F433705
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 397 | 232 | 794 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300005441|Ga0070700_100067818|Ga0070700_1000678183 |
| Length | 100 |
| Sequence | MSPEHRHIPEPGELVHPPRLSWAPAVFAFALALTVCGIFAEGFMVRGWIYSIIGAVIALFAFRGMVRESVRDYYKLPRKQRVRGAVLPVEQISPPRRLID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 120 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 121 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 128 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 129 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 130 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 132 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 133 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 134 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 135 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 136 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 190 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 191 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 192 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 193 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 194 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 195 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 198 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 199 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 200 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 204 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 205 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 206 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 225 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 226 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 227 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.99 |
| Metatranscriptomes | 1.01 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.76 |
| Nodule | 0 |
| Rhizoplane | 9.82 |
| Rhizosphere | 87.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070700_100067818 | 3300005441 | Bacteria | 2267 |
| 2 | JGI24746J21847_1000113 | 3300001977 | Bacteria | 9482 |
| 3 | JGI24740J21852_10022756 | 3300001979 | Bacteria | 2152 |
| 4 | JGI24034J26672_10000115 | 3300002239 | Bacteria | 12949 |
| 5 | JGI24742J22300_10006668 | 3300002244 | Bacteria | 1904 |
| 6 | Ga0070683_100011312 | 3300005329 | Bacteria | 7707 |
| 7 | Ga0070683_100323447 | 3300005329 | Bacteria | 1468 |
| 8 | Ga0070683_100521332 | 3300005329 | Bacteria | 1136 |
| 9 | Ga0070683_100775681 | 3300005329 | Unclassified | 919 |
| 10 | Ga0070677_10000521 | 3300005333 | Bacteria | 13187 |
| 11 | Ga0070682_100000023 | 3300005337 | Bacteria | 206016 |
| 12 | Ga0070682_100355105 | 3300005337 | Bacteria | 1094 |
| 13 | Ga0068868_100000694 | 3300005338 | Bacteria | 22626 |
| 14 | Ga0070689_100150788 | 3300005340 | Bacteria | 1875 |
| 15 | Ga0070691_10000004 | 3300005341 | Bacteria | 80156 |
| 16 | Ga0070691_10000970 | 3300005341 | Bacteria | 11707 |
| 17 | Ga0070661_100790109 | 3300005344 | Unclassified | 778 |
| 18 | Ga0070668_100297547 | 3300005347 | Bacteria | 1353 |
| 19 | Ga0070669_100395911 | 3300005353 | Unclassified | 1129 |
| 20 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 21 | Ga0070674_100000141 | 3300005356 | Bacteria | 33366 |
| 22 | Ga0070674_100224244 | 3300005356 | Unclassified | 1464 |
| 23 | Ga0070673_100005888 | 3300005364 | Bacteria | 7910 |
| 24 | Ga0070659_100003678 | 3300005366 | Bacteria | 10933 |
| 25 | Ga0070659_101539916 | 3300005366 | Bacteria | 593 |
| 26 | Ga0070667_100001110 | 3300005367 | Bacteria | 24556 |
| 27 | Ga0070667_100672146 | 3300005367 | Bacteria | 957 |
| 28 | Ga0070714_101033150 | 3300005435 | Bacteria | 800 |
| 29 | Ga0070701_11173314 | 3300005438 | Unclassified | 544 |
| 30 | Ga0070700_100035172 | 3300005441 | Bacteria | 3030 |
| 31 | Ga0070694_101190561 | 3300005444 | Bacteria | 638 |
| 32 | Ga0070663_101793802 | 3300005455 | Bacteria | 550 |
| 33 | Ga0070678_100648231 | 3300005456 | Unclassified | 947 |
| 34 | Ga0070662_100000001 | 3300005457 | Bacteria | 317995 |
| 35 | Ga0070681_10037706 | 3300005458 | Bacteria | 4849 |
| 36 | Ga0068867_100000078 | 3300005459 | Bacteria | 59729 |
| 37 | Ga0070679_100000424 | 3300005530 | Bacteria | 35927 |
| 38 | Ga0070679_101103229 | 3300005530 | Bacteria | 738 |
| 39 | Ga0070684_100014422 | 3300005535 | Bacteria | 6403 |
| 40 | Ga0070684_100695614 | 3300005535 | Bacteria | 948 |
| 41 | Ga0068853_100007596 | 3300005539 | Bacteria | 8682 |
| 42 | Ga0070695_100632745 | 3300005545 | Bacteria | 843 |
| 43 | Ga0070693_100001267 | 3300005547 | Bacteria | 11429 |
| 44 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 45 | Ga0070665_100042444 | 3300005548 | Bacteria | 4572 |
| 46 | Ga0068855_101016967 | 3300005563 | Bacteria | 870 |
| 47 | Ga0068854_100097017 | 3300005578 | Bacteria | 2203 |
| 48 | Ga0068854_102046354 | 3300005578 | Unclassified | 528 |
| 49 | Ga0068856_100013363 | 3300005614 | Bacteria | 7950 |
| 50 | Ga0068856_100563038 | 3300005614 | Bacteria | 1161 |
| 51 | Ga0068856_101787964 | 3300005614 | Bacteria | 626 |
| 52 | Ga0068852_101493211 | 3300005616 | Bacteria | 698 |
| 53 | Ga0068866_10000004 | 3300005718 | Bacteria | 202810 |
| 54 | Ga0068866_10000206 | 3300005718 | Bacteria | 27716 |
| 55 | Ga0068866_10016679 | 3300005718 | Bacteria | 3289 |
| 56 | Ga0068861_100220052 | 3300005719 | Unclassified | 1604 |
| 57 | Ga0068863_100000261 | 3300005841 | Bacteria | 55053 |
| 58 | Ga0068863_100190446 | 3300005841 | Bacteria | 1971 |
| 59 | Ga0068858_100001180 | 3300005842 | Bacteria | 27065 |
| 60 | Ga0068860_100085478 | 3300005843 | Bacteria | 3002 |
| 61 | Ga0068860_100474956 | 3300005843 | Bacteria | 1246 |
| 62 | Ga0068862_100017783 | 3300005844 | Bacteria | 5917 |
| 63 | Ga0081455_10004942 | 3300005937 | Bacteria | 14737 |
| 64 | Ga0081540_1000557 | 3300005983 | Bacteria | 36162 |
| 65 | Ga0070715_10000008 | 3300006163 | Bacteria | 189899 |
| 66 | Ga0070716_100016440 | 3300006173 | Bacteria | 3819 |
| 67 | Ga0070712_100202320 | 3300006175 | Bacteria | 1561 |
| 68 | Ga0070712_100569908 | 3300006175 | Bacteria | 956 |
| 69 | Ga0070712_100844868 | 3300006175 | Bacteria | 787 |
| 70 | Ga0068871_100310952 | 3300006358 | Bacteria | 1385 |
| 71 | Ga0075430_100206320 | 3300006846 | Bacteria | 1631 |
| 72 | Ga0075433_10000337 | 3300006852 | Bacteria | 29062 |
| 73 | Ga0068865_100373458 | 3300006881 | Bacteria | 1161 |
| 74 | Ga0105240_10627793 | 3300009093 | Bacteria | 1180 |
| 75 | Ga0105245_10000040 | 3300009098 | Bacteria | 144005 |
| 76 | Ga0105245_10000629 | 3300009098 | Bacteria | 32084 |
| 77 | Ga0105247_10000131 | 3300009101 | Bacteria | 72578 |
| 78 | Ga0105243_10193364 | 3300009148 | Bacteria | 1779 |
| 79 | Ga0105242_10000063 | 3300009176 | Bacteria | 74721 |
| 80 | Ga0105242_10000428 | 3300009176 | Bacteria | 33565 |
| 81 | Ga0105242_10161703 | 3300009176 | Bacteria | 1961 |
| 82 | Ga0105238_10000033 | 3300009551 | Bacteria | 172981 |
| 83 | Ga0105238_10563617 | 3300009551 | Bacteria | 1144 |
| 84 | Ga0105249_10000218 | 3300009553 | Bacteria | 65480 |
| 85 | Ga0105249_10017915 | 3300009553 | Bacteria | 6294 |
| 86 | Ga0105249_10109690 | 3300009553 | Bacteria | 2607 |
| 87 | Ga0105249_10738102 | 3300009553 | Bacteria | 1046 |
| 88 | Ga0105239_11139727 | 3300010375 | Unclassified | 898 |
| 89 | Ga0105239_12905659 | 3300010375 | Unclassified | 559 |
| 90 | Ga0105246_10182023 | 3300011119 | Bacteria | 1619 |
| 91 | Ga0105246_10545482 | 3300011119 | Bacteria | 993 |
| 92 | Ga0105246_11024624 | 3300011119 | Unclassified | 749 |
| 93 | Ga0157342_1086216 | 3300012507 | Bacteria | 502 |
| 94 | Ga0157374_10001719 | 3300013296 | Bacteria | 18377 |
| 95 | Ga0157374_10101946 | 3300013296 | Bacteria | 2752 |
| 96 | Ga0157374_10430667 | 3300013296 | Bacteria | 1319 |
| 97 | Ga0157378_10118657 | 3300013297 | Bacteria | 2435 |
| 98 | Ga0157378_11046379 | 3300013297 | Unclassified | 852 |
| 99 | Ga0163162_10504488 | 3300013306 | Bacteria | 1340 |
| 100 | Ga0157372_11179541 | 3300013307 | Bacteria | 885 |
| 101 | Ga0157375_10318422 | 3300013308 | Bacteria | 1720 |
| 102 | Ga0157375_12514616 | 3300013308 | Bacteria | 615 |
| 103 | Ga0157375_12897676 | 3300013308 | Unclassified | 573 |
| 104 | Ga0163163_10278387 | 3300014325 | Bacteria | 1724 |
| 105 | Ga0163163_10771727 | 3300014325 | Bacteria | 1025 |
| 106 | Ga0163163_11593631 | 3300014325 | Unclassified | 714 |
| 107 | Ga0163163_12519022 | 3300014325 | Unclassified | 572 |
| 108 | Ga0157380_10001343 | 3300014326 | Bacteria | 16023 |
| 109 | Ga0157379_10056698 | 3300014968 | Bacteria | 3500 |
| 110 | Ga0157379_10088527 | 3300014968 | Unclassified | 2777 |
| 111 | Ga0157379_10141140 | 3300014968 | Bacteria | 2172 |
| 112 | Ga0163161_10010899 | 3300017792 | Bacteria | 6303 |
| 113 | Ga0163161_10519933 | 3300017792 | Bacteria | 972 |
| 114 | Ga0207682_10000769 | 3300025893 | Bacteria | 14799 |
| 115 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 116 | Ga0207642_10000737 | 3300025899 | Bacteria | 10119 |
| 117 | Ga0207642_10019348 | 3300025899 | Bacteria | 2635 |
| 118 | Ga0207710_10000268 | 3300025900 | Bacteria | 42956 |
| 119 | Ga0207685_10000012 | 3300025905 | Bacteria | 189900 |
| 120 | Ga0207707_10059817 | 3300025912 | Bacteria | 3315 |
| 121 | Ga0207693_10199974 | 3300025915 | Bacteria | 1572 |
| 122 | Ga0207693_10772349 | 3300025915 | Unclassified | 741 |
| 123 | Ga0207660_10004388 | 3300025917 | Bacteria | 9200 |
| 124 | Ga0207657_10166653 | 3300025919 | Bacteria | 1787 |
| 125 | Ga0207652_10000232 | 3300025921 | Bacteria | 58473 |
| 126 | Ga0207652_11635212 | 3300025921 | Bacteria | 548 |
| 127 | Ga0207681_11346474 | 3300025923 | Bacteria | 599 |
| 128 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 129 | Ga0207694_10496541 | 3300025924 | Bacteria | 1022 |
| 130 | Ga0207650_10359573 | 3300025925 | Bacteria | 1199 |
| 131 | Ga0207659_11772584 | 3300025926 | Bacteria | 525 |
| 132 | Ga0207687_10000046 | 3300025927 | Bacteria | 99576 |
| 133 | Ga0207687_10000095 | 3300025927 | Bacteria | 64664 |
| 134 | Ga0207664_10852307 | 3300025929 | Bacteria | 819 |
| 135 | Ga0207690_10002537 | 3300025932 | Bacteria | 11031 |
| 136 | Ga0207706_10000003 | 3300025933 | Bacteria | 345011 |
| 137 | Ga0207686_10000230 | 3300025934 | Bacteria | 42566 |
| 138 | Ga0207686_10000395 | 3300025934 | Bacteria | 30349 |
| 139 | Ga0207686_10056822 | 3300025934 | Bacteria | 2461 |
| 140 | Ga0207709_10027191 | 3300025935 | Bacteria | 3292 |
| 141 | Ga0207670_10108432 | 3300025936 | Bacteria | 1996 |
| 142 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 143 | Ga0207669_10000021 | 3300025937 | Bacteria | 100327 |
| 144 | Ga0207669_10107293 | 3300025937 | Bacteria | 1862 |
| 145 | Ga0207704_10245347 | 3300025938 | Bacteria | 1341 |
| 146 | Ga0207704_10264416 | 3300025938 | Bacteria | 1299 |
| 147 | Ga0207665_10045426 | 3300025939 | Bacteria | 2941 |
| 148 | Ga0207661_10007065 | 3300025944 | Bacteria | 7970 |
| 149 | Ga0207661_10183130 | 3300025944 | Bacteria | 1831 |
| 150 | Ga0207661_10527283 | 3300025944 | Bacteria | 1081 |
| 151 | Ga0207667_10700316 | 3300025949 | Bacteria | 1015 |
| 152 | Ga0207651_10003288 | 3300025960 | Bacteria | 7914 |
| 153 | Ga0207712_10000027 | 3300025961 | Bacteria | 263739 |
| 154 | Ga0207712_10012099 | 3300025961 | Bacteria | 5510 |
| 155 | Ga0207712_11213984 | 3300025961 | Bacteria | 673 |
| 156 | Ga0207668_10112373 | 3300025972 | Bacteria | 2046 |
| 157 | Ga0207640_10047856 | 3300025981 | Bacteria | 2761 |
| 158 | Ga0207640_11632029 | 3300025981 | Unclassified | 581 |
| 159 | Ga0207658_10001811 | 3300025986 | Bacteria | 15995 |
| 160 | Ga0207677_10003648 | 3300026023 | Bacteria | 8170 |
| 161 | Ga0207703_10000020 | 3300026035 | Bacteria | 251603 |
| 162 | Ga0207703_12161706 | 3300026035 | Bacteria | 533 |
| 163 | Ga0207639_10032914 | 3300026041 | Bacteria | 3821 |
| 164 | Ga0207708_10040974 | 3300026075 | Bacteria | 3532 |
| 165 | Ga0207708_10052500 | 3300026075 | Bacteria | 3105 |
| 166 | Ga0207702_10001788 | 3300026078 | Bacteria | 21174 |
| 167 | Ga0207702_10214281 | 3300026078 | Bacteria | 1792 |
| 168 | Ga0207702_12466500 | 3300026078 | Bacteria | 507 |
| 169 | Ga0207641_10000062 | 3300026088 | Bacteria | 159982 |
| 170 | Ga0207641_10011027 | 3300026088 | Bacteria | 7412 |
| 171 | Ga0207641_11327663 | 3300026088 | Bacteria | 720 |
| 172 | Ga0207648_10000457 | 3300026089 | Bacteria | 45386 |
| 173 | Ga0207683_10080282 | 3300026121 | Bacteria | 2893 |
| 174 | Ga0207698_11593350 | 3300026142 | Bacteria | 668 |
| 175 | Ga0207698_11721077 | 3300026142 | Bacteria | 642 |
| 176 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 177 | Ga0268266_10024467 | 3300028379 | Bacteria | 5135 |
| 178 | Ga0268265_10001768 | 3300028380 | Bacteria | 17341 |
| 179 | Ga0268264_10001191 | 3300028381 | Bacteria | 25160 |
| 180 | Ga0268264_10227716 | 3300028381 | Bacteria | 1719 |
| 181 | Ga0265337_1001256 | 3300028556 | Bacteria | 12773 |
| 182 | Ga0265326_10000452 | 3300028558 | Bacteria | 16152 |
| 183 | Ga0265322_10000005 | 3300028654 | Bacteria | 246112 |
| 184 | Ga0265336_10012464 | 3300028666 | Bacteria | 2862 |
| 185 | Ga0265338_10659755 | 3300028800 | Bacteria | 724 |
| 186 | Ga0265324_10000183 | 3300029957 | Bacteria | 48185 |
| 187 | Ga0265328_10014040 | 3300031239 | Bacteria | 3160 |
| 188 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 189 | Ga0265329_10001050 | 3300031242 | Bacteria | 13701 |
| 190 | Ga0265339_10014859 | 3300031249 | Bacteria | 4682 |
| 191 | Ga0265331_10000217 | 3300031250 | Bacteria | 69142 |
| 192 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 193 | Ga0265316_10055023 | 3300031344 | Bacteria | 3114 |
| 194 | Ga0265314_10000491 | 3300031711 | Bacteria | 51373 |
| 195 | Ga0373954_0471180 | 3300035118 | Bacteria | 622 |
| 196 | Ga0373957_0154340 | 3300035120 | Bacteria | 943 |
| 197 | Ga0373955_0250587 | 3300035172 | Bacteria | 1061 |
| 198 | Ga0373937_0307430 | 3300036401 | Bacteria | 1499 |
| 199 | Ga0373937_1391319 | 3300036401 | Bacteria | 649 |
| 200 | Ga0451837_0535800 | 3300041494 | Unclassified | 821 |
| 201 | Ga0451853_1793063 | 3300041512 | Bacteria | 3429 |
| 202 | Ga0451853_2416291 | 3300041512 | Bacteria | 821 |
| 203 | Ga0466963_0000233 | 3300044694 | Bacteria | 24036 |
| 204 | Ga0466963_0746205 | 3300044694 | Bacteria | 690 |
| 205 | Ga0466960_0752939 | 3300044901 | Bacteria | 587 |
| 206 | Ga0466967_0005859 | 3300045976 | Bacteria | 8601 |
| 207 | Ga0466967_0027611 | 3300045976 | Bacteria | 4724 |
| 208 | Ga0466967_1988103 | 3300045976 | Bacteria | 578 |
| 209 | Ga0495592_0000024 | 3300046454 | Bacteria | 136661 |
| 210 | Ga0495592_0411719 | 3300046454 | Bacteria | 854 |
| 211 | Ga0495603_0000102 | 3300046455 | Bacteria | 40074 |
| 212 | Ga0495603_0001201 | 3300046455 | Bacteria | 15127 |
| 213 | Ga0495591_048307 | 3300046458 | Unclassified | 1174 |
| 214 | Ga0495629_0029414 | 3300046459 | Bacteria | 3896 |
| 215 | Ga0495629_0050917 | 3300046459 | Bacteria | 2899 |
| 216 | Ga0495629_0922763 | 3300046459 | Unclassified | 571 |
| 217 | Ga0495641_0000004 | 3300046461 | Bacteria | 210501 |
| 218 | Ga0495641_0073208 | 3300046461 | Bacteria | 1537 |
| 219 | Ga0495651_0069917 | 3300046462 | Bacteria | 2672 |
| 220 | Ga0495651_0115113 | 3300046462 | Bacteria | 1983 |
| 221 | Ga0495651_0134502 | 3300046462 | Unclassified | 1801 |
| 222 | Ga0495651_0531304 | 3300046462 | Unclassified | 749 |
| 223 | Ga0495653_0025770 | 3300046463 | Bacteria | 4718 |
| 224 | Ga0495653_0086541 | 3300046463 | Bacteria | 2303 |
| 225 | Ga0495653_0909122 | 3300046463 | Unclassified | 524 |
| 226 | Ga0495582_0000003 | 3300046473 | Bacteria | 168880 |
| 227 | Ga0495639_0027981 | 3300046475 | Bacteria | 2497 |
| 228 | Ga0495662_0001473 | 3300046476 | Bacteria | 11649 |
| 229 | Ga0495662_0230468 | 3300046476 | Bacteria | 913 |
| 230 | Ga0495662_0382752 | 3300046476 | Unclassified | 691 |
| 231 | Ga0495608_0139905 | 3300046511 | Bacteria | 1545 |
| 232 | Ga0495608_0174767 | 3300046511 | Bacteria | 1361 |
| 233 | Ga0495618_0000267 | 3300046514 | Bacteria | 37924 |
| 234 | Ga0495618_0231994 | 3300046514 | Bacteria | 1162 |
| 235 | Ga0495618_0891113 | 3300046514 | Bacteria | 514 |
| 236 | Ga0495620_0000041 | 3300046515 | Bacteria | 112605 |
| 237 | Ga0495628_0000794 | 3300046516 | Bacteria | 29108 |
| 238 | Ga0495628_0106291 | 3300046516 | Bacteria | 2162 |
| 239 | Ga0495628_0317929 | 3300046516 | Bacteria | 1149 |
| 240 | Ga0495628_0489608 | 3300046516 | Bacteria | 889 |
| 241 | Ga0495628_1073971 | 3300046516 | Unclassified | 551 |
| 242 | Ga0495630_0000026 | 3300046517 | Bacteria | 147084 |
| 243 | Ga0495630_0007095 | 3300046517 | Bacteria | 7981 |
| 244 | Ga0495630_0286628 | 3300046517 | Bacteria | 1258 |
| 245 | Ga0495644_0056326 | 3300046523 | Bacteria | 1477 |
| 246 | Ga0495652_0000018 | 3300046529 | Bacteria | 201634 |
| 247 | Ga0495652_0084431 | 3300046529 | Bacteria | 2611 |
| 248 | Ga0495652_0116183 | 3300046529 | Bacteria | 2143 |
| 249 | Ga0495640_0039697 | 3300046533 | Bacteria | 3301 |
| 250 | Ga0495640_0205499 | 3300046533 | Bacteria | 1247 |
| 251 | Ga0495586_0000254 | 3300046535 | Bacteria | 35015 |
| 252 | Ga0495587_0000272 | 3300046536 | Bacteria | 36939 |
| 253 | Ga0495587_0065886 | 3300046536 | Bacteria | 2114 |
| 254 | Ga0495587_0515917 | 3300046536 | Bacteria | 660 |
| 255 | Ga0495598_0102931 | 3300046537 | Bacteria | 947 |
| 256 | Ga0495621_0000692 | 3300046539 | Bacteria | 8511 |
| 257 | Ga0495645_0006138 | 3300046543 | Bacteria | 8316 |
| 258 | Ga0495645_0008553 | 3300046543 | Bacteria | 7148 |
| 259 | Ga0495645_0133365 | 3300046543 | Bacteria | 1739 |
| 260 | Ga0495667_0000038 | 3300046559 | Bacteria | 131349 |
| 261 | Ga0495656_0083945 | 3300046615 | Unclassified | 1443 |
| 262 | Ga0495668_0281900 | 3300046616 | Bacteria | 910 |
| 263 | Ga0495634_0001691 | 3300046642 | Bacteria | 19214 |
| 264 | Ga0495634_0012207 | 3300046642 | Bacteria | 6228 |
| 265 | Ga0495634_0107580 | 3300046642 | Unclassified | 1796 |
| 266 | Ga0495634_0148467 | 3300046642 | Bacteria | 1484 |
| 267 | Ga0495634_0467053 | 3300046642 | Bacteria | 743 |
| 268 | Ga0495635_0000005 | 3300046663 | Bacteria | 302178 |
| 269 | Ga0495635_0331532 | 3300046663 | Unclassified | 1017 |
| 270 | Ga0495635_0818381 | 3300046663 | Bacteria | 599 |
| 271 | Ga0495588_0067415 | 3300046674 | Bacteria | 1858 |
| 272 | Ga0495657_0026099 | 3300046675 | Bacteria | 4141 |
| 273 | Ga0495657_0027840 | 3300046675 | Bacteria | 3982 |
| 274 | Ga0495599_0103286 | 3300046678 | Bacteria | 1776 |
| 275 | Ga0495599_0259516 | 3300046678 | Bacteria | 1056 |
| 276 | Ga0495599_0261031 | 3300046678 | Bacteria | 1052 |
| 277 | Ga0495623_0121912 | 3300046679 | Bacteria | 1569 |
| 278 | Ga0495646_0630144 | 3300046680 | Unclassified | 543 |
| 279 | Ga0495647_0000005 | 3300046681 | Bacteria | 125996 |
| 280 | Ga0495647_0003950 | 3300046681 | Bacteria | 4782 |
| 281 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 282 | Ga0495669_0003848 | 3300046684 | Bacteria | 6171 |
| 283 | Ga0495669_0148670 | 3300046684 | Bacteria | 1108 |
| 284 | Ga0495613_0009561 | 3300046689 | Bacteria | 7202 |
| 285 | Ga0495624_0000123 | 3300046690 | Bacteria | 54291 |
| 286 | Ga0495624_0019486 | 3300046690 | Bacteria | 4525 |
| 287 | Ga0495670_0016012 | 3300046691 | Bacteria | 3686 |
| 288 | Ga0495649_0007918 | 3300046694 | Bacteria | 6430 |
| 289 | Ga0495600_0007613 | 3300046809 | Bacteria | 6634 |
| 290 | Ga0495600_0030031 | 3300046809 | Bacteria | 3520 |
| 291 | Ga0495600_0836501 | 3300046809 | Unclassified | 546 |
| 292 | Ga0495604_0000100 | 3300047317 | Bacteria | 72995 |
| 293 | Ga0495674_0242694 | 3300047319 | Bacteria | 1484 |
| 294 | Ga0495672_0286782 | 3300047320 | Bacteria | 785 |
| 295 | Ga0495676_0034965 | 3300047321 | Bacteria | 4209 |
| 296 | Ga0495676_0090530 | 3300047321 | Bacteria | 2289 |
| 297 | Ga0495676_0230640 | 3300047321 | Bacteria | 1272 |
| 298 | Ga0495680_0000007 | 3300047322 | Bacteria | 152053 |
| 299 | Ga0495680_0000929 | 3300047322 | Bacteria | 32526 |
| 300 | Ga0495680_0001001 | 3300047322 | Bacteria | 31451 |
| 301 | Ga0495680_0039839 | 3300047322 | Bacteria | 3746 |
| 302 | Ga0495680_0604863 | 3300047322 | Bacteria | 733 |
| 303 | Ga0495679_188677 | 3300047446 | Bacteria | 544 |
| 304 | Ga0495685_083819 | 3300047447 | Bacteria | 1060 |
| 305 | Ga0495684_0156167 | 3300047471 | Bacteria | 1704 |
| 306 | Ga0495684_0259560 | 3300047471 | Bacteria | 1261 |
| 307 | Ga0495684_0327145 | 3300047471 | Bacteria | 1094 |
| 308 | Ga0495686_0122196 | 3300047472 | Unclassified | 1550 |
| 309 | Ga0495593_0240373 | 3300047673 | Bacteria | 907 |
| 310 | Ga0495593_0534144 | 3300047673 | Bacteria | 588 |
| 311 | Ga0496100_0000024 | 3300048903 | Bacteria | 116138 |
| 312 | Ga0496100_0556138 | 3300048903 | Bacteria | 888 |
| 313 | Ga0496101_0000072 | 3300048904 | Bacteria | 116138 |
| 314 | Ga0496102_0000749 | 3300048905 | Bacteria | 31723 |
| 315 | Ga0496103_0003112 | 3300048906 | Bacteria | 10202 |
| 316 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 317 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 318 | Ga0496104_0000230 | 3300048907 | Bacteria | 49225 |
| 319 | Ga0496104_0163739 | 3300048907 | Bacteria | 2133 |
| 320 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 321 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 322 | Ga0496105_0000051 | 3300048908 | Bacteria | 90365 |
| 323 | Ga0496105_0008261 | 3300048908 | Bacteria | 8095 |
| 324 | Ga0496105_0443054 | 3300048908 | Bacteria | 1026 |
| 325 | Ga0496106_0000040 | 3300048909 | Bacteria | 108754 |
| 326 | Ga0496106_0000042 | 3300048909 | Bacteria | 106662 |
| 327 | Ga0496107_0000025 | 3300048910 | Bacteria | 116138 |
| 328 | Ga0496107_0030281 | 3300048910 | Bacteria | 3857 |
| 329 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 330 | Ga0496108_0082672 | 3300048911 | Bacteria | 2723 |
| 331 | Ga0496108_1053773 | 3300048911 | Unclassified | 693 |
| 332 | Ga0496109_0000013 | 3300048912 | Bacteria | 227469 |
| 333 | Ga0496109_0078451 | 3300048912 | Bacteria | 3041 |
| 334 | Ga0496109_0293051 | 3300048912 | Unclassified | 1534 |
| 335 | Ga0496110_0294825 | 3300048913 | Bacteria | 1477 |
| 336 | Ga0496110_0511679 | 3300048913 | Bacteria | 1093 |
| 337 | Ga0496111_0024236 | 3300048914 | Bacteria | 4270 |
| 338 | Ga0496111_0251455 | 3300048914 | Bacteria | 1312 |
| 339 | Ga0496112_0000026 | 3300048915 | Bacteria | 144758 |
| 340 | Ga0496112_0379325 | 3300048915 | Bacteria | 1355 |
| 341 | Ga0496113_0024269 | 3300048916 | Bacteria | 4307 |
| 342 | Ga0496113_0039531 | 3300048916 | Bacteria | 3472 |
| 343 | Ga0496113_0163366 | 3300048916 | Bacteria | 1761 |
| 344 | Ga0496113_0208263 | 3300048916 | Bacteria | 1556 |
| 345 | Ga0496113_0294269 | 3300048916 | Bacteria | 1299 |
| 346 | Ga0496114_0005156 | 3300048917 | Bacteria | 10194 |
| 347 | Ga0496114_0568013 | 3300048917 | Bacteria | 1001 |
| 348 | Ga0496115_0000016 | 3300048918 | Bacteria | 187067 |
| 349 | Ga0496115_0004801 | 3300048918 | Bacteria | 9806 |
| 350 | Ga0496118_0142297 | 3300048921 | Bacteria | 1518 |
| 351 | Ga0496119_0020058 | 3300048922 | Bacteria | 4891 |
| 352 | Ga0496120_0440931 | 3300048923 | Bacteria | 568 |
| 353 | Ga0501040_0113036 | 3300049576 | Bacteria | 1900 |
| 354 | Ga0501041_0831848 | 3300049577 | Bacteria | 592 |
| 355 | Ga0501042_0008317 | 3300049578 | Bacteria | 6842 |
| 356 | Ga0501042_0209477 | 3300049578 | Bacteria | 1406 |
| 357 | Ga0501046_0359694 | 3300049580 | Bacteria | 1056 |
| 358 | Ga0501046_0747894 | 3300049580 | Unclassified | 687 |
| 359 | Ga0501048_0230230 | 3300049582 | Bacteria | 1315 |
| 360 | Ga0501070_0013883 | 3300049586 | Bacteria | 6783 |
| 361 | Ga0501070_0811805 | 3300049586 | Bacteria | 734 |
| 362 | Ga0501071_0516753 | 3300049587 | Bacteria | 916 |
| 363 | Ga0501071_0670189 | 3300049587 | Bacteria | 798 |
| 364 | Ga0501075_0006173 | 3300049591 | Bacteria | 8237 |
| 365 | Ga0501075_0241094 | 3300049591 | Bacteria | 1378 |
| 366 | Ga0501076_0076532 | 3300049592 | Bacteria | 2684 |
| 367 | Ga0501076_1733526 | 3300049592 | Unclassified | 512 |
| 368 | Ga0501081_0346937 | 3300049743 | Bacteria | 1094 |
| 369 | Ga0501081_0468241 | 3300049743 | Bacteria | 937 |
| 370 | Ga0501045_0436084 | 3300049824 | Bacteria | 974 |
| 371 | nmdc:mga0qj67_183648_c1 | 3300050509 | Bacteria | 1699 |
| 372 | nmdc:mga08y16_816433_c1 | 3300050511 | Unclassified | 924 |
| 373 | nmdc:mga0a205_4_c1 | 3300050515 | Bacteria | 168154 |
| 374 | Ga0495601_0000318 | 3300053077 | Bacteria | 25520 |
| 375 | Ga0495601_0003205 | 3300053077 | Bacteria | 9362 |
| 376 | Ga0495601_0007036 | 3300053077 | Bacteria | 6593 |
| 377 | Ga0495601_0020026 | 3300053077 | Bacteria | 4083 |
| 378 | Ga0495601_0606829 | 3300053077 | Bacteria | 702 |
| 379 | Ga0495601_0841878 | 3300053077 | Unclassified | 581 |
| 380 | Ga0495612_0000155 | 3300053078 | Bacteria | 28711 |
| 381 | Ga0495612_0005239 | 3300053078 | Bacteria | 5356 |
| 382 | Ga0495612_0179560 | 3300053078 | Bacteria | 929 |
| 383 | Ga0495655_0000258 | 3300053083 | Bacteria | 9877 |
| 384 | Ga0495619_0000127 | 3300053085 | Bacteria | 55995 |
| 385 | Ga0495619_0003866 | 3300053085 | Bacteria | 9630 |
| 386 | Ga0495619_0007002 | 3300053085 | Bacteria | 7137 |
| 387 | Ga0495619_0044157 | 3300053085 | Bacteria | 2924 |
| 388 | Ga0495619_0458627 | 3300053085 | Bacteria | 878 |
| 389 | Ga0500566_0033940 | 3300053094 | Bacteria | 2971 |
| 390 | Ga0500614_000426 | 3300053123 | Bacteria | 10958 |
| 391 | Ga0500628_000072 | 3300053129 | Bacteria | 26251 |
| 392 | Ga0501084_0607606 | 3300054114 | Bacteria | 924 |
| 393 | Ga0587085_039045 | 3300059506 | Unclassified | 818 |
| 394 | Ga0587092_104241 | 3300059512 | Unclassified | 588 |
| 395 | Ga0587127_031234 | 3300059629 | Unclassified | 511 |
| 396 | Ga0587128_142575 | 3300059630 | Unclassified | 539 |
| 397 | Ga0501082_0412093 | 3300060353 | Bacteria | 1180 |
| 398 | Ga0070700_100067818 | |||
| 399 | JGI24746J21847_1000113 | |||
| 400 | JGI24740J21852_10022756 | |||
| 401 | JGI24034J26672_10000115 | |||
| 402 | JGI24742J22300_10006668 | |||
| 403 | Ga0070683_100011312 | |||
| 404 | Ga0070683_100323447 | |||
| 405 | Ga0070683_100521332 | |||
| 406 | Ga0070683_100775681 | |||
| 407 | Ga0070677_10000521 | |||
| 408 | Ga0070682_100000023 | |||
| 409 | Ga0070682_100355105 | |||
| 410 | Ga0068868_100000694 | |||
| 411 | Ga0070689_100150788 | |||
| 412 | Ga0070691_10000004 | |||
| 413 | Ga0070691_10000970 | |||
| 414 | Ga0070661_100790109 | |||
| 415 | Ga0070668_100297547 | |||
| 416 | Ga0070669_100395911 | |||
| 417 | Ga0070674_100000002 | |||
| 418 | Ga0070674_100000141 | |||
| 419 | Ga0070674_100224244 | |||
| 420 | Ga0070673_100005888 | |||
| 421 | Ga0070659_100003678 | |||
| 422 | Ga0070659_101539916 | |||
| 423 | Ga0070667_100001110 | |||
| 424 | Ga0070667_100672146 | |||
| 425 | Ga0070714_101033150 | |||
| 426 | Ga0070701_11173314 | |||
| 427 | Ga0070700_100035172 | |||
| 428 | Ga0070694_101190561 | |||
| 429 | Ga0070663_101793802 | |||
| 430 | Ga0070678_100648231 | |||
| 431 | Ga0070662_100000001 | |||
| 432 | Ga0070681_10037706 | |||
| 433 | Ga0068867_100000078 | |||
| 434 | Ga0070679_100000424 | |||
| 435 | Ga0070679_101103229 | |||
| 436 | Ga0070684_100014422 | |||
| 437 | Ga0070684_100695614 | |||
| 438 | Ga0068853_100007596 | |||
| 439 | Ga0070695_100632745 | |||
| 440 | Ga0070693_100001267 | |||
| 441 | Ga0070665_100000022 | |||
| 442 | Ga0070665_100042444 | |||
| 443 | Ga0068855_101016967 | |||
| 444 | Ga0068854_100097017 | |||
| 445 | Ga0068854_102046354 | |||
| 446 | Ga0068856_100013363 | |||
| 447 | Ga0068856_100563038 | |||
| 448 | Ga0068856_101787964 | |||
| 449 | Ga0068852_101493211 | |||
| 450 | Ga0068866_10000004 | |||
| 451 | Ga0068866_10000206 | |||
| 452 | Ga0068866_10016679 | |||
| 453 | Ga0068861_100220052 | |||
| 454 | Ga0068863_100000261 | |||
| 455 | Ga0068863_100190446 | |||
| 456 | Ga0068858_100001180 | |||
| 457 | Ga0068860_100085478 | |||
| 458 | Ga0068860_100474956 | |||
| 459 | Ga0068862_100017783 | |||
| 460 | Ga0081455_10004942 | |||
| 461 | Ga0081540_1000557 | |||
| 462 | Ga0070715_10000008 | |||
| 463 | Ga0070716_100016440 | |||
| 464 | Ga0070712_100202320 | |||
| 465 | Ga0070712_100569908 | |||
| 466 | Ga0070712_100844868 | |||
| 467 | Ga0068871_100310952 | |||
| 468 | Ga0075430_100206320 | |||
| 469 | Ga0075433_10000337 | |||
| 470 | Ga0068865_100373458 | |||
| 471 | Ga0105240_10627793 | |||
| 472 | Ga0105245_10000040 | |||
| 473 | Ga0105245_10000629 | |||
| 474 | Ga0105247_10000131 | |||
| 475 | Ga0105243_10193364 | |||
| 476 | Ga0105242_10000063 | |||
| 477 | Ga0105242_10000428 | |||
| 478 | Ga0105242_10161703 | |||
| 479 | Ga0105238_10000033 | |||
| 480 | Ga0105238_10563617 | |||
| 481 | Ga0105249_10000218 | |||
| 482 | Ga0105249_10017915 | |||
| 483 | Ga0105249_10109690 | |||
| 484 | Ga0105249_10738102 | |||
| 485 | Ga0105239_11139727 | |||
| 486 | Ga0105239_12905659 | |||
| 487 | Ga0105246_10182023 | |||
| 488 | Ga0105246_10545482 | |||
| 489 | Ga0105246_11024624 | |||
| 490 | Ga0157342_1086216 | |||
| 491 | Ga0157374_10001719 | |||
| 492 | Ga0157374_10101946 | |||
| 493 | Ga0157374_10430667 | |||
| 494 | Ga0157378_10118657 | |||
| 495 | Ga0157378_11046379 | |||
| 496 | Ga0163162_10504488 | |||
| 497 | Ga0157372_11179541 | |||
| 498 | Ga0157375_10318422 | |||
| 499 | Ga0157375_12514616 | |||
| 500 | Ga0157375_12897676 | |||
| 501 | Ga0163163_10278387 | |||
| 502 | Ga0163163_10771727 | |||
| 503 | Ga0163163_11593631 | |||
| 504 | Ga0163163_12519022 | |||
| 505 | Ga0157380_10001343 | |||
| 506 | Ga0157379_10056698 | |||
| 507 | Ga0157379_10088527 | |||
| 508 | Ga0157379_10141140 | |||
| 509 | Ga0163161_10010899 | |||
| 510 | Ga0163161_10519933 | |||
| 511 | Ga0207682_10000769 | |||
| 512 | Ga0207642_10000005 | |||
| 513 | Ga0207642_10000737 | |||
| 514 | Ga0207642_10019348 | |||
| 515 | Ga0207710_10000268 | |||
| 516 | Ga0207685_10000012 | |||
| 517 | Ga0207707_10059817 | |||
| 518 | Ga0207693_10199974 | |||
| 519 | Ga0207693_10772349 | |||
| 520 | Ga0207660_10004388 | |||
| 521 | Ga0207657_10166653 | |||
| 522 | Ga0207652_10000232 | |||
| 523 | Ga0207652_11635212 | |||
| 524 | Ga0207681_11346474 | |||
| 525 | Ga0207694_10000012 | |||
| 526 | Ga0207694_10496541 | |||
| 527 | Ga0207650_10359573 | |||
| 528 | Ga0207659_11772584 | |||
| 529 | Ga0207687_10000046 | |||
| 530 | Ga0207687_10000095 | |||
| 531 | Ga0207664_10852307 | |||
| 532 | Ga0207690_10002537 | |||
| 533 | Ga0207706_10000003 | |||
| 534 | Ga0207686_10000230 | |||
| 535 | Ga0207686_10000395 | |||
| 536 | Ga0207686_10056822 | |||
| 537 | Ga0207709_10027191 | |||
| 538 | Ga0207670_10108432 | |||
| 539 | Ga0207669_10000003 | |||
| 540 | Ga0207669_10000021 | |||
| 541 | Ga0207669_10107293 | |||
| 542 | Ga0207704_10245347 | |||
| 543 | Ga0207704_10264416 | |||
| 544 | Ga0207665_10045426 | |||
| 545 | Ga0207661_10007065 | |||
| 546 | Ga0207661_10183130 | |||
| 547 | Ga0207661_10527283 | |||
| 548 | Ga0207667_10700316 | |||
| 549 | Ga0207651_10003288 | |||
| 550 | Ga0207712_10000027 | |||
| 551 | Ga0207712_10012099 | |||
| 552 | Ga0207712_11213984 | |||
| 553 | Ga0207668_10112373 | |||
| 554 | Ga0207640_10047856 | |||
| 555 | Ga0207640_11632029 | |||
| 556 | Ga0207658_10001811 | |||
| 557 | Ga0207677_10003648 | |||
| 558 | Ga0207703_10000020 | |||
| 559 | Ga0207703_12161706 | |||
| 560 | Ga0207639_10032914 | |||
| 561 | Ga0207708_10040974 | |||
| 562 | Ga0207708_10052500 | |||
| 563 | Ga0207702_10001788 | |||
| 564 | Ga0207702_10214281 | |||
| 565 | Ga0207702_12466500 | |||
| 566 | Ga0207641_10000062 | |||
| 567 | Ga0207641_10011027 | |||
| 568 | Ga0207641_11327663 | |||
| 569 | Ga0207648_10000457 | |||
| 570 | Ga0207683_10080282 | |||
| 571 | Ga0207698_11593350 | |||
| 572 | Ga0207698_11721077 | |||
| 573 | Ga0268266_10000029 | |||
| 574 | Ga0268266_10024467 | |||
| 575 | Ga0268265_10001768 | |||
| 576 | Ga0268264_10001191 | |||
| 577 | Ga0268264_10227716 | |||
| 578 | Ga0265337_1001256 | |||
| 579 | Ga0265326_10000452 | |||
| 580 | Ga0265322_10000005 | |||
| 581 | Ga0265336_10012464 | |||
| 582 | Ga0265338_10659755 | |||
| 583 | Ga0265324_10000183 | |||
| 584 | Ga0265328_10014040 | |||
| 585 | Ga0265320_10000010 | |||
| 586 | Ga0265329_10001050 | |||
| 587 | Ga0265339_10014859 | |||
| 588 | Ga0265331_10000217 | |||
| 589 | Ga0265327_10000040 | |||
| 590 | Ga0265316_10055023 | |||
| 591 | Ga0265314_10000491 | |||
| 592 | Ga0373954_0471180 | |||
| 593 | Ga0373957_0154340 | |||
| 594 | Ga0373955_0250587 | |||
| 595 | Ga0373937_0307430 | |||
| 596 | Ga0373937_1391319 | |||
| 597 | Ga0451837_0535800 | |||
| 598 | Ga0451853_1793063 | |||
| 599 | Ga0451853_2416291 | |||
| 600 | Ga0466963_0000233 | |||
| 601 | Ga0466963_0746205 | |||
| 602 | Ga0466960_0752939 | |||
| 603 | Ga0466967_0005859 | |||
| 604 | Ga0466967_0027611 | |||
| 605 | Ga0466967_1988103 | |||
| 606 | Ga0495592_0000024 | |||
| 607 | Ga0495592_0411719 | |||
| 608 | Ga0495603_0000102 | |||
| 609 | Ga0495603_0001201 | |||
| 610 | Ga0495591_048307 | |||
| 611 | Ga0495629_0029414 | |||
| 612 | Ga0495629_0050917 | |||
| 613 | Ga0495629_0922763 | |||
| 614 | Ga0495641_0000004 | |||
| 615 | Ga0495641_0073208 | |||
| 616 | Ga0495651_0069917 | |||
| 617 | Ga0495651_0115113 | |||
| 618 | Ga0495651_0134502 | |||
| 619 | Ga0495651_0531304 | |||
| 620 | Ga0495653_0025770 | |||
| 621 | Ga0495653_0086541 | |||
| 622 | Ga0495653_0909122 | |||
| 623 | Ga0495582_0000003 | |||
| 624 | Ga0495639_0027981 | |||
| 625 | Ga0495662_0001473 | |||
| 626 | Ga0495662_0230468 | |||
| 627 | Ga0495662_0382752 | |||
| 628 | Ga0495608_0139905 | |||
| 629 | Ga0495608_0174767 | |||
| 630 | Ga0495618_0000267 | |||
| 631 | Ga0495618_0231994 | |||
| 632 | Ga0495618_0891113 | |||
| 633 | Ga0495620_0000041 | |||
| 634 | Ga0495628_0000794 | |||
| 635 | Ga0495628_0106291 | |||
| 636 | Ga0495628_0317929 | |||
| 637 | Ga0495628_0489608 | |||
| 638 | Ga0495628_1073971 | |||
| 639 | Ga0495630_0000026 | |||
| 640 | Ga0495630_0007095 | |||
| 641 | Ga0495630_0286628 | |||
| 642 | Ga0495644_0056326 | |||
| 643 | Ga0495652_0000018 | |||
| 644 | Ga0495652_0084431 | |||
| 645 | Ga0495652_0116183 | |||
| 646 | Ga0495640_0039697 | |||
| 647 | Ga0495640_0205499 | |||
| 648 | Ga0495586_0000254 | |||
| 649 | Ga0495587_0000272 | |||
| 650 | Ga0495587_0065886 | |||
| 651 | Ga0495587_0515917 | |||
| 652 | Ga0495598_0102931 | |||
| 653 | Ga0495621_0000692 | |||
| 654 | Ga0495645_0006138 | |||
| 655 | Ga0495645_0008553 | |||
| 656 | Ga0495645_0133365 | |||
| 657 | Ga0495667_0000038 | |||
| 658 | Ga0495656_0083945 | |||
| 659 | Ga0495668_0281900 | |||
| 660 | Ga0495634_0001691 | |||
| 661 | Ga0495634_0012207 | |||
| 662 | Ga0495634_0107580 | |||
| 663 | Ga0495634_0148467 | |||
| 664 | Ga0495634_0467053 | |||
| 665 | Ga0495635_0000005 | |||
| 666 | Ga0495635_0331532 | |||
| 667 | Ga0495635_0818381 | |||
| 668 | Ga0495588_0067415 | |||
| 669 | Ga0495657_0026099 | |||
| 670 | Ga0495657_0027840 | |||
| 671 | Ga0495599_0103286 | |||
| 672 | Ga0495599_0259516 | |||
| 673 | Ga0495599_0261031 | |||
| 674 | Ga0495623_0121912 | |||
| 675 | Ga0495646_0630144 | |||
| 676 | Ga0495647_0000005 | |||
| 677 | Ga0495647_0003950 | |||
| 678 | Ga0495658_0000001 | |||
| 679 | Ga0495669_0003848 | |||
| 680 | Ga0495669_0148670 | |||
| 681 | Ga0495613_0009561 | |||
| 682 | Ga0495624_0000123 | |||
| 683 | Ga0495624_0019486 | |||
| 684 | Ga0495670_0016012 | |||
| 685 | Ga0495649_0007918 | |||
| 686 | Ga0495600_0007613 | |||
| 687 | Ga0495600_0030031 | |||
| 688 | Ga0495600_0836501 | |||
| 689 | Ga0495604_0000100 | |||
| 690 | Ga0495674_0242694 | |||
| 691 | Ga0495672_0286782 | |||
| 692 | Ga0495676_0034965 | |||
| 693 | Ga0495676_0090530 | |||
| 694 | Ga0495676_0230640 | |||
| 695 | Ga0495680_0000007 | |||
| 696 | Ga0495680_0000929 | |||
| 697 | Ga0495680_0001001 | |||
| 698 | Ga0495680_0039839 | |||
| 699 | Ga0495680_0604863 | |||
| 700 | Ga0495679_188677 | |||
| 701 | Ga0495685_083819 | |||
| 702 | Ga0495684_0156167 | |||
| 703 | Ga0495684_0259560 | |||
| 704 | Ga0495684_0327145 | |||
| 705 | Ga0495686_0122196 | |||
| 706 | Ga0495593_0240373 | |||
| 707 | Ga0495593_0534144 | |||
| 708 | Ga0496100_0000024 | |||
| 709 | Ga0496100_0556138 | |||
| 710 | Ga0496101_0000072 | |||
| 711 | Ga0496102_0000749 | |||
| 712 | Ga0496103_0003112 | |||
| 713 | Ga0496104_0000008 | |||
| 714 | Ga0496104_0000010 | |||
| 715 | Ga0496104_0000230 | |||
| 716 | Ga0496104_0163739 | |||
| 717 | Ga0496105_0000003 | |||
| 718 | Ga0496105_0000005 | |||
| 719 | Ga0496105_0000051 | |||
| 720 | Ga0496105_0008261 | |||
| 721 | Ga0496105_0443054 | |||
| 722 | Ga0496106_0000040 | |||
| 723 | Ga0496106_0000042 | |||
| 724 | Ga0496107_0000025 | |||
| 725 | Ga0496107_0030281 | |||
| 726 | Ga0496108_0000004 | |||
| 727 | Ga0496108_0082672 | |||
| 728 | Ga0496108_1053773 | |||
| 729 | Ga0496109_0000013 | |||
| 730 | Ga0496109_0078451 | |||
| 731 | Ga0496109_0293051 | |||
| 732 | Ga0496110_0294825 | |||
| 733 | Ga0496110_0511679 | |||
| 734 | Ga0496111_0024236 | |||
| 735 | Ga0496111_0251455 | |||
| 736 | Ga0496112_0000026 | |||
| 737 | Ga0496112_0379325 | |||
| 738 | Ga0496113_0024269 | |||
| 739 | Ga0496113_0039531 | |||
| 740 | Ga0496113_0163366 | |||
| 741 | Ga0496113_0208263 | |||
| 742 | Ga0496113_0294269 | |||
| 743 | Ga0496114_0005156 | |||
| 744 | Ga0496114_0568013 | |||
| 745 | Ga0496115_0000016 | |||
| 746 | Ga0496115_0004801 | |||
| 747 | Ga0496118_0142297 | |||
| 748 | Ga0496119_0020058 | |||
| 749 | Ga0496120_0440931 | |||
| 750 | Ga0501040_0113036 | |||
| 751 | Ga0501041_0831848 | |||
| 752 | Ga0501042_0008317 | |||
| 753 | Ga0501042_0209477 | |||
| 754 | Ga0501046_0359694 | |||
| 755 | Ga0501046_0747894 | |||
| 756 | Ga0501048_0230230 | |||
| 757 | Ga0501070_0013883 | |||
| 758 | Ga0501070_0811805 | |||
| 759 | Ga0501071_0516753 | |||
| 760 | Ga0501071_0670189 | |||
| 761 | Ga0501075_0006173 | |||
| 762 | Ga0501075_0241094 | |||
| 763 | Ga0501076_0076532 | |||
| 764 | Ga0501076_1733526 | |||
| 765 | Ga0501081_0346937 | |||
| 766 | Ga0501081_0468241 | |||
| 767 | Ga0501045_0436084 | |||
| 768 | nmdc:mga0qj67_183648_c1 | |||
| 769 | nmdc:mga08y16_816433_c1 | |||
| 770 | nmdc:mga0a205_4_c1 | |||
| 771 | Ga0495601_0000318 | |||
| 772 | Ga0495601_0003205 | |||
| 773 | Ga0495601_0007036 | |||
| 774 | Ga0495601_0020026 | |||
| 775 | Ga0495601_0606829 | |||
| 776 | Ga0495601_0841878 | |||
| 777 | Ga0495612_0000155 | |||
| 778 | Ga0495612_0005239 | |||
| 779 | Ga0495612_0179560 | |||
| 780 | Ga0495655_0000258 | |||
| 781 | Ga0495619_0000127 | |||
| 782 | Ga0495619_0003866 | |||
| 783 | Ga0495619_0007002 | |||
| 784 | Ga0495619_0044157 | |||
| 785 | Ga0495619_0458627 | |||
| 786 | Ga0500566_0033940 | |||
| 787 | Ga0500614_000426 | |||
| 788 | Ga0500628_000072 | |||
| 789 | Ga0501084_0607606 | |||
| 790 | Ga0587085_039045 | |||
| 791 | Ga0587092_104241 | |||
| 792 | Ga0587127_031234 | |||
| 793 | Ga0587128_142575 | |||
| 794 | Ga0501082_0412093 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1m56-assembly1.cif.gz_C | structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type) | 0.8487 | 16 | 74 |
| 7jrp-assembly1.cif.gz_c | plant mitochondrial complex sc iii2+iv from vigna radiata | 0.8364 | 15 | 71 |
| 5z62-assembly1.cif.gz_C | structure of human cytochrome c oxidase | 0.8337 | 15 | 71 |
| 8dh6-assembly1.cif.gz_c | cryo-em structure of saccharomyces cerevisiae cytochrome c oxidase (complex iv) extracted in lipid nanodiscs | 0.8306 | 16 | 74 |
| 7dgq-assembly1.cif.gz_A9 | activity optimized supercomplex state1 | 0.8277 | 15 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3asoC01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.846 | 15 | 71 | 1.10.287.70 |
| 5zcqC01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8212 | 15 | 71 | 1.10.287.70 |
| 5zcqP01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8203 | 15 | 71 | 1.10.287.70 |
| 5b1aP01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8187 | 15 | 71 | 1.10.287.70 |
| 5x19C01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8143 | 10 | 71 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I0E668-F1-model_v4 | cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) | 0.8729 | 15 | 73 |
GO:0004129
GO:0016020 GO:0019646 |
| AF-A0A4V1IST1-F1-model_v4 | Cytochrome c oxidase subunit 3 | 0.8645 | 15 | 74 |
GO:0004129
GO:0005739 GO:0006123 GO:0016020 |
| AF-Q2HJM0-F1-model_v4 | Cytochrome c oxidase subunit 3 | 0.8523 | 15 | 71 |
GO:0004129
GO:0005739 GO:0006123 GO:0016020 |
| AF-Q5VB06-F1-model_v4 | Cytochrome c oxidase subunit 3 | 0.8369 | 15 | 72 |
GO:0004129
GO:0005739 GO:0006123 GO:0016020 |
| AF-A0A6M8UGK1-F1-model_v4 | Cytochrome c oxidase subunit 3 | 0.8243 | 15 | 71 |
GO:0004129
GO:0005739 GO:0006123 GO:0016020 |