F433646

General Info

Members Datasets Scaffolds Average Seq Length
396 171 792 151

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221664|2644356055
Length 179
Sequence KAAISAGPASPARGAAPRLAPGLPPSLAPSLARRCLLHAAAALPLLALVRPACATPEELRAAIAAYTGGAVPATGKVTFDIAKLIDNGNAVPVTITVDSPMTAAAHVTGIAIFNERNPETDIARFTLGPRSGKAEVSTRIRLATSQKLVAVARLSDGSYWQQAMDVIVALAACIEGEAP

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
30 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
38 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
39 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
40 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
41 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
42 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
43 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
44 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
65 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
66 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
76 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
81 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
91 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
92 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
97 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
118 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
119 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
125 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
126 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
130 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
144 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
145 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
147 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
148 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
149 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
150 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
151 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
152 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
153 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
154 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
155 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
156 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
157 2643221664 Massilia sp. Root418 Isolate Unclassified
158 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
159 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
160 2643221645 Massilia sp. Root351 Isolate Unclassified
161 2738541280 Massilia sp. GV090 Isolate Unclassified
162 2738541297 Duganella sp. GV083 Isolate Unclassified
163 2738541300 Massilia sp. GV016 Isolate Unclassified
164 2738541357 Duganella sp. GV053 Isolate Unclassified
165 2738543003 Duganella sp. GV066 Isolate Unclassified
166 2738543018 Massilia sp. GV045 Isolate Unclassified
167 2738543026 Duganella sp. GV089 Isolate Unclassified
168 2738543029 Duganella sp. GV039 Isolate Unclassified
169 2738543030 Massilia sp. GV097 Isolate Unclassified
170 2821131069 Duganella sp. 1224 Isolate Unclassified
171 2904424332 Duganella sp. 1411 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 0.25
Isolates 3.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.05
Nodule 0.76
Rhizoplane 1.77
Rhizosphere 58.59
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000025 3300002705 Bacteria 136287
2 JGI25154J39366_1000045 3300002738 Bacteria 136302
3 JGI25157J39369_1000034 3300002741 Bacteria 136301
4 JGI25150J39212_1011038 3300002774 Bacteria 1653
5 JGI25150J39212_1016409 3300002774 Bacteria 1216
6 JGI25159J45721_1000348 3300002987 Bacteria 21410
7 JGI25159J45721_1009889 3300002987 Bacteria 2480
8 JGI25159J45721_1030755 3300002987 Bacteria 868
9 JGI25151J46595_10011919 3300003187 Bacteria 3974
10 rootH1_10095860 3300003316 Bacteria 1026
11 JGI25160J50197_1000379 3300003354 Bacteria 29058
12 JGI25160J50197_1000400 3300003354 Bacteria 27971
13 JGI25160J50197_1051698 3300003354 Bacteria 868
14 JGI25161J50226_1000222 3300003374 Bacteria 35113
15 JGI25161J50226_1000247 3300003374 Bacteria 32339
16 Ga0055526_1000306 3300003771 Bacteria 40960
17 Ga0055526_1001433 3300003771 Bacteria 16981
18 Ga0055526_1039082 3300003771 Bacteria 1213
19 Ga0055526_1053003 3300003771 Bacteria 911
20 Ga0055537_1000008 3300003773 Bacteria 142572
21 Ga0055537_1000119 3300003773 Bacteria 59684
22 Ga0055537_1017485 3300003773 Bacteria 1177
23 Ga0055537_1023836 3300003773 Bacteria 869
24 Ga0055537_1027546 3300003773 Bacteria 762
25 Ga0055524_1000075 3300003775 Bacteria 121897
26 Ga0055524_1007019 3300003775 Bacteria 4838
27 Ga0055524_1017662 3300003775 Bacteria 2509
28 Ga0055524_1044388 3300003775 Bacteria 1081
29 Ga0055536_1006581 3300003781 Bacteria 5382
30 Ga0055534_1000047 3300003784 Bacteria 94932
31 Ga0055534_1000809 3300003784 Bacteria 14478
32 Ga0055534_1017776 3300003784 Bacteria 1250
33 Ga0055528_1000049 3300003790 Bacteria 94814
34 Ga0055528_1000272 3300003790 Bacteria 43798
35 Ga0055530_10000152 3300003791 Bacteria 62435
36 Ga0055530_10001546 3300003791 Bacteria 16531
37 Ga0055530_10029756 3300003791 Bacteria 1455
38 Ga0055540_1000160 3300003792 Bacteria 66881
39 Ga0055531_10000366 3300003794 Bacteria 43612
40 Ga0055531_10000652 3300003794 Bacteria 29887
41 Ga0055531_10007406 3300003794 Bacteria 6001
42 Ga0055531_10059006 3300003794 Bacteria 951
43 Ga0055543_1000185 3300004625 Bacteria 50666
44 Ga0055543_1000925 3300004625 Bacteria 13667
45 Ga0065165_1000167 3300005262 Bacteria 115630
46 Ga0065165_1001481 3300005262 Bacteria 24964
47 Ga0065165_1017928 3300005262 Bacteria 2585
48 Ga0065165_1033251 3300005262 Bacteria 1606
49 Ga0065165_1046968 3300005262 Bacteria 1249
50 Ga0068869_100793449 3300005334 Bacteria 813
51 Ga0070678_100443635 3300005456 Bacteria 1135
52 Ga0070662_100531911 3300005457 Bacteria 983
53 Ga0068867_100122554 3300005459 Bacteria 2011
54 Ga0068854_100372163 3300005578 Bacteria 1175
55 Ga0068862_100406263 3300005844 Bacteria 1275
56 Ga0075363_100309920 3300006048 Bacteria 917
57 Ga0068871_100254427 3300006358 Bacteria 1531
58 Ga0079104_1065140 3300006946 Bacteria 776
59 Ga0099826_10000048 3300006948 Bacteria 74895
60 Ga0105244_10002531 3300009036 Bacteria 13730
61 Ga0163162_10683708 3300013306 Bacteria 1149
62 Ga0157380_10231923 3300014326 Bacteria 1659
63 Ga0157379_10242792 3300014968 Bacteria 1634
64 Ga0163161_10014363 3300017792 Bacteria 5512
65 Ga0213872_10000981 3300021361 Bacteria 19948
66 Ga0213872_10006546 3300021361 Bacteria 5827
67 Ga0213872_10330837 3300021361 Bacteria 628
68 Ga0209435_100001 3300025206 Bacteria 1424171
69 Ga0209436_100148 3300025208 Bacteria 33690
70 Ga0209436_104982 3300025208 Bacteria 3166
71 Ga0209436_111930 3300025208 Bacteria 1500
72 Ga0209436_120974 3300025208 Bacteria 870
73 Ga0207425_1000093 3300025245 Bacteria 87038
74 Ga0207425_1001279 3300025245 Bacteria 10933
75 Ga0207425_1009193 3300025245 Bacteria 2473
76 Ga0209646_1000001 3300025246 Bacteria 3092932
77 Ga0209026_1000003 3300025250 Bacteria 1060571
78 Ga0209759_1000001 3300025256 Bacteria 2799452
79 Ga0209129_1000344 3300025258 Bacteria 39975
80 Ga0209129_1008401 3300025258 Bacteria 2877
81 Ga0209565_1000004 3300025263 Bacteria 983150
82 Ga0209565_1000112 3300025263 Bacteria 117209
83 Ga0209565_1001307 3300025263 Bacteria 11476
84 Ga0209565_1005330 3300025263 Bacteria 3753
85 Ga0209565_1006531 3300025263 Bacteria 3261
86 Ga0209565_1012246 3300025263 Bacteria 2054
87 Ga0209565_1019690 3300025263 Bacteria 1436
88 Ga0209673_1000210 3300025273 Bacteria 117276
89 Ga0209673_1000275 3300025273 Bacteria 96728
90 Ga0209130_1000016 3300025284 Bacteria 395540
91 Ga0209130_1000129 3300025284 Bacteria 123096
92 Ga0209130_1000299 3300025284 Bacteria 60368
93 Ga0209130_1000369 3300025284 Bacteria 51132
94 Ga0209130_1014636 3300025284 Bacteria 1961
95 Ga0209675_1000044 3300025291 Bacteria 230392
96 Ga0209675_1000142 3300025291 Bacteria 95327
97 Ga0209675_1008043 3300025291 Bacteria 3939
98 Ga0209675_1018592 3300025291 Bacteria 1940
99 Ga0209676_1000029 3300025292 Bacteria 520536
100 Ga0209676_1008637 3300025292 Bacteria 4511
101 Ga0209025_1002883 3300025294 Bacteria 17225
102 Ga0209025_1005351 3300025294 Bacteria 10521
103 Ga0209564_1000042 3300025295 Bacteria 392805
104 Ga0209564_1000245 3300025295 Bacteria 117378
105 Ga0209564_1000356 3300025295 Bacteria 85562
106 Ga0209564_1000448 3300025295 Bacteria 70600
107 Ga0209564_1009484 3300025295 Bacteria 4625
108 Ga0209564_1014928 3300025295 Bacteria 3196
109 Ga0209564_1021137 3300025295 Bacteria 2354
110 Ga0209564_1036838 3300025295 Bacteria 1388
111 Ga0209758_1063563 3300025297 Bacteria 1201
112 Ga0209050_1000003 3300025298 Bacteria 1609245
113 Ga0209050_1000086 3300025298 Bacteria 262009
114 Ga0209050_1000211 3300025298 Bacteria 129614
115 Ga0209050_1001147 3300025298 Bacteria 31733
116 Ga0209050_1002834 3300025298 Bacteria 13772
117 Ga0209050_1006363 3300025298 Bacteria 7017
118 Ga0209256_1000001 3300025299 Bacteria 2166974
119 Ga0209256_1000252 3300025299 Bacteria 94936
120 Ga0209256_1000268 3300025299 Bacteria 91897
121 Ga0209256_1000929 3300025299 Bacteria 35648
122 Ga0209256_1002063 3300025299 Bacteria 17738
123 Ga0209256_1023696 3300025299 Bacteria 1824
124 Ga0209256_1050700 3300025299 Bacteria 1005
125 Ga0207426_1000071 3300025302 Bacteria 329539
126 Ga0207426_1004111 3300025302 Bacteria 7313
127 Ga0207426_1004151 3300025302 Bacteria 7255
128 Ga0207426_1026693 3300025302 Bacteria 1931
129 Ga0207426_1086941 3300025302 Bacteria 835
130 Ga0209051_1000003 3300025303 Bacteria 1609245
131 Ga0209051_1028385 3300025303 Bacteria 2211
132 Ga0209257_1000018 3300025304 Bacteria 836016
133 Ga0209257_1000087 3300025304 Bacteria 282503
134 Ga0209257_1001799 3300025304 Bacteria 23534
135 Ga0209257_1016115 3300025304 Bacteria 3048
136 Ga0207655_1004090 3300025728 Bacteria 10499
137 Ga0207669_10142221 3300025937 Bacteria 1667
138 Ga0207648_10070558 3300026089 Bacteria 3046
139 Ga0207683_10243188 3300026121 Bacteria 1642
140 Ga0209282_1000066 3300027666 Bacteria 87072
141 Ga0268265_10447315 3300028380 Bacteria 1206
142 Ga0307515_10228770 3300028794 Bacteria 1658
143 Ga0307515_10439350 3300028794 Bacteria 922
144 Ga0316177_1159406 3300030731 Bacteria 2709
145 Ga0316180_1051715 3300030736 Bacteria 1718
146 Ga0316181_1067271 3300030744 Bacteria 2972
147 Ga0307513_10000006 3300031456 Bacteria 470848
148 Ga0307513_10000014 3300031456 Bacteria 303157
149 Ga0307408_100000106 3300031548 Bacteria 91438
150 Ga0307408_100000289 3300031548 Bacteria 49603
151 Ga0307408_100000326 3300031548 Bacteria 45638
152 Ga0307408_100011010 3300031548 Bacteria 5968
153 Ga0307408_100058417 3300031548 Bacteria 2804
154 Ga0307516_10117227 3300031730 Bacteria 2457
155 Ga0307405_10893210 3300031731 Bacteria 751
156 Ga0307412_10443772 3300031911 Bacteria 1067
157 Ga0307412_11762183 3300031911 Bacteria 569
158 Ga0307416_100020241 3300032002 Bacteria 4742
159 Ga0373939_0132434 3300035114 Bacteria 891
160 Ga0436361_0324047 3300039447 Bacteria 25390
161 Ga0436361_0470245 3300039447 Bacteria 1406
162 Ga0436361_1158315 3300039447 Bacteria 8002
163 Ga0451791_0185433 3300041451 Bacteria 585
164 Ga0451839_0707710 3300041496 Bacteria 613
165 Ga0451853_0244838 3300041512 Bacteria 958
166 Ga0451853_1391320 3300041512 Bacteria 1554
167 Ga0451577_0253127 3300042876 Bacteria 1594
168 Ga0453684_0873213 3300044712 Bacteria 965
169 Ga0495617_002298 3300046452 Bacteria 7715
170 Ga0495617_002348 3300046452 Bacteria 7579
171 Ga0495617_009698 3300046452 Bacteria 3303
172 Ga0495617_025256 3300046452 Bacteria 2003
173 Ga0495590_0000056 3300046457 Bacteria 96913
174 Ga0495590_0011115 3300046457 Bacteria 3373
175 Ga0495638_0000170 3300046460 Bacteria 101629
176 Ga0495638_0006602 3300046460 Bacteria 8430
177 Ga0495638_0018858 3300046460 Bacteria 4574
178 Ga0495638_0239732 3300046460 Bacteria 1005
179 Ga0495638_0340005 3300046460 Bacteria 796
180 Ga0495653_0000066 3300046463 Bacteria 91671
181 Ga0495650_0000553 3300046471 Bacteria 53302
182 Ga0495650_0001888 3300046471 Bacteria 18636
183 Ga0495650_0003450 3300046471 Bacteria 11527
184 Ga0495650_0026921 3300046471 Bacteria 2665
185 Ga0495650_0065614 3300046471 Bacteria 1440
186 Ga0495605_0000315 3300046474 Bacteria 50714
187 Ga0495605_0006948 3300046474 Bacteria 6463
188 Ga0495639_0020556 3300046475 Bacteria 2885
189 Ga0495584_0000365 3300046491 Bacteria 31489
190 Ga0495584_0001822 3300046491 Bacteria 12380
191 Ga0495585_0000646 3300046492 Bacteria 32025
192 Ga0495585_0027344 3300046492 Bacteria 3255
193 Ga0495585_0036737 3300046492 Bacteria 2760
194 Ga0495585_0089739 3300046492 Bacteria 1656
195 Ga0495585_0118033 3300046492 Bacteria 1405
196 Ga0495594_0047325 3300046499 Bacteria 2362
197 Ga0495596_0002901 3300046500 Bacteria 8917
198 Ga0495607_0001697 3300046501 Bacteria 18946
199 Ga0495607_0014081 3300046501 Bacteria 5220
200 Ga0495607_0022969 3300046501 Bacteria 3909
201 Ga0495607_0031611 3300046501 Bacteria 3239
202 Ga0495607_0068419 3300046501 Bacteria 1991
203 Ga0495607_0145084 3300046501 Bacteria 1220
204 Ga0495607_0242291 3300046501 Unclassified 872
205 Ga0495607_0389714 3300046501 Bacteria 636
206 Ga0495583_0000417 3300046506 Bacteria 64786
207 Ga0495583_0003284 3300046506 Bacteria 12546
208 Ga0495583_0037555 3300046506 Bacteria 2295
209 Ga0495606_0000063 3300046507 Bacteria 184610
210 Ga0495606_0000431 3300046507 Bacteria 69714
211 Ga0495606_0001347 3300046507 Bacteria 33360
212 Ga0495606_0003374 3300046507 Bacteria 16993
213 Ga0495606_0004107 3300046507 Bacteria 14789
214 Ga0495606_0008520 3300046507 Bacteria 8892
215 Ga0495606_0151700 3300046507 Bacteria 1359
216 Ga0495606_0422276 3300046507 Bacteria 689
217 Ga0495610_0000014 3300046512 Bacteria 444708
218 Ga0495610_0000353 3300046512 Bacteria 48216
219 Ga0495610_0001670 3300046512 Bacteria 19517
220 Ga0495610_0005618 3300046512 Bacteria 8852
221 Ga0495610_0009648 3300046512 Bacteria 6077
222 Ga0495610_0043076 3300046512 Bacteria 2252
223 Ga0495616_0004391 3300046513 Bacteria 8897
224 Ga0495616_0011359 3300046513 Bacteria 5108
225 Ga0495631_0040983 3300046518 Bacteria 2050
226 Ga0495637_0000150 3300046520 Bacteria 53429
227 Ga0495637_0006039 3300046520 Bacteria 6115
228 Ga0495643_0000246 3300046522 Bacteria 80483
229 Ga0495643_0000302 3300046522 Bacteria 68932
230 Ga0495643_0235310 3300046522 Bacteria 862
231 Ga0495643_0369349 3300046522 Bacteria 638
232 Ga0495644_0000451 3300046523 Bacteria 18007
233 Ga0495644_0000622 3300046523 Bacteria 14853
234 Ga0495648_0000119 3300046524 Bacteria 95682
235 Ga0495648_0000240 3300046524 Bacteria 62286
236 Ga0495648_0000486 3300046524 Bacteria 42701
237 Ga0495648_0003471 3300046524 Bacteria 13857
238 Ga0495648_0013106 3300046524 Bacteria 6146
239 Ga0495648_0094281 3300046524 Bacteria 1667
240 Ga0495642_0001364 3300046528 Bacteria 10919
241 Ga0495642_0194277 3300046528 Bacteria 884
242 Ga0495642_0403013 3300046528 Bacteria 603
243 Ga0495654_0000014 3300046530 Bacteria 312126
244 Ga0495654_0006366 3300046530 Bacteria 6713
245 Ga0495654_0006588 3300046530 Bacteria 6576
246 Ga0495609_0000816 3300046538 Bacteria 23247
247 Ga0495609_0001962 3300046538 Bacteria 13050
248 Ga0495609_0003738 3300046538 Bacteria 8596
249 Ga0495609_0014881 3300046538 Bacteria 3650
250 Ga0495609_0023045 3300046538 Bacteria 2863
251 Ga0495597_0000069 3300046542 Bacteria 89990
252 Ga0495597_0000123 3300046542 Bacteria 70236
253 Ga0495597_0002767 3300046542 Bacteria 10803
254 Ga0495597_0012964 3300046542 Bacteria 4003
255 Ga0495622_0000109 3300046557 Bacteria 71936
256 Ga0495622_0000246 3300046557 Bacteria 42141
257 Ga0495622_0189670 3300046557 Bacteria 919
258 Ga0495633_0000088 3300046558 Bacteria 124193
259 Ga0495633_0000131 3300046558 Bacteria 100408
260 Ga0495633_0005902 3300046558 Bacteria 7365
261 Ga0495633_0008968 3300046558 Bacteria 5570
262 Ga0495633_0012055 3300046558 Bacteria 4618
263 Ga0495633_0013013 3300046558 Bacteria 4402
264 Ga0495633_0017386 3300046558 Bacteria 3679
265 Ga0495633_0115375 3300046558 Bacteria 1244
266 Ga0495633_0468835 3300046558 Bacteria 568
267 Ga0495656_0006949 3300046615 Bacteria 3981
268 Ga0495656_0023540 3300046615 Bacteria 2424
269 Ga0495656_0248698 3300046615 Bacteria 897
270 Ga0495668_0000152 3300046616 Bacteria 104716
271 Ga0495668_0000188 3300046616 Bacteria 92177
272 Ga0495668_0000574 3300046616 Bacteria 45013
273 Ga0495668_0000636 3300046616 Bacteria 42184
274 Ga0495668_0027065 3300046616 Bacteria 3249
275 Ga0495668_0151915 3300046616 Bacteria 1268
276 Ga0495611_0004697 3300046648 Bacteria 5865
277 Ga0495611_0004729 3300046648 Bacteria 5847
278 Ga0495611_0028671 3300046648 Bacteria 2439
279 Ga0495625_0000386 3300046660 Bacteria 67356
280 Ga0495625_0004123 3300046660 Bacteria 13868
281 Ga0495625_0010047 3300046660 Bacteria 7865
282 Ga0495625_0065999 3300046660 Bacteria 2550
283 Ga0495625_0066294 3300046660 Bacteria 2543
284 Ga0495625_0122456 3300046660 Bacteria 1768
285 Ga0495625_0216235 3300046660 Bacteria 1258
286 Ga0495659_0000026 3300046664 Bacteria 69038
287 Ga0495659_0000364 3300046664 Bacteria 17652
288 Ga0495661_0044139 3300046665 Bacteria 2735
289 Ga0495661_0054321 3300046665 Bacteria 2405
290 Ga0495661_0078641 3300046665 Bacteria 1907
291 Ga0495661_0105039 3300046665 Bacteria 1583
292 Ga0495661_0197919 3300046665 Bacteria 1054
293 Ga0495669_0060196 3300046684 Bacteria 1716
294 Ga0495670_0001843 3300046691 Bacteria 10427
295 Ga0495670_0009901 3300046691 Bacteria 4686
296 Ga0495671_0000005 3300046692 Bacteria 509397
297 Ga0495671_0000144 3300046692 Bacteria 63224
298 Ga0495671_0003189 3300046692 Bacteria 10190
299 Ga0495671_0007388 3300046692 Bacteria 6270
300 Ga0495671_0019087 3300046692 Bacteria 3628
301 Ga0495671_0053365 3300046692 Bacteria 2006
302 Ga0495649_0000600 3300046694 Bacteria 30004
303 Ga0495649_0011122 3300046694 Bacteria 5296
304 Ga0495649_0016777 3300046694 Bacteria 4147
305 Ga0495649_0045495 3300046694 Bacteria 2393
306 Ga0495649_0137334 3300046694 Bacteria 1288
307 Ga0495589_0193612 3300046794 Bacteria 961
308 Ga0495660_0000229 3300046810 Bacteria 55150
309 Ga0495660_0000962 3300046810 Bacteria 21017
310 Ga0495660_0007303 3300046810 Bacteria 6495
311 Ga0495660_0399723 3300046810 Bacteria 602
312 Ga0495636_0000861 3300047318 Bacteria 11216
313 Ga0495636_0140506 3300047318 Bacteria 1078
314 Ga0495672_0000232 3300047320 Bacteria 79561
315 Ga0495672_0000260 3300047320 Bacteria 73347
316 Ga0495672_0002347 3300047320 Bacteria 17504
317 Ga0495672_0004556 3300047320 Bacteria 11276
318 Ga0495683_0002158 3300047323 Bacteria 12082
319 Ga0495683_0003420 3300047323 Bacteria 9263
320 Ga0495683_0189136 3300047323 Bacteria 935
321 Ga0495687_000629 3300047443 Bacteria 40470
322 Ga0495687_003552 3300047443 Bacteria 11207
323 Ga0495687_003553 3300047443 Bacteria 11205
324 Ga0495687_031070 3300047443 Bacteria 2453
325 Ga0495687_047192 3300047443 Bacteria 1854
326 Ga0495677_0003543 3300047445 Bacteria 6056
327 Ga0495677_0010891 3300047445 Bacteria 3332
328 Ga0495677_0031753 3300047445 Bacteria 1922
329 Ga0495677_0050566 3300047445 Bacteria 1529
330 Ga0495679_021392 3300047446 Bacteria 2234
331 Ga0495685_000147 3300047447 Bacteria 24129
332 Ga0495685_014082 3300047447 Bacteria 2714
333 Ga0495673_0000009 3300047469 Bacteria 731993
334 Ga0495673_0000012 3300047469 Bacteria 656908
335 Ga0495673_0000146 3300047469 Bacteria 127378
336 Ga0495673_0013580 3300047469 Bacteria 4272
337 Ga0495673_0062229 3300047469 Bacteria 1595
338 Ga0495673_0273710 3300047469 Bacteria 611
339 Ga0495681_0028587 3300047470 Bacteria 2866
340 Ga0495681_0068982 3300047470 Bacteria 1607
341 Ga0495681_0202504 3300047470 Bacteria 804
342 Ga0495686_0002750 3300047472 Bacteria 16073
343 Ga0495686_0005943 3300047472 Bacteria 9496
344 Ga0495686_0032478 3300047472 Bacteria 3378
345 Ga0495686_0058995 3300047472 Bacteria 2391
346 Ga0495615_0001327 3300048090 Bacteria 3631
347 Ga0495626_0093521 3300048091 Bacteria 1319
348 Ga0496100_0450680 3300048903 Unclassified 986
349 Ga0496103_0001127 3300048906 Bacteria 18573
350 Ga0496107_0883337 3300048910 Bacteria 652
351 Ga0496109_1002587 3300048912 Bacteria 773
352 Ga0496111_1054109 3300048914 Bacteria 581
353 Ga0496114_0162557 3300048917 Bacteria 1942
354 Ga0496119_0139778 3300048922 Bacteria 1309
355 Ga0496121_0227366 3300048924 Bacteria 1309
356 Ga0496122_0069316 3300048925 Bacteria 2526
357 Ga0496123_0008272 3300048926 Bacteria 9587
358 Ga0496124_0156391 3300048927 Bacteria 1782
359 Ga0496126_0043656 3300048929 Bacteria 4133
360 Ga0495678_000278 3300049459 Bacteria 56511
361 Ga0495678_004335 3300049459 Bacteria 8261
362 Ga0495678_022953 3300049459 Bacteria 2720
363 Ga0495678_023903 3300049459 Bacteria 2647
364 Ga0495678_107438 3300049459 Bacteria 957
365 Ga0495682_0000515 3300049460 Bacteria 26766
366 Ga0495682_0000614 3300049460 Bacteria 23998
367 Ga0495682_0129548 3300049460 Bacteria 902
368 Ga0501315_073780 3300049531 Bacteria 570
369 Ga0501227_067565 3300049665 Bacteria 924
370 Ga0501249_010931 3300049679 Bacteria 1902
371 Ga0501269_001658 3300049766 Bacteria 2847
372 Ga0501279_025529 3300049775 Bacteria 859
373 Ga0500644_0001775 3300053088 Bacteria 5580
374 Ga0500593_001823 3300053117 Bacteria 7657
375 Ga0500594_0203563 3300053118 Bacteria 651
376 Ga0500618_001265 3300053125 Bacteria 11758
377 Ga0500586_012053 3300053145 Bacteria 2501
378 Ga0500645_000631 3300053730 Bacteria 22397
379 Ga0500645_001912 3300053730 Bacteria 9900
380 Ga0500645_064946 3300053730 Bacteria 1052
381 Ga0500661_004900 3300055283 Bacteria 2504
382 2644356055 2643221664 Bacteria 7272945
383 2511242713 2511231002 Bacteria 5042903
384 2644031337 2643221603 Bacteria 6147767
385 2644250423 2643221645 Bacteria 7207331
386 2738742612 2738541280 Bacteria 6630198
387 2738826064 2738541297 Bacteria 6549566
388 2738842384 2738541300 Bacteria 6675882
389 2739149861 2738541357 Bacteria 6549408
390 2739191780 2738543003 Bacteria 6549560
391 2739273131 2738543018 Bacteria 6718814
392 2739318257 2738543026 Bacteria 6549408
393 2739336498 2738543029 Bacteria 6549249
394 2739342175 2738543030 Bacteria 6719714
395 2821136404 2821131069 Bacteria 6108407
396 2904428484 2904424332 Bacteria 7633521
397 JGI25156J39149_1000025
398 JGI25154J39366_1000045
399 JGI25157J39369_1000034
400 JGI25150J39212_1011038
401 JGI25150J39212_1016409
402 JGI25159J45721_1000348
403 JGI25159J45721_1009889
404 JGI25159J45721_1030755
405 JGI25151J46595_10011919
406 rootH1_10095860
407 JGI25160J50197_1000379
408 JGI25160J50197_1000400
409 JGI25160J50197_1051698
410 JGI25161J50226_1000222
411 JGI25161J50226_1000247
412 Ga0055526_1000306
413 Ga0055526_1001433
414 Ga0055526_1039082
415 Ga0055526_1053003
416 Ga0055537_1000008
417 Ga0055537_1000119
418 Ga0055537_1017485
419 Ga0055537_1023836
420 Ga0055537_1027546
421 Ga0055524_1000075
422 Ga0055524_1007019
423 Ga0055524_1017662
424 Ga0055524_1044388
425 Ga0055536_1006581
426 Ga0055534_1000047
427 Ga0055534_1000809
428 Ga0055534_1017776
429 Ga0055528_1000049
430 Ga0055528_1000272
431 Ga0055530_10000152
432 Ga0055530_10001546
433 Ga0055530_10029756
434 Ga0055540_1000160
435 Ga0055531_10000366
436 Ga0055531_10000652
437 Ga0055531_10007406
438 Ga0055531_10059006
439 Ga0055543_1000185
440 Ga0055543_1000925
441 Ga0065165_1000167
442 Ga0065165_1001481
443 Ga0065165_1017928
444 Ga0065165_1033251
445 Ga0065165_1046968
446 Ga0068869_100793449
447 Ga0070678_100443635
448 Ga0070662_100531911
449 Ga0068867_100122554
450 Ga0068854_100372163
451 Ga0068862_100406263
452 Ga0075363_100309920
453 Ga0068871_100254427
454 Ga0079104_1065140
455 Ga0099826_10000048
456 Ga0105244_10002531
457 Ga0163162_10683708
458 Ga0157380_10231923
459 Ga0157379_10242792
460 Ga0163161_10014363
461 Ga0213872_10000981
462 Ga0213872_10006546
463 Ga0213872_10330837
464 Ga0209435_100001
465 Ga0209436_100148
466 Ga0209436_104982
467 Ga0209436_111930
468 Ga0209436_120974
469 Ga0207425_1000093
470 Ga0207425_1001279
471 Ga0207425_1009193
472 Ga0209646_1000001
473 Ga0209026_1000003
474 Ga0209759_1000001
475 Ga0209129_1000344
476 Ga0209129_1008401
477 Ga0209565_1000004
478 Ga0209565_1000112
479 Ga0209565_1001307
480 Ga0209565_1005330
481 Ga0209565_1006531
482 Ga0209565_1012246
483 Ga0209565_1019690
484 Ga0209673_1000210
485 Ga0209673_1000275
486 Ga0209130_1000016
487 Ga0209130_1000129
488 Ga0209130_1000299
489 Ga0209130_1000369
490 Ga0209130_1014636
491 Ga0209675_1000044
492 Ga0209675_1000142
493 Ga0209675_1008043
494 Ga0209675_1018592
495 Ga0209676_1000029
496 Ga0209676_1008637
497 Ga0209025_1002883
498 Ga0209025_1005351
499 Ga0209564_1000042
500 Ga0209564_1000245
501 Ga0209564_1000356
502 Ga0209564_1000448
503 Ga0209564_1009484
504 Ga0209564_1014928
505 Ga0209564_1021137
506 Ga0209564_1036838
507 Ga0209758_1063563
508 Ga0209050_1000003
509 Ga0209050_1000086
510 Ga0209050_1000211
511 Ga0209050_1001147
512 Ga0209050_1002834
513 Ga0209050_1006363
514 Ga0209256_1000001
515 Ga0209256_1000252
516 Ga0209256_1000268
517 Ga0209256_1000929
518 Ga0209256_1002063
519 Ga0209256_1023696
520 Ga0209256_1050700
521 Ga0207426_1000071
522 Ga0207426_1004111
523 Ga0207426_1004151
524 Ga0207426_1026693
525 Ga0207426_1086941
526 Ga0209051_1000003
527 Ga0209051_1028385
528 Ga0209257_1000018
529 Ga0209257_1000087
530 Ga0209257_1001799
531 Ga0209257_1016115
532 Ga0207655_1004090
533 Ga0207669_10142221
534 Ga0207648_10070558
535 Ga0207683_10243188
536 Ga0209282_1000066
537 Ga0268265_10447315
538 Ga0307515_10228770
539 Ga0307515_10439350
540 Ga0316177_1159406
541 Ga0316180_1051715
542 Ga0316181_1067271
543 Ga0307513_10000006
544 Ga0307513_10000014
545 Ga0307408_100000106
546 Ga0307408_100000289
547 Ga0307408_100000326
548 Ga0307408_100011010
549 Ga0307408_100058417
550 Ga0307516_10117227
551 Ga0307405_10893210
552 Ga0307412_10443772
553 Ga0307412_11762183
554 Ga0307416_100020241
555 Ga0373939_0132434
556 Ga0436361_0324047
557 Ga0436361_0470245
558 Ga0436361_1158315
559 Ga0451791_0185433
560 Ga0451839_0707710
561 Ga0451853_0244838
562 Ga0451853_1391320
563 Ga0451577_0253127
564 Ga0453684_0873213
565 Ga0495617_002298
566 Ga0495617_002348
567 Ga0495617_009698
568 Ga0495617_025256
569 Ga0495590_0000056
570 Ga0495590_0011115
571 Ga0495638_0000170
572 Ga0495638_0006602
573 Ga0495638_0018858
574 Ga0495638_0239732
575 Ga0495638_0340005
576 Ga0495653_0000066
577 Ga0495650_0000553
578 Ga0495650_0001888
579 Ga0495650_0003450
580 Ga0495650_0026921
581 Ga0495650_0065614
582 Ga0495605_0000315
583 Ga0495605_0006948
584 Ga0495639_0020556
585 Ga0495584_0000365
586 Ga0495584_0001822
587 Ga0495585_0000646
588 Ga0495585_0027344
589 Ga0495585_0036737
590 Ga0495585_0089739
591 Ga0495585_0118033
592 Ga0495594_0047325
593 Ga0495596_0002901
594 Ga0495607_0001697
595 Ga0495607_0014081
596 Ga0495607_0022969
597 Ga0495607_0031611
598 Ga0495607_0068419
599 Ga0495607_0145084
600 Ga0495607_0242291
601 Ga0495607_0389714
602 Ga0495583_0000417
603 Ga0495583_0003284
604 Ga0495583_0037555
605 Ga0495606_0000063
606 Ga0495606_0000431
607 Ga0495606_0001347
608 Ga0495606_0003374
609 Ga0495606_0004107
610 Ga0495606_0008520
611 Ga0495606_0151700
612 Ga0495606_0422276
613 Ga0495610_0000014
614 Ga0495610_0000353
615 Ga0495610_0001670
616 Ga0495610_0005618
617 Ga0495610_0009648
618 Ga0495610_0043076
619 Ga0495616_0004391
620 Ga0495616_0011359
621 Ga0495631_0040983
622 Ga0495637_0000150
623 Ga0495637_0006039
624 Ga0495643_0000246
625 Ga0495643_0000302
626 Ga0495643_0235310
627 Ga0495643_0369349
628 Ga0495644_0000451
629 Ga0495644_0000622
630 Ga0495648_0000119
631 Ga0495648_0000240
632 Ga0495648_0000486
633 Ga0495648_0003471
634 Ga0495648_0013106
635 Ga0495648_0094281
636 Ga0495642_0001364
637 Ga0495642_0194277
638 Ga0495642_0403013
639 Ga0495654_0000014
640 Ga0495654_0006366
641 Ga0495654_0006588
642 Ga0495609_0000816
643 Ga0495609_0001962
644 Ga0495609_0003738
645 Ga0495609_0014881
646 Ga0495609_0023045
647 Ga0495597_0000069
648 Ga0495597_0000123
649 Ga0495597_0002767
650 Ga0495597_0012964
651 Ga0495622_0000109
652 Ga0495622_0000246
653 Ga0495622_0189670
654 Ga0495633_0000088
655 Ga0495633_0000131
656 Ga0495633_0005902
657 Ga0495633_0008968
658 Ga0495633_0012055
659 Ga0495633_0013013
660 Ga0495633_0017386
661 Ga0495633_0115375
662 Ga0495633_0468835
663 Ga0495656_0006949
664 Ga0495656_0023540
665 Ga0495656_0248698
666 Ga0495668_0000152
667 Ga0495668_0000188
668 Ga0495668_0000574
669 Ga0495668_0000636
670 Ga0495668_0027065
671 Ga0495668_0151915
672 Ga0495611_0004697
673 Ga0495611_0004729
674 Ga0495611_0028671
675 Ga0495625_0000386
676 Ga0495625_0004123
677 Ga0495625_0010047
678 Ga0495625_0065999
679 Ga0495625_0066294
680 Ga0495625_0122456
681 Ga0495625_0216235
682 Ga0495659_0000026
683 Ga0495659_0000364
684 Ga0495661_0044139
685 Ga0495661_0054321
686 Ga0495661_0078641
687 Ga0495661_0105039
688 Ga0495661_0197919
689 Ga0495669_0060196
690 Ga0495670_0001843
691 Ga0495670_0009901
692 Ga0495671_0000005
693 Ga0495671_0000144
694 Ga0495671_0003189
695 Ga0495671_0007388
696 Ga0495671_0019087
697 Ga0495671_0053365
698 Ga0495649_0000600
699 Ga0495649_0011122
700 Ga0495649_0016777
701 Ga0495649_0045495
702 Ga0495649_0137334
703 Ga0495589_0193612
704 Ga0495660_0000229
705 Ga0495660_0000962
706 Ga0495660_0007303
707 Ga0495660_0399723
708 Ga0495636_0000861
709 Ga0495636_0140506
710 Ga0495672_0000232
711 Ga0495672_0000260
712 Ga0495672_0002347
713 Ga0495672_0004556
714 Ga0495683_0002158
715 Ga0495683_0003420
716 Ga0495683_0189136
717 Ga0495687_000629
718 Ga0495687_003552
719 Ga0495687_003553
720 Ga0495687_031070
721 Ga0495687_047192
722 Ga0495677_0003543
723 Ga0495677_0010891
724 Ga0495677_0031753
725 Ga0495677_0050566
726 Ga0495679_021392
727 Ga0495685_000147
728 Ga0495685_014082
729 Ga0495673_0000009
730 Ga0495673_0000012
731 Ga0495673_0000146
732 Ga0495673_0013580
733 Ga0495673_0062229
734 Ga0495673_0273710
735 Ga0495681_0028587
736 Ga0495681_0068982
737 Ga0495681_0202504
738 Ga0495686_0002750
739 Ga0495686_0005943
740 Ga0495686_0032478
741 Ga0495686_0058995
742 Ga0495615_0001327
743 Ga0495626_0093521
744 Ga0496100_0450680
745 Ga0496103_0001127
746 Ga0496107_0883337
747 Ga0496109_1002587
748 Ga0496111_1054109
749 Ga0496114_0162557
750 Ga0496119_0139778
751 Ga0496121_0227366
752 Ga0496122_0069316
753 Ga0496123_0008272
754 Ga0496124_0156391
755 Ga0496126_0043656
756 Ga0495678_000278
757 Ga0495678_004335
758 Ga0495678_022953
759 Ga0495678_023903
760 Ga0495678_107438
761 Ga0495682_0000515
762 Ga0495682_0000614
763 Ga0495682_0129548
764 Ga0501315_073780
765 Ga0501227_067565
766 Ga0501249_010931
767 Ga0501269_001658
768 Ga0501279_025529
769 Ga0500644_0001775
770 Ga0500593_001823
771 Ga0500594_0203563
772 Ga0500618_001265
773 Ga0500586_012053
774 Ga0500645_000631
775 Ga0500645_001912
776 Ga0500645_064946
777 Ga0500661_004900
778 2644356055
779 2511242713
780 2644031337
781 2644250423
782 2738742612
783 2738826064
784 2738842384
785 2739149861
786 2739191780
787 2739273131
788 2739318257
789 2739336498
790 2739342175
791 2821136404
792 2904428484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13501

SoxY

Sulfur oxidation protein SoxY

63

173

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxh-assembly3.cif.gz_D the soxyz complex of paracoccus pantotrophus 0.8729 38 150
4brj-assembly1.cif.gz_A superoxide reductase (neelaredoxin) from ignicoccus hospitalis t24k 0.8727 56 149
4brv-assembly1.cif.gz_D superoxide reductase (neelaredoxin) from ignicoccus hospitalis e23a 0.8648 56 149
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8616 56 149
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8589 56 149
ID Description Score Start End Superfamily
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8865 38 150 2.60.40.2470
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8616 56 149 2.60.40.10
af_Q58151_5_116_2.60.40.730 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.8582 50 149 2.60.40.730
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.849 38 150 2.60.40.2470
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8446 36 149 2.60.40.2470
ID Description Score Start End GO Terms
AF-A0A526YJA9-F1-model_v4 Sulfur oxidation protein SoxY 0.9404 44 133
AF-A0A2V6WSE4-F1-model_v4 Ig-like SoxY domain-containing protein 0.9202 72 153
AF-W6KAT5-F1-model_v4 Putative thiosulfate-binding protein SoxY 0.918 37 149
AF-A0A7W3UBD8-F1-model_v4 deleted 0.9159 69 153
AF-A0A526YJA9-F1-model_v4 Sulfur oxidation protein SoxY 0.9113 44 133

Map