983 |
| 53 | Ga0068867_100122554 | 3300005459 | Bacteria | 2011 |
| 54 | Ga0068854_100372163 | 3300005578 | Bacteria | 1175 |
| 55 | Ga0068862_100406263 | 3300005844 | Bacteria | 1275 |
| 56 | Ga0075363_100309920 | 3300006048 | Bacteria | 917 |
| 57 | Ga0068871_100254427 | 3300006358 | Bacteria | 1531 |
| 58 | Ga0079104_1065140 | 3300006946 | Bacteria | 776 |
| 59 | Ga0099826_10000048 | 3300006948 | Bacteria | 74895 |
| 60 | Ga0105244_10002531 | 3300009036 | Bacteria | 13730 |
| 61 | Ga0163162_10683708 | 3300013306 | Bacteria | 1149 |
| 62 | Ga0157380_10231923 | 3300014326 | Bacteria | 1659 |
| 63 | Ga0157379_10242792 | 3300014968 | Bacteria | 1634 |
| 64 | Ga0163161_10014363 | 3300017792 | Bacteria | 5512 |
| 65 | Ga0213872_10000981 | 3300021361 | Bacteria | 19948 |
| 66 | Ga0213872_10006546 | 3300021361 | Bacteria | 5827 |
| 67 | Ga0213872_10330837 | 3300021361 | Bacteria | 628 |
| 68 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 69 | Ga0209436_100148 | 3300025208 | Bacteria | 33690 |
| 70 | Ga0209436_104982 | 3300025208 | Bacteria | 3166 |
| 71 | Ga0209436_111930 | 3300025208 | Bacteria | 1500 |
| 72 | Ga0209436_120974 | 3300025208 | Bacteria | 870 |
| 73 | Ga0207425_1000093 | 3300025245 | Bacteria | 87038 |
| 74 | Ga0207425_1001279 | 3300025245 | Bacteria | 10933 |
| 75 | Ga0207425_1009193 | 3300025245 | Bacteria | 2473 |
| 76 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 77 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 78 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 79 | Ga0209129_1000344 | 3300025258 | Bacteria | 39975 |
| 80 | Ga0209129_1008401 | 3300025258 | Bacteria | 2877 |
| 81 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 82 | Ga0209565_1000112 | 3300025263 | Bacteria | 117209 |
| 83 | Ga0209565_1001307 | 3300025263 | Bacteria | 11476 |
| 84 | Ga0209565_1005330 | 3300025263 | Bacteria | 3753 |
| 85 | Ga0209565_1006531 | 3300025263 | Bacteria | 3261 |
| 86 | Ga0209565_1012246 | 3300025263 | Bacteria | 2054 |
| 87 | Ga0209565_1019690 | 3300025263 | Bacteria | 1436 |
| 88 | Ga0209673_1000210 | 3300025273 | Bacteria | 117276 |
| 89 | Ga0209673_1000275 | 3300025273 | Bacteria | 96728 |
| 90 | Ga0209130_1000016 | 3300025284 | Bacteria | 395540 |
| 91 | Ga0209130_1000129 | 3300025284 | Bacteria | 123096 |
| 92 | Ga0209130_1000299 | 3300025284 | Bacteria | 60368 |
| 93 | Ga0209130_1000369 | 3300025284 | Bacteria | 51132 |
| 94 | Ga0209130_1014636 | 3300025284 | Bacteria | 1961 |
| 95 | Ga0209675_1000044 | 3300025291 | Bacteria | 230392 |
| 96 | Ga0209675_1000142 | 3300025291 | Bacteria | 95327 |
| 97 | Ga0209675_1008043 | 3300025291 | Bacteria | 3939 |
| 98 | Ga0209675_1018592 | 3300025291 | Bacteria | 1940 |
| 99 | Ga0209676_1000029 | 3300025292 | Bacteria | 520536 |
| 100 | Ga0209676_1008637 | 3300025292 | Bacteria | 4511 |
| 101 | Ga0209025_1002883 | 3300025294 | Bacteria | 17225 |
| 102 | Ga0209025_1005351 | 3300025294 | Bacteria | 10521 |
| 103 | Ga0209564_1000042 | 3300025295 | Bacteria | 392805 |
| 104 | Ga0209564_1000245 | 3300025295 | Bacteria | 117378 |
| 105 | Ga0209564_1000356 | 3300025295 | Bacteria | 85562 |
| 106 | Ga0209564_1000448 | 3300025295 | Bacteria | 70600 |
| 107 | Ga0209564_1009484 | 3300025295 | Bacteria | 4625 |
| 108 | Ga0209564_1014928 | 3300025295 | Bacteria | 3196 |
| 109 | Ga0209564_1021137 | 3300025295 | Bacteria | 2354 |
| 110 | Ga0209564_1036838 | 3300025295 | Bacteria | 1388 |
| 111 | Ga0209758_1063563 | 3300025297 | Bacteria | 1201 |
| 112 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 113 | Ga0209050_1000086 | 3300025298 | Bacteria | 262009 |
| 114 | Ga0209050_1000211 | 3300025298 | Bacteria | 129614 |
| 115 | Ga0209050_1001147 | 3300025298 | Bacteria | 31733 |
| 116 | Ga0209050_1002834 | 3300025298 | Bacteria | 13772 |
| 117 | Ga0209050_1006363 | 3300025298 | Bacteria | 7017 |
| 118 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 119 | Ga0209256_1000252 | 3300025299 | Bacteria | 94936 |
| 120 | Ga0209256_1000268 | 3300025299 | Bacteria | 91897 |
| 121 | Ga0209256_1000929 | 3300025299 | Bacteria | 35648 |
| 122 | Ga0209256_1002063 | 3300025299 | Bacteria | 17738 |
| 123 | Ga0209256_1023696 | 3300025299 | Bacteria | 1824 |
| 124 | Ga0209256_1050700 | 3300025299 | Bacteria | 1005 |
| 125 | Ga0207426_1000071 | 3300025302 | Bacteria | 329539 |
| 126 | Ga0207426_1004111 | 3300025302 | Bacteria | 7313 |
| 127 | Ga0207426_1004151 | 3300025302 | Bacteria | 7255 |
| 128 | Ga0207426_1026693 | 3300025302 | Bacteria | 1931 |
| 129 | Ga0207426_1086941 | 3300025302 | Bacteria | 835 |
| 130 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 131 | Ga0209051_1028385 | 3300025303 | Bacteria | 2211 |
| 132 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 133 | Ga0209257_1000087 | 3300025304 | Bacteria | 282503 |
| 134 | Ga0209257_1001799 | 3300025304 | Bacteria | 23534 |
| 135 | Ga0209257_1016115 | 3300025304 | Bacteria | 3048 |
| 136 | Ga0207655_1004090 | 3300025728 | Bacteria | 10499 |
| 137 | Ga0207669_10142221 | 3300025937 | Bacteria | 1667 |
| 138 | Ga0207648_10070558 | 3300026089 | Bacteria | 3046 |
| 139 | Ga0207683_10243188 | 3300026121 | Bacteria | 1642 |
| 140 | Ga0209282_1000066 | 3300027666 | Bacteria | 87072 |
| 141 | Ga0268265_10447315 | 3300028380 | Bacteria | 1206 |
| 142 | Ga0307515_10228770 | 3300028794 | Bacteria | 1658 |
| 143 | Ga0307515_10439350 | 3300028794 | Bacteria | 922 |
| 144 | Ga0316177_1159406 | 3300030731 | Bacteria | 2709 |
| 145 | Ga0316180_1051715 | 3300030736 | Bacteria | 1718 |
| 146 | Ga0316181_1067271 | 3300030744 | Bacteria | 2972 |
| 147 | Ga0307513_10000006 | 3300031456 | Bacteria | 470848 |
| 148 | Ga0307513_10000014 | 3300031456 | Bacteria | 303157 |
| 149 | Ga0307408_100000106 | 3300031548 | Bacteria | 91438 |
| 150 | Ga0307408_100000289 | 3300031548 | Bacteria | 49603 |
| 151 | Ga0307408_100000326 | 3300031548 | Bacteria | 45638 |
| 152 | Ga0307408_100011010 | 3300031548 | Bacteria | 5968 |
| 153 | Ga0307408_100058417 | 3300031548 | Bacteria | 2804 |
| 154 | Ga0307516_10117227 | 3300031730 | Bacteria | 2457 |
| 155 | Ga0307405_10893210 | 3300031731 | Bacteria | 751 |
| 156 | Ga0307412_10443772 | 3300031911 | Bacteria | 1067 |
| 157 | Ga0307412_11762183 | 3300031911 | Bacteria | 569 |
| 158 | Ga0307416_100020241 | 3300032002 | Bacteria | 4742 |
| 159 | Ga0373939_0132434 | 3300035114 | Bacteria | 891 |
| 160 | Ga0436361_0324047 | 3300039447 | Bacteria | 25390 |
| 161 | Ga0436361_0470245 | 3300039447 | Bacteria | 1406 |
| 162 | Ga0436361_1158315 | 3300039447 | Bacteria | 8002 |
| 163 | Ga0451791_0185433 | 3300041451 | Bacteria | 585 |
| 164 | Ga0451839_0707710 | 3300041496 | Bacteria | 613 |
| 165 | Ga0451853_0244838 | 3300041512 | Bacteria | 958 |
| 166 | Ga0451853_1391320 | 3300041512 | Bacteria | 1554 |
| 167 | Ga0451577_0253127 | 3300042876 | Bacteria | 1594 |
| 168 | Ga0453684_0873213 | 3300044712 | Bacteria | 965 |
| 169 | Ga0495617_002298 | 3300046452 | Bacteria | 7715 |
| 170 | Ga0495617_002348 | 3300046452 | Bacteria | 7579 |
| 171 | Ga0495617_009698 | 3300046452 | Bacteria | 3303 |
| 172 | Ga0495617_025256 | 3300046452 | Bacteria | 2003 |
| 173 | Ga0495590_0000056 | 3300046457 | Bacteria | 96913 |
| 174 | Ga0495590_0011115 | 3300046457 | Bacteria | 3373 |
| 175 | Ga0495638_0000170 | 3300046460 | Bacteria | 101629 |
| 176 | Ga0495638_0006602 | 3300046460 | Bacteria | 8430 |
| 177 | Ga0495638_0018858 | 3300046460 | Bacteria | 4574 |
| 178 | Ga0495638_0239732 | 3300046460 | Bacteria | 1005 |
| 179 | Ga0495638_0340005 | 3300046460 | Bacteria | 796 |
| 180 | Ga0495653_0000066 | 3300046463 | Bacteria | 91671 |
| 181 | Ga0495650_0000553 | 3300046471 | Bacteria | 53302 |
| 182 | Ga0495650_0001888 | 3300046471 | Bacteria | 18636 |
| 183 | Ga0495650_0003450 | 3300046471 | Bacteria | 11527 |
| 184 | Ga0495650_0026921 | 3300046471 | Bacteria | 2665 |
| 185 | Ga0495650_0065614 | 3300046471 | Bacteria | 1440 |
| 186 | Ga0495605_0000315 | 3300046474 | Bacteria | 50714 |
| 187 | Ga0495605_0006948 | 3300046474 | Bacteria | 6463 |
| 188 | Ga0495639_0020556 | 3300046475 | Bacteria | 2885 |
| 189 | Ga0495584_0000365 | 3300046491 | Bacteria | 31489 |
| 190 | Ga0495584_0001822 | 3300046491 | Bacteria | 12380 |
| 191 | Ga0495585_0000646 | 3300046492 | Bacteria | 32025 |
| 192 | Ga0495585_0027344 | 3300046492 | Bacteria | 3255 |
| 193 | Ga0495585_0036737 | 3300046492 | Bacteria | 2760 |
| 194 | Ga0495585_0089739 | 3300046492 | Bacteria | 1656 |
| 195 | Ga0495585_0118033 | 3300046492 | Bacteria | 1405 |
| 196 | Ga0495594_0047325 | 3300046499 | Bacteria | 2362 |
| 197 | Ga0495596_0002901 | 3300046500 | Bacteria | 8917 |
| 198 | Ga0495607_0001697 | 3300046501 | Bacteria | 18946 |
| 199 | Ga0495607_0014081 | 3300046501 | Bacteria | 5220 |
| 200 | Ga0495607_0022969 | 3300046501 | Bacteria | 3909 |
| 201 | Ga0495607_0031611 | 3300046501 | Bacteria | 3239 |
| 202 | Ga0495607_0068419 | 3300046501 | Bacteria | 1991 |
| 203 | Ga0495607_0145084 | 3300046501 | Bacteria | 1220 |
| 204 | Ga0495607_0242291 | 3300046501 | Unclassified | 872 |
| 205 | Ga0495607_0389714 | 3300046501 | Bacteria | 636 |
| 206 | Ga0495583_0000417 | 3300046506 | Bacteria | 64786 |
| 207 | Ga0495583_0003284 | 3300046506 | Bacteria | 12546 |
| 208 | Ga0495583_0037555 | 3300046506 | Bacteria | 2295 |
| 209 | Ga0495606_0000063 | 3300046507 | Bacteria | 184610 |
| 210 | Ga0495606_0000431 | 3300046507 | Bacteria | 69714 |
| 211 | Ga0495606_0001347 | 3300046507 | Bacteria | 33360 |
| 212 | Ga0495606_0003374 | 3300046507 | Bacteria | 16993 |
| 213 | Ga0495606_0004107 | 3300046507 | Bacteria | 14789 |
| 214 | Ga0495606_0008520 | 3300046507 | Bacteria | 8892 |
| 215 | Ga0495606_0151700 | 3300046507 | Bacteria | 1359 |
| 216 | Ga0495606_0422276 | 3300046507 | Bacteria | 689 |
| 217 | Ga0495610_0000014 | 3300046512 | Bacteria | 444708 |
| 218 | Ga0495610_0000353 | 3300046512 | Bacteria | 48216 |
| 219 | Ga0495610_0001670 | 3300046512 | Bacteria | 19517 |
| 220 | Ga0495610_0005618 | 3300046512 | Bacteria | 8852 |
| 221 | Ga0495610_0009648 | 3300046512 | Bacteria | 6077 |
| 222 | Ga0495610_0043076 | 3300046512 | Bacteria | 2252 |
| 223 | Ga0495616_0004391 | 3300046513 | Bacteria | 8897 |
| 224 | Ga0495616_0011359 | 3300046513 | Bacteria | 5108 |
| 225 | Ga0495631_0040983 | 3300046518 | Bacteria | 2050 |
| 226 | Ga0495637_0000150 | 3300046520 | Bacteria | 53429 |
| 227 | Ga0495637_0006039 | 3300046520 | Bacteria | 6115 |
| 228 | Ga0495643_0000246 | 3300046522 | Bacteria | 80483 |
| 229 | Ga0495643_0000302 | 3300046522 | Bacteria | 68932 |
| 230 | Ga0495643_0235310 | 3300046522 | Bacteria | 862 |
| 231 | Ga0495643_0369349 | 3300046522 | Bacteria | 638 |
| 232 | Ga0495644_0000451 | 3300046523 | Bacteria | 18007 |
| 233 | Ga0495644_0000622 | 3300046523 | Bacteria | 14853 |
| 234 | Ga0495648_0000119 | 3300046524 | Bacteria | 95682 |
| 235 | Ga0495648_0000240 | 3300046524 | Bacteria | 62286 |
| 236 | Ga0495648_0000486 | 3300046524 | Bacteria | 42701 |
| 237 | Ga0495648_0003471 | 3300046524 | Bacteria | 13857 |
| 238 | Ga0495648_0013106 | 3300046524 | Bacteria | 6146 |
| 239 | Ga0495648_0094281 | 3300046524 | Bacteria | 1667 |
| 240 | Ga0495642_0001364 | 3300046528 | Bacteria | 10919 |
| 241 | Ga0495642_0194277 | 3300046528 | Bacteria | 884 |
| 242 | Ga0495642_0403013 | 3300046528 | Bacteria | 603 |
| 243 | Ga0495654_0000014 | 3300046530 | Bacteria | 312126 |
| 244 | Ga0495654_0006366 | 3300046530 | Bacteria | 6713 |
| 245 | Ga0495654_0006588 | 3300046530 | Bacteria | 6576 |
| 246 | Ga0495609_0000816 | 3300046538 | Bacteria | 23247 |
| 247 | Ga0495609_0001962 | 3300046538 | Bacteria | 13050 |
| 248 | Ga0495609_0003738 | 3300046538 | Bacteria | 8596 |
| 249 | Ga0495609_0014881 | 3300046538 | Bacteria | 3650 |
| 250 | Ga0495609_0023045 | 3300046538 | Bacteria | 2863 |
| 251 | Ga0495597_0000069 | 3300046542 | Bacteria | 89990 |
| 252 | Ga0495597_0000123 | 3300046542 | Bacteria | 70236 |
| 253 | Ga0495597_0002767 | 3300046542 | Bacteria | 10803 |
| 254 | Ga0495597_0012964 | 3300046542 | Bacteria | 4003 |
| 255 | Ga0495622_0000109 | 3300046557 | Bacteria | 71936 |
| 256 | Ga0495622_0000246 | 3300046557 | Bacteria | 42141 |
| 257 | Ga0495622_0189670 | 3300046557 | Bacteria | 919 |
| 258 | Ga0495633_0000088 | 3300046558 | Bacteria | 124193 |
| 259 | Ga0495633_0000131 | 3300046558 | Bacteria | 100408 |
| 260 | Ga0495633_0005902 | 3300046558 | Bacteria | 7365 |
| 261 | Ga0495633_0008968 | 3300046558 | Bacteria | 5570 |
| 262 | Ga0495633_0012055 | 3300046558 | Bacteria | 4618 |
| 263 | Ga0495633_0013013 | 3300046558 | Bacteria | 4402 |
| 264 | Ga0495633_0017386 | 3300046558 | Bacteria | 3679 |
| 265 | Ga0495633_0115375 | 3300046558 | Bacteria | 1244 |
| 266 | Ga0495633_0468835 | 3300046558 | Bacteria | 568 |
| 267 | Ga0495656_0006949 | 3300046615 | Bacteria | 3981 |
| 268 | Ga0495656_0023540 | 3300046615 | Bacteria | 2424 |
| 269 | Ga0495656_0248698 | 3300046615 | Bacteria | 897 |
| 270 | Ga0495668_0000152 | 3300046616 | Bacteria | 104716 |
| 271 | Ga0495668_0000188 | 3300046616 | Bacteria | 92177 |
| 272 | Ga0495668_0000574 | 3300046616 | Bacteria | 45013 |
| 273 | Ga0495668_0000636 | 3300046616 | Bacteria | 42184 |
| 274 | Ga0495668_0027065 | 3300046616 | Bacteria | 3249 |
| 275 | Ga0495668_0151915 | 3300046616 | Bacteria | 1268 |
| 276 | Ga0495611_0004697 | 3300046648 | Bacteria | 5865 |
| 277 | Ga0495611_0004729 | 3300046648 | Bacteria | 5847 |
| 278 | Ga0495611_0028671 | 3300046648 | Bacteria | 2439 |
| 279 | Ga0495625_0000386 | 3300046660 | Bacteria | 67356 |
| 280 | Ga0495625_0004123 | 3300046660 | Bacteria | 13868 |
| 281 | Ga0495625_0010047 | 3300046660 | Bacteria | 7865 |
| 282 | Ga0495625_0065999 | 3300046660 | Bacteria | 2550 |
| 283 | Ga0495625_0066294 | 3300046660 | Bacteria | 2543 |
| 284 | Ga0495625_0122456 | 3300046660 | Bacteria | 1768 |
| 285 | Ga0495625_0216235 | 3300046660 | Bacteria | 1258 |
| 286 | Ga0495659_0000026 | 3300046664 | Bacteria | 69038 |
| 287 | Ga0495659_0000364 | 3300046664 | Bacteria | 17652 |
| 288 | Ga0495661_0044139 | 3300046665 | Bacteria | 2735 |
| 289 | Ga0495661_0054321 | 3300046665 | Bacteria | 2405 |
| 290 | Ga0495661_0078641 | 3300046665 | Bacteria | 1907 |
| 291 | Ga0495661_0105039 | 3300046665 | Bacteria | 1583 |
| 292 | Ga0495661_0197919 | 3300046665 | Bacteria | 1054 |
| 293 | Ga0495669_0060196 | 3300046684 | Bacteria | 1716 |
| 294 | Ga0495670_0001843 | 3300046691 | Bacteria | 10427 |
| 295 | Ga0495670_0009901 | 3300046691 | Bacteria | 4686 |
| 296 | Ga0495671_0000005 | 3300046692 | Bacteria | 509397 |
| 297 | Ga0495671_0000144 | 3300046692 | Bacteria | 63224 |
| 298 | Ga0495671_0003189 | 3300046692 | Bacteria | 10190 |
| 299 | Ga0495671_0007388 | 3300046692 | Bacteria | 6270 |
| 300 | Ga0495671_0019087 | 3300046692 | Bacteria | 3628 |
| 301 | Ga0495671_0053365 | 3300046692 | Bacteria | 2006 |
| 302 | Ga0495649_0000600 | 3300046694 | Bacteria | 30004 |
| 303 | Ga0495649_0011122 | 3300046694 | Bacteria | 5296 |
| 304 | Ga0495649_0016777 | 3300046694 | Bacteria | 4147 |
| 305 | Ga0495649_0045495 | 3300046694 | Bacteria | 2393 |
| 306 | Ga0495649_0137334 | 3300046694 | Bacteria | 1288 |
| 307 | Ga0495589_0193612 | 3300046794 | Bacteria | 961 |
| 308 | Ga0495660_0000229 | 3300046810 | Bacteria | 55150 |
| 309 | Ga0495660_0000962 | 3300046810 | Bacteria | 21017 |
| 310 | Ga0495660_0007303 | 3300046810 | Bacteria | 6495 |
| 311 | Ga0495660_0399723 | 3300046810 | Bacteria | 602 |
| 312 | Ga0495636_0000861 | 3300047318 | Bacteria | 11216 |
| 313 | Ga0495636_0140506 | 3300047318 | Bacteria | 1078 |
| 314 | Ga0495672_0000232 | 3300047320 | Bacteria | 79561 |
| 315 | Ga0495672_0000260 | 3300047320 | Bacteria | 73347 |
| 316 | Ga0495672_0002347 | 3300047320 | Bacteria | 17504 |
| 317 | Ga0495672_0004556 | 3300047320 | Bacteria | 11276 |
| 318 | Ga0495683_0002158 | 3300047323 | Bacteria | 12082 |
| 319 | Ga0495683_0003420 | 3300047323 | Bacteria | 9263 |
| 320 | Ga0495683_0189136 | 3300047323 | Bacteria | 935 |
| 321 | Ga0495687_000629 | 3300047443 | Bacteria | 40470 |
| 322 | Ga0495687_003552 | 3300047443 | Bacteria | 11207 |
| 323 | Ga0495687_003553 | 3300047443 | Bacteria | 11205 |
| 324 | Ga0495687_031070 | 3300047443 | Bacteria | 2453 |
| 325 | Ga0495687_047192 | 3300047443 | Bacteria | 1854 |
| 326 | Ga0495677_0003543 | 3300047445 | Bacteria | 6056 |
| 327 | Ga0495677_0010891 | 3300047445 | Bacteria | 3332 |
| 328 | Ga0495677_0031753 | 3300047445 | Bacteria | 1922 |
| 329 | Ga0495677_0050566 | 3300047445 | Bacteria | 1529 |
| 330 | Ga0495679_021392 | 3300047446 | Bacteria | 2234 |
| 331 | Ga0495685_000147 | 3300047447 | Bacteria | 24129 |
| 332 | Ga0495685_014082 | 3300047447 | Bacteria | 2714 |
| 333 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 334 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 335 | Ga0495673_0000146 | 3300047469 | Bacteria | 127378 |
| 336 | Ga0495673_0013580 | 3300047469 | Bacteria | 4272 |
| 337 | Ga0495673_0062229 | 3300047469 | Bacteria | 1595 |
| 338 | Ga0495673_0273710 | 3300047469 | Bacteria | 611 |
| 339 | Ga0495681_0028587 | 3300047470 | Bacteria | 2866 |
| 340 | Ga0495681_0068982 | 3300047470 | Bacteria | 1607 |
| 341 | Ga0495681_0202504 | 3300047470 | Bacteria | 804 |
| 342 | Ga0495686_0002750 | 3300047472 | Bacteria | 16073 |
| 343 | Ga0495686_0005943 | 3300047472 | Bacteria | 9496 |
| 344 | Ga0495686_0032478 | 3300047472 | Bacteria | 3378 |
| 345 | Ga0495686_0058995 | 3300047472 | Bacteria | 2391 |
| 346 | Ga0495615_0001327 | 3300048090 | Bacteria | 3631 |
| 347 | Ga0495626_0093521 | 3300048091 | Bacteria | 1319 |
| 348 | Ga0496100_0450680 | 3300048903 | Unclassified | 986 |
| 349 | Ga0496103_0001127 | 3300048906 | Bacteria | 18573 |
| 350 | Ga0496107_0883337 | 3300048910 | Bacteria | 652 |
| 351 | Ga0496109_1002587 | 3300048912 | Bacteria | 773 |
| 352 | Ga0496111_1054109 | 3300048914 | Bacteria | 581 |
| 353 | Ga0496114_0162557 | 3300048917 | Bacteria | 1942 |
| 354 | Ga0496119_0139778 | 3300048922 | Bacteria | 1309 |
| 355 | Ga0496121_0227366 | 3300048924 | Bacteria | 1309 |
| 356 | Ga0496122_0069316 | 3300048925 | Bacteria | 2526 |
| 357 | Ga0496123_0008272 | 3300048926 | Bacteria | 9587 |
| 358 | Ga0496124_0156391 | 3300048927 | Bacteria | 1782 |
| 359 | Ga0496126_0043656 | 3300048929 | Bacteria | 4133 |
| 360 | Ga0495678_000278 | 3300049459 | Bacteria | 56511 |
| 361 | Ga0495678_004335 | 3300049459 | Bacteria | 8261 |
| 362 | Ga0495678_022953 | 3300049459 | Bacteria | 2720 |
| 363 | Ga0495678_023903 | 3300049459 | Bacteria | 2647 |
| 364 | Ga0495678_107438 | 3300049459 | Bacteria | 957 |
| 365 | Ga0495682_0000515 | 3300049460 | Bacteria | 26766 |
| 366 | Ga0495682_0000614 | 3300049460 | Bacteria | 23998 |
| 367 | Ga0495682_0129548 | 3300049460 | Bacteria | 902 |
| 368 | Ga0501315_073780 | 3300049531 | Bacteria | 570 |
| 369 | Ga0501227_067565 | 3300049665 | Bacteria | 924 |
| 370 | Ga0501249_010931 | 3300049679 | Bacteria | 1902 |
| 371 | Ga0501269_001658 | 3300049766 | Bacteria | 2847 |
| 372 | Ga0501279_025529 | 3300049775 | Bacteria | 859 |
| 373 | Ga0500644_0001775 | 3300053088 | Bacteria | 5580 |
| 374 | Ga0500593_001823 | 3300053117 | Bacteria | 7657 |
| 375 | Ga0500594_0203563 | 3300053118 | Bacteria | 651 |
| 376 | Ga0500618_001265 | 3300053125 | Bacteria | 11758 |
| 377 | Ga0500586_012053 | 3300053145 | Bacteria | 2501 |
| 378 | Ga0500645_000631 | 3300053730 | Bacteria | 22397 |
| 379 | Ga0500645_001912 | 3300053730 | Bacteria | 9900 |
| 380 | Ga0500645_064946 | 3300053730 | Bacteria | 1052 |
| 381 | Ga0500661_004900 | 3300055283 | Bacteria | 2504 |
| 382 | 2644356055 | 2643221664 | Bacteria | 7272945 |
| 383 | 2511242713 | 2511231002 | Bacteria | 5042903 |
| 384 | 2644031337 | 2643221603 | Bacteria | 6147767 |
| 385 | 2644250423 | 2643221645 | Bacteria | 7207331 |
| 386 | 2738742612 | 2738541280 | Bacteria | 6630198 |
| 387 | 2738826064 | 2738541297 | Bacteria | 6549566 |
| 388 | 2738842384 | 2738541300 | Bacteria | 6675882 |
| 389 | 2739149861 | 2738541357 | Bacteria | 6549408 |
| 390 | 2739191780 | 2738543003 | Bacteria | 6549560 |
| 391 | 2739273131 | 2738543018 | Bacteria | 6718814 |
| 392 | 2739318257 | 2738543026 | Bacteria | 6549408 |
| 393 | 2739336498 | 2738543029 | Bacteria | 6549249 |
| 394 | 2739342175 | 2738543030 | Bacteria | 6719714 |
| 395 | 2821136404 | 2821131069 | Bacteria | 6108407 |
| 396 | 2904428484 | 2904424332 | Bacteria | 7633521 |
| 397 | JGI25156J39149_1000025 | |||
| 398 | JGI25154J39366_1000045 | |||
| 399 | JGI25157J39369_1000034 | |||
| 400 | JGI25150J39212_1011038 | |||
| 401 | JGI25150J39212_1016409 | |||
| 402 | JGI25159J45721_1000348 | |||
| 403 | JGI25159J45721_1009889 | |||
| 404 | JGI25159J45721_1030755 | |||
| 405 | JGI25151J46595_10011919 | |||
| 406 | rootH1_10095860 | |||
| 407 | JGI25160J50197_1000379 | |||
| 408 | JGI25160J50197_1000400 | |||
| 409 | JGI25160J50197_1051698 | |||
| 410 | JGI25161J50226_1000222 | |||
| 411 | JGI25161J50226_1000247 | |||
| 412 | Ga0055526_1000306 | |||
| 413 | Ga0055526_1001433 | |||
| 414 | Ga0055526_1039082 | |||
| 415 | Ga0055526_1053003 | |||
| 416 | Ga0055537_1000008 | |||
| 417 | Ga0055537_1000119 | |||
| 418 | Ga0055537_1017485 | |||
| 419 | Ga0055537_1023836 | |||
| 420 | Ga0055537_1027546 | |||
| 421 | Ga0055524_1000075 | |||
| 422 | Ga0055524_1007019 | |||
| 423 | Ga0055524_1017662 | |||
| 424 | Ga0055524_1044388 | |||
| 425 | Ga0055536_1006581 | |||
| 426 | Ga0055534_1000047 | |||
| 427 | Ga0055534_1000809 | |||
| 428 | Ga0055534_1017776 | |||
| 429 | Ga0055528_1000049 | |||
| 430 | Ga0055528_1000272 | |||
| 431 | Ga0055530_10000152 | |||
| 432 | Ga0055530_10001546 | |||
| 433 | Ga0055530_10029756 | |||
| 434 | Ga0055540_1000160 | |||
| 435 | Ga0055531_10000366 | |||
| 436 | Ga0055531_10000652 | |||
| 437 | Ga0055531_10007406 | |||
| 438 | Ga0055531_10059006 | |||
| 439 | Ga0055543_1000185 | |||
| 440 | Ga0055543_1000925 | |||
| 441 | Ga0065165_1000167 | |||
| 442 | Ga0065165_1001481 | |||
| 443 | Ga0065165_1017928 | |||
| 444 | Ga0065165_1033251 | |||
| 445 | Ga0065165_1046968 | |||
| 446 | Ga0068869_100793449 | |||
| 447 | Ga0070678_100443635 | |||
| 448 | Ga0070662_100531911 | |||
| 449 | Ga0068867_100122554 | |||
| 450 | Ga0068854_100372163 | |||
| 451 | Ga0068862_100406263 | |||
| 452 | Ga0075363_100309920 | |||
| 453 | Ga0068871_100254427 | |||
| 454 | Ga0079104_1065140 | |||
| 455 | Ga0099826_10000048 | |||
| 456 | Ga0105244_10002531 | |||
| 457 | Ga0163162_10683708 | |||
| 458 | Ga0157380_10231923 | |||
| 459 | Ga0157379_10242792 | |||
| 460 | Ga0163161_10014363 | |||
| 461 | Ga0213872_10000981 | |||
| 462 | Ga0213872_10006546 | |||
| 463 | Ga0213872_10330837 | |||
| 464 | Ga0209435_100001 | |||
| 465 | Ga0209436_100148 | |||
| 466 | Ga0209436_104982 | |||
| 467 | Ga0209436_111930 | |||
| 468 | Ga0209436_120974 | |||
| 469 | Ga0207425_1000093 | |||
| 470 | Ga0207425_1001279 | |||
| 471 | Ga0207425_1009193 | |||
| 472 | Ga0209646_1000001 | |||
| 473 | Ga0209026_1000003 | |||
| 474 | Ga0209759_1000001 | |||
| 475 | Ga0209129_1000344 | |||
| 476 | Ga0209129_1008401 | |||
| 477 | Ga0209565_1000004 | |||
| 478 | Ga0209565_1000112 | |||
| 479 | Ga0209565_1001307 | |||
| 480 | Ga0209565_1005330 | |||
| 481 | Ga0209565_1006531 | |||
| 482 | Ga0209565_1012246 | |||
| 483 | Ga0209565_1019690 | |||
| 484 | Ga0209673_1000210 | |||
| 485 | Ga0209673_1000275 | |||
| 486 | Ga0209130_1000016 | |||
| 487 | Ga0209130_1000129 | |||
| 488 | Ga0209130_1000299 | |||
| 489 | Ga0209130_1000369 | |||
| 490 | Ga0209130_1014636 | |||
| 491 | Ga0209675_1000044 | |||
| 492 | Ga0209675_1000142 | |||
| 493 | Ga0209675_1008043 | |||
| 494 | Ga0209675_1018592 | |||
| 495 | Ga0209676_1000029 | |||
| 496 | Ga0209676_1008637 | |||
| 497 | Ga0209025_1002883 | |||
| 498 | Ga0209025_1005351 | |||
| 499 | Ga0209564_1000042 | |||
| 500 | Ga0209564_1000245 | |||
| 501 | Ga0209564_1000356 | |||
| 502 | Ga0209564_1000448 | |||
| 503 | Ga0209564_1009484 | |||
| 504 | Ga0209564_1014928 | |||
| 505 | Ga0209564_1021137 | |||
| 506 | Ga0209564_1036838 | |||
| 507 | Ga0209758_1063563 | |||
| 508 | Ga0209050_1000003 | |||
| 509 | Ga0209050_1000086 | |||
| 510 | Ga0209050_1000211 | |||
| 511 | Ga0209050_1001147 | |||
| 512 | Ga0209050_1002834 | |||
| 513 | Ga0209050_1006363 | |||
| 514 | Ga0209256_1000001 | |||
| 515 | Ga0209256_1000252 | |||
| 516 | Ga0209256_1000268 | |||
| 517 | Ga0209256_1000929 | |||
| 518 | Ga0209256_1002063 | |||
| 519 | Ga0209256_1023696 | |||
| 520 | Ga0209256_1050700 | |||
| 521 | Ga0207426_1000071 | |||
| 522 | Ga0207426_1004111 | |||
| 523 | Ga0207426_1004151 | |||
| 524 | Ga0207426_1026693 | |||
| 525 | Ga0207426_1086941 | |||
| 526 | Ga0209051_1000003 | |||
| 527 | Ga0209051_1028385 | |||
| 528 | Ga0209257_1000018 | |||
| 529 | Ga0209257_1000087 | |||
| 530 | Ga0209257_1001799 | |||
| 531 | Ga0209257_1016115 | |||
| 532 | Ga0207655_1004090 | |||
| 533 | Ga0207669_10142221 | |||
| 534 | Ga0207648_10070558 | |||
| 535 | Ga0207683_10243188 | |||
| 536 | Ga0209282_1000066 | |||
| 537 | Ga0268265_10447315 | |||
| 538 | Ga0307515_10228770 | |||
| 539 | Ga0307515_10439350 | |||
| 540 | Ga0316177_1159406 | |||
| 541 | Ga0316180_1051715 | |||
| 542 | Ga0316181_1067271 | |||
| 543 | Ga0307513_10000006 | |||
| 544 | Ga0307513_10000014 | |||
| 545 | Ga0307408_100000106 | |||
| 546 | Ga0307408_100000289 | |||
| 547 | Ga0307408_100000326 | |||
| 548 | Ga0307408_100011010 | |||
| 549 | Ga0307408_100058417 | |||
| 550 | Ga0307516_10117227 | |||
| 551 | Ga0307405_10893210 | |||
| 552 | Ga0307412_10443772 | |||
| 553 | Ga0307412_11762183 | |||
| 554 | Ga0307416_100020241 | |||
| 555 | Ga0373939_0132434 | |||
| 556 | Ga0436361_0324047 | |||
| 557 | Ga0436361_0470245 | |||
| 558 | Ga0436361_1158315 | |||
| 559 | Ga0451791_0185433 | |||
| 560 | Ga0451839_0707710 | |||
| 561 | Ga0451853_0244838 | |||
| 562 | Ga0451853_1391320 | |||
| 563 | Ga0451577_0253127 | |||
| 564 | Ga0453684_0873213 | |||
| 565 | Ga0495617_002298 | |||
| 566 | Ga0495617_002348 | |||
| 567 | Ga0495617_009698 | |||
| 568 | Ga0495617_025256 | |||
| 569 | Ga0495590_0000056 | |||
| 570 | Ga0495590_0011115 | |||
| 571 | Ga0495638_0000170 | |||
| 572 | Ga0495638_0006602 | |||
| 573 | Ga0495638_0018858 | |||
| 574 | Ga0495638_0239732 | |||
| 575 | Ga0495638_0340005 | |||
| 576 | Ga0495653_0000066 | |||
| 577 | Ga0495650_0000553 | |||
| 578 | Ga0495650_0001888 | |||
| 579 | Ga0495650_0003450 | |||
| 580 | Ga0495650_0026921 | |||
| 581 | Ga0495650_0065614 | |||
| 582 | Ga0495605_0000315 | |||
| 583 | Ga0495605_0006948 | |||
| 584 | Ga0495639_0020556 | |||
| 585 | Ga0495584_0000365 | |||
| 586 | Ga0495584_0001822 | |||
| 587 | Ga0495585_0000646 | |||
| 588 | Ga0495585_0027344 | |||
| 589 | Ga0495585_0036737 | |||
| 590 | Ga0495585_0089739 | |||
| 591 | Ga0495585_0118033 | |||
| 592 | Ga0495594_0047325 | |||
| 593 | Ga0495596_0002901 | |||
| 594 | Ga0495607_0001697 | |||
| 595 | Ga0495607_0014081 | |||
| 596 | Ga0495607_0022969 | |||
| 597 | Ga0495607_0031611 | |||
| 598 | Ga0495607_0068419 | |||
| 599 | Ga0495607_0145084 | |||
| 600 | Ga0495607_0242291 | |||
| 601 | Ga0495607_0389714 | |||
| 602 | Ga0495583_0000417 | |||
| 603 | Ga0495583_0003284 | |||
| 604 | Ga0495583_0037555 | |||
| 605 | Ga0495606_0000063 | |||
| 606 | Ga0495606_0000431 | |||
| 607 | Ga0495606_0001347 | |||
| 608 | Ga0495606_0003374 | |||
| 609 | Ga0495606_0004107 | |||
| 610 | Ga0495606_0008520 | |||
| 611 | Ga0495606_0151700 | |||
| 612 | Ga0495606_0422276 | |||
| 613 | Ga0495610_0000014 | |||
| 614 | Ga0495610_0000353 | |||
| 615 | Ga0495610_0001670 | |||
| 616 | Ga0495610_0005618 | |||
| 617 | Ga0495610_0009648 | |||
| 618 | Ga0495610_0043076 | |||
| 619 | Ga0495616_0004391 | |||
| 620 | Ga0495616_0011359 | |||
| 621 | Ga0495631_0040983 | |||
| 622 | Ga0495637_0000150 | |||
| 623 | Ga0495637_0006039 | |||
| 624 | Ga0495643_0000246 | |||
| 625 | Ga0495643_0000302 | |||
| 626 | Ga0495643_0235310 | |||
| 627 | Ga0495643_0369349 | |||
| 628 | Ga0495644_0000451 | |||
| 629 | Ga0495644_0000622 | |||
| 630 | Ga0495648_0000119 | |||
| 631 | Ga0495648_0000240 | |||
| 632 | Ga0495648_0000486 | |||
| 633 | Ga0495648_0003471 | |||
| 634 | Ga0495648_0013106 | |||
| 635 | Ga0495648_0094281 | |||
| 636 | Ga0495642_0001364 | |||
| 637 | Ga0495642_0194277 | |||
| 638 | Ga0495642_0403013 | |||
| 639 | Ga0495654_0000014 | |||
| 640 | Ga0495654_0006366 | |||
| 641 | Ga0495654_0006588 | |||
| 642 | Ga0495609_0000816 | |||
| 643 | Ga0495609_0001962 | |||
| 644 | Ga0495609_0003738 | |||
| 645 | Ga0495609_0014881 | |||
| 646 | Ga0495609_0023045 | |||
| 647 | Ga0495597_0000069 | |||
| 648 | Ga0495597_0000123 | |||
| 649 | Ga0495597_0002767 | |||
| 650 | Ga0495597_0012964 | |||
| 651 | Ga0495622_0000109 | |||
| 652 | Ga0495622_0000246 | |||
| 653 | Ga0495622_0189670 | |||
| 654 | Ga0495633_0000088 | |||
| 655 | Ga0495633_0000131 | |||
| 656 | Ga0495633_0005902 | |||
| 657 | Ga0495633_0008968 | |||
| 658 | Ga0495633_0012055 | |||
| 659 | Ga0495633_0013013 | |||
| 660 | Ga0495633_0017386 | |||
| 661 | Ga0495633_0115375 | |||
| 662 | Ga0495633_0468835 | |||
| 663 | Ga0495656_0006949 | |||
| 664 | Ga0495656_0023540 | |||
| 665 | Ga0495656_0248698 | |||
| 666 | Ga0495668_0000152 | |||
| 667 | Ga0495668_0000188 | |||
| 668 | Ga0495668_0000574 | |||
| 669 | Ga0495668_0000636 | |||
| 670 | Ga0495668_0027065 | |||
| 671 | Ga0495668_0151915 | |||
| 672 | Ga0495611_0004697 | |||
| 673 | Ga0495611_0004729 | |||
| 674 | Ga0495611_0028671 | |||
| 675 | Ga0495625_0000386 | |||
| 676 | Ga0495625_0004123 | |||
| 677 | Ga0495625_0010047 | |||
| 678 | Ga0495625_0065999 | |||
| 679 | Ga0495625_0066294 | |||
| 680 | Ga0495625_0122456 | |||
| 681 | Ga0495625_0216235 | |||
| 682 | Ga0495659_0000026 | |||
| 683 | Ga0495659_0000364 | |||
| 684 | Ga0495661_0044139 | |||
| 685 | Ga0495661_0054321 | |||
| 686 | Ga0495661_0078641 | |||
| 687 | Ga0495661_0105039 | |||
| 688 | Ga0495661_0197919 | |||
| 689 | Ga0495669_0060196 | |||
| 690 | Ga0495670_0001843 | |||
| 691 | Ga0495670_0009901 | |||
| 692 | Ga0495671_0000005 | |||
| 693 | Ga0495671_0000144 | |||
| 694 | Ga0495671_0003189 | |||
| 695 | Ga0495671_0007388 | |||
| 696 | Ga0495671_0019087 | |||
| 697 | Ga0495671_0053365 | |||
| 698 | Ga0495649_0000600 | |||
| 699 | Ga0495649_0011122 | |||
| 700 | Ga0495649_0016777 | |||
| 701 | Ga0495649_0045495 | |||
| 702 | Ga0495649_0137334 | |||
| 703 | Ga0495589_0193612 | |||
| 704 | Ga0495660_0000229 | |||
| 705 | Ga0495660_0000962 | |||
| 706 | Ga0495660_0007303 | |||
| 707 | Ga0495660_0399723 | |||
| 708 | Ga0495636_0000861 | |||
| 709 | Ga0495636_0140506 | |||
| 710 | Ga0495672_0000232 | |||
| 711 | Ga0495672_0000260 | |||
| 712 | Ga0495672_0002347 | |||
| 713 | Ga0495672_0004556 | |||
| 714 | Ga0495683_0002158 | |||
| 715 | Ga0495683_0003420 | |||
| 716 | Ga0495683_0189136 | |||
| 717 | Ga0495687_000629 | |||
| 718 | Ga0495687_003552 | |||
| 719 | Ga0495687_003553 | |||
| 720 | Ga0495687_031070 | |||
| 721 | Ga0495687_047192 | |||
| 722 | Ga0495677_0003543 | |||
| 723 | Ga0495677_0010891 | |||
| 724 | Ga0495677_0031753 | |||
| 725 | Ga0495677_0050566 | |||
| 726 | Ga0495679_021392 | |||
| 727 | Ga0495685_000147 | |||
| 728 | Ga0495685_014082 | |||
| 729 | Ga0495673_0000009 | |||
| 730 | Ga0495673_0000012 | |||
| 731 | Ga0495673_0000146 | |||
| 732 | Ga0495673_0013580 | |||
| 733 | Ga0495673_0062229 | |||
| 734 | Ga0495673_0273710 | |||
| 735 | Ga0495681_0028587 | |||
| 736 | Ga0495681_0068982 | |||
| 737 | Ga0495681_0202504 | |||
| 738 | Ga0495686_0002750 | |||
| 739 | Ga0495686_0005943 | |||
| 740 | Ga0495686_0032478 | |||
| 741 | Ga0495686_0058995 | |||
| 742 | Ga0495615_0001327 | |||
| 743 | Ga0495626_0093521 | |||
| 744 | Ga0496100_0450680 | |||
| 745 | Ga0496103_0001127 | |||
| 746 | Ga0496107_0883337 | |||
| 747 | Ga0496109_1002587 | |||
| 748 | Ga0496111_1054109 | |||
| 749 | Ga0496114_0162557 | |||
| 750 | Ga0496119_0139778 | |||
| 751 | Ga0496121_0227366 | |||
| 752 | Ga0496122_0069316 | |||
| 753 | Ga0496123_0008272 | |||
| 754 | Ga0496124_0156391 | |||
| 755 | Ga0496126_0043656 | |||
| 756 | Ga0495678_000278 | |||
| 757 | Ga0495678_004335 | |||
| 758 | Ga0495678_022953 | |||
| 759 | Ga0495678_023903 | |||
| 760 | Ga0495678_107438 | |||
| 761 | Ga0495682_0000515 | |||
| 762 | Ga0495682_0000614 | |||
| 763 | Ga0495682_0129548 | |||
| 764 | Ga0501315_073780 | |||
| 765 | Ga0501227_067565 | |||
| 766 | Ga0501249_010931 | |||
| 767 | Ga0501269_001658 | |||
| 768 | Ga0501279_025529 | |||
| 769 | Ga0500644_0001775 | |||
| 770 | Ga0500593_001823 | |||
| 771 | Ga0500594_0203563 | |||
| 772 | Ga0500618_001265 | |||
| 773 | Ga0500586_012053 | |||
| 774 | Ga0500645_000631 | |||
| 775 | Ga0500645_001912 | |||
| 776 | Ga0500645_064946 | |||
| 777 | Ga0500661_004900 | |||
| 778 | 2644356055 | |||
| 779 | 2511242713 | |||
| 780 | 2644031337 | |||
| 781 | 2644250423 | |||
| 782 | 2738742612 | |||
| 783 | 2738826064 | |||
| 784 | 2738842384 | |||
| 785 | 2739149861 | |||
| 786 | 2739191780 | |||
| 787 | 2739273131 | |||
| 788 | 2739318257 | |||
| 789 | 2739336498 | |||
| 790 | 2739342175 | |||
| 791 | 2821136404 | |||
| 792 | 2904428484 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oxh-assembly3.cif.gz_D | the soxyz complex of paracoccus pantotrophus | 0.8729 | 38 | 150 |
| 4brj-assembly1.cif.gz_A | superoxide reductase (neelaredoxin) from ignicoccus hospitalis t24k | 0.8727 | 56 | 149 |
| 4brv-assembly1.cif.gz_D | superoxide reductase (neelaredoxin) from ignicoccus hospitalis e23a | 0.8648 | 56 | 149 |
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.8616 | 56 | 149 |
| 2ox5-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.8589 | 56 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ox5B00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.8865 | 38 | 150 | 2.60.40.2470 |
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8616 | 56 | 149 | 2.60.40.10 |
| af_Q58151_5_116_2.60.40.730 | Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain | 0.8582 | 50 | 149 | 2.60.40.730 |
| 2ox5B00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.849 | 38 | 150 | 2.60.40.2470 |
| 2nncA00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.8446 | 36 | 149 | 2.60.40.2470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A526YJA9-F1-model_v4 | Sulfur oxidation protein SoxY | 0.9404 | 44 | 133 |
|
| AF-A0A2V6WSE4-F1-model_v4 | Ig-like SoxY domain-containing protein | 0.9202 | 72 | 153 |
|
| AF-W6KAT5-F1-model_v4 | Putative thiosulfate-binding protein SoxY | 0.918 | 37 | 149 |
|
| AF-A0A7W3UBD8-F1-model_v4 | deleted | 0.9159 | 69 | 153 |
|
| AF-A0A526YJA9-F1-model_v4 | Sulfur oxidation protein SoxY | 0.9113 | 44 | 133 |
|