F433745

General Info

Members Datasets Scaffolds Average Seq Length
397 273 794 252

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10034129|Ga0105240_100341293
Length 269
Sequence MIEGEKRFMLQQTSDAVDRAVYPSLRDKRVIVTGGGSGIGEGLVEAFAAQGARVAFLDIDDEASHSVVARLSADAPHQPVYRHCDVTDLDALATTIAELEQLLGGIDILANNAGNDDRHTIADVTPDYWNERLNVNLRHQFFAAKAVVPAMQRAGGGAILNFGSISWHLGLPDLVLYQTCKAAIEGLTRSLARDLGRDGIRVNTIVPGNVQTPRQEKWYTPQGEAEIVAGQCLDGRIQPSDVAALVLFLASDDARMCTGHEYWVDAGWR

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
61 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
169 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
200 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
201 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
202 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
203 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
204 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
205 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
206 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
207 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
211 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
214 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
217 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
220 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
221 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
222 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
223 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
224 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
225 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
229 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
233 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
234 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
235 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
236 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
237 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
238 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
239 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
240 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
241 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
242 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
243 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
244 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
245 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
246 2643221583 Caulobacter sp. Root655 Isolate Unclassified
247 2643221584 Caulobacter sp. Root656 Isolate Unclassified
248 2643221640 Caulobacter sp. Root342 Isolate Unclassified
249 2643221642 Caulobacter sp. Root343 Isolate Unclassified
250 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
251 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
252 2818991435 Caulobacter henricii 536 Isolate Unclassified
253 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
254 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
255 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
256 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
257 2849560528 Caulobacter zeae 410 Isolate Unclassified
258 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
259 2851153111 Caulobacter radicis 736 Isolate Unclassified
260 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
261 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
262 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
263 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
264 2902330777 Methylobacterium sp. 2A Isolate Unclassified
265 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
266 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
267 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
268 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
269 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
270 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
271 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
272 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
273 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 90.68
Metatranscriptomes 0
Isolates 9.32

Biome Distribution

Category Percentage (%)
Aerial Root 1.26
Bulb 0
Endosphere 25.94
Nodule 0.25
Rhizoplane 3.53
Rhizosphere 56.93
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10034129 3300009093 Bacteria 6566
2 SwRhRL2b_contig_1635877 2162886007 Bacteria 7373
3 JGI24741J21665_1001835 3300001915 Bacteria 5808
4 JGI24740J21852_10000779 3300001979 Bacteria 13973
5 JGI24737J22298_10001412 3300001990 Bacteria 8530
6 JGI25406J46586_10016685 3300003203 Bacteria 3055
7 Ga0055525_1000096 3300003759 Bacteria 137836
8 Ga0055542_1000012 3300003762 Bacteria 391808
9 Ga0055529_1000002 3300003763 Bacteria 537914
10 Ga0055529_1000021 3300003763 Bacteria 321484
11 Ga0055526_1010390 3300003771 Bacteria 4336
12 Ga0055537_1001969 3300003773 Bacteria 7333
13 Ga0055524_1010010 3300003775 Bacteria 3810
14 Ga0055524_1011340 3300003775 Bacteria 3493
15 Ga0055524_1021436 3300003775 Bacteria 2141
16 Ga0055536_1000653 3300003781 Bacteria 23422
17 Ga0055536_1000964 3300003781 Bacteria 18424
18 Ga0055528_1004650 3300003790 Bacteria 6564
19 Ga0055530_10000579 3300003791 Bacteria 31675
20 Ga0055530_10001170 3300003791 Bacteria 20304
21 Ga0055530_10001374 3300003791 Bacteria 18030
22 Ga0055530_10018714 3300003791 Bacteria 2125
23 Ga0055531_10000646 3300003794 Bacteria 30076
24 Ga0055531_10003351 3300003794 Bacteria 10242
25 Ga0055531_10006560 3300003794 Bacteria 6577
26 Ga0055531_10015275 3300003794 Bacteria 3396
27 Ga0055531_10020118 3300003794 Bacteria 2660
28 Ga0055531_10036604 3300003794 Bacteria 1509
29 Ga0065704_10070205 3300005289 Bacteria 83747
30 Ga0070658_10000196 3300005327 Bacteria 53378
31 Ga0070658_10002355 3300005327 Bacteria 15842
32 Ga0070666_10008776 3300005335 Bacteria 6282
33 Ga0070660_100016365 3300005339 Bacteria 5382
34 Ga0070661_100002495 3300005344 Bacteria 12611
35 Ga0070661_100006919 3300005344 Bacteria 7827
36 Ga0070675_100308949 3300005354 Bacteria 1395
37 Ga0070674_100118658 3300005356 Bacteria 1955
38 Ga0070659_100016509 3300005366 Bacteria 5543
39 Ga0070663_100270666 3300005455 Bacteria 1350
40 Ga0070678_100000055 3300005456 Bacteria 40348
41 Ga0068867_100002955 3300005459 Bacteria 11973
42 Ga0070684_100059523 3300005535 Bacteria 3340
43 Ga0068853_100074121 3300005539 Bacteria 2969
44 Ga0070665_100002302 3300005548 Bacteria 21191
45 Ga0068855_100000047 3300005563 Bacteria 145355
46 Ga0068855_100027779 3300005563 Bacteria 6769
47 Ga0070664_100006220 3300005564 Bacteria 9645
48 Ga0068857_100384080 3300005577 Bacteria 1304
49 Ga0068854_100023707 3300005578 Bacteria 4194
50 Ga0068856_100006207 3300005614 Bacteria 11727
51 Ga0068852_100174465 3300005616 Bacteria 2017
52 Ga0068859_100002646 3300005617 Bacteria 18230
53 Ga0068861_100000084 3300005719 Bacteria 45078
54 Ga0075369_10037077 3300006186 Bacteria 2076
55 Ga0075366_10007023 3300006195 Bacteria 6195
56 Ga0075366_10138359 3300006195 Bacteria 1471
57 Ga0097621_100028194 3300006237 Bacteria 4425
58 Ga0075370_10083706 3300006353 Bacteria 1835
59 Ga0075370_10100081 3300006353 Bacteria 1677
60 Ga0068871_100333516 3300006358 Bacteria 1338
61 Ga0068865_100095523 3300006881 Bacteria 2166
62 Ga0097620_100002646 3300006931 Bacteria 18230
63 Ga0105240_10000647 3300009093 Bacteria 64299
64 Ga0105240_10002690 3300009093 Bacteria 28290
65 Ga0105247_10045830 3300009101 Bacteria 2684
66 Ga0105243_10000227 3300009148 Bacteria 64901
67 Ga0105241_10000352 3300009174 Bacteria 34850
68 Ga0105248_10003056 3300009177 Bacteria 18559
69 Ga0105237_10001281 3300009545 Bacteria 33535
70 Ga0105237_10067799 3300009545 Bacteria 3562
71 Ga0105237_10120051 3300009545 Bacteria 2623
72 Ga0105238_10247266 3300009551 Bacteria 1761
73 Ga0105249_10630958 3300009553 Bacteria 1128
74 Ga0105239_10000105 3300010375 Bacteria 117635
75 Ga0105239_10001683 3300010375 Bacteria 29162
76 Ga0105239_10100931 3300010375 Bacteria 3193
77 Ga0157373_10010643 3300013100 Bacteria 6769
78 Ga0157371_10000094 3300013102 Bacteria 139074
79 Ga0157370_10151669 3300013104 Bacteria 2156
80 Ga0157369_10010530 3300013105 Bacteria 10525
81 Ga0157369_10112576 3300013105 Bacteria 2891
82 Ga0157369_10134641 3300013105 Bacteria 2616
83 Ga0157372_10075910 3300013307 Bacteria 3794
84 Ga0157372_10449669 3300013307 Bacteria 1501
85 Ga0157375_10386806 3300013308 Bacteria 1566
86 Ga0183365_10005 3300015684 Bacteria 249619
87 Ga0183363_1004 3300015690 Bacteria 416766
88 Ga0163161_10189807 3300017792 Bacteria 1579
89 Ga0209674_102709 3300025226 Bacteria 3629
90 Ga0207425_1016036 3300025245 Bacteria 1669
91 Ga0209646_1003506 3300025246 Bacteria 3086
92 Ga0209148_1000008 3300025254 Bacteria 1504371
93 Ga0209565_1000140 3300025263 Bacteria 101561
94 Ga0209455_1000002 3300025272 Bacteria 1505459
95 Ga0209673_1000630 3300025273 Bacteria 53635
96 Ga0209130_1002498 3300025284 Bacteria 9091
97 Ga0209675_1005092 3300025291 Bacteria 5613
98 Ga0209675_1023894 3300025291 Bacteria 1572
99 Ga0209676_1000043 3300025292 Bacteria 418680
100 Ga0209676_1000712 3300025292 Bacteria 46015
101 Ga0209676_1004038 3300025292 Bacteria 8449
102 Ga0209025_1000864 3300025294 Bacteria 47865
103 Ga0209564_1006541 3300025295 Bacteria 6261
104 Ga0209564_1022706 3300025295 Bacteria 2206
105 Ga0209564_1032062 3300025295 Bacteria 1590
106 Ga0209758_1000924 3300025297 Bacteria 39688
107 Ga0209050_1000049 3300025298 Bacteria 364096
108 Ga0209050_1000559 3300025298 Bacteria 60902
109 Ga0209050_1001103 3300025298 Bacteria 32702
110 Ga0209050_1001731 3300025298 Bacteria 21722
111 Ga0209050_1022876 3300025298 Bacteria 2223
112 Ga0209256_1001549 3300025299 Bacteria 22921
113 Ga0209256_1008649 3300025299 Bacteria 4663
114 Ga0209256_1009010 3300025299 Bacteria 4471
115 Ga0209256_1014548 3300025299 Bacteria 2822
116 Ga0209051_1002278 3300025303 Bacteria 14056
117 Ga0209257_1000134 3300025304 Bacteria 207628
118 Ga0209257_1000200 3300025304 Bacteria 147538
119 Ga0209257_1000452 3300025304 Bacteria 77144
120 Ga0209257_1000692 3300025304 Bacteria 52346
121 Ga0209257_1001064 3300025304 Bacteria 36288
122 Ga0209257_1001841 3300025304 Bacteria 23124
123 Ga0209257_1008106 3300025304 Bacteria 6106
124 Ga0209257_1018216 3300025304 Bacteria 2716
125 Ga0207656_10001687 3300025321 Bacteria 7342
126 Ga0207647_10016955 3300025904 Bacteria 4959
127 Ga0207647_10255250 3300025904 Bacteria 1005
128 Ga0207705_10000183 3300025909 Bacteria 65457
129 Ga0207654_10000020 3300025911 Bacteria 167053
130 Ga0207654_10103877 3300025911 Bacteria 1755
131 Ga0207695_10000003 3300025913 Bacteria 1368691
132 Ga0207695_10009971 3300025913 Bacteria 11670
133 Ga0207695_10038057 3300025913 Bacteria 5185
134 Ga0207671_10028216 3300025914 Bacteria 4196
135 Ga0207657_10000140 3300025919 Bacteria 74094
136 Ga0207649_10002882 3300025920 Bacteria 9462
137 Ga0207649_10013619 3300025920 Bacteria 4544
138 Ga0207649_10496652 3300025920 Bacteria 927
139 Ga0207694_10000011 3300025924 Bacteria 417640
140 Ga0207694_10000878 3300025924 Bacteria 26740
141 Ga0207659_10099885 3300025926 Bacteria 2186
142 Ga0207690_10000063 3300025932 Bacteria 95620
143 Ga0207706_10008063 3300025933 Bacteria 9723
144 Ga0207686_10095705 3300025934 Bacteria 1971
145 Ga0207709_10000093 3300025935 Bacteria 139110
146 Ga0207669_10000086 3300025937 Bacteria 46934
147 Ga0207704_10047594 3300025938 Bacteria 2564
148 Ga0207711_10001846 3300025941 Bacteria 19327
149 Ga0207667_10000006 3300025949 Bacteria 679876
150 Ga0207667_10000050 3300025949 Bacteria 234390
151 Ga0207640_10001108 3300025981 Bacteria 14880
152 Ga0207640_10282439 3300025981 Bacteria 1305
153 Ga0207677_10232238 3300026023 Bacteria 1487
154 Ga0207639_10010063 3300026041 Bacteria 6541
155 Ga0207678_10002329 3300026067 Bacteria 17206
156 Ga0207702_10000713 3300026078 Bacteria 35789
157 Ga0207702_10327762 3300026078 Bacteria 1460
158 Ga0207648_10059597 3300026089 Bacteria 3329
159 Ga0207674_10048345 3300026116 Bacteria 4354
160 Ga0207675_100000166 3300026118 Bacteria 58837
161 Ga0207683_10000181 3300026121 Bacteria 54142
162 Ga0207698_10035277 3300026142 Bacteria 3657
163 Ga0307517_10012028 3300028786 Bacteria 11940
164 Ga0307517_10215329 3300028786 Bacteria 1176
165 Ga0307515_10090947 3300028794 Bacteria 3820
166 Ga0307515_10115900 3300028794 Bacteria 3081
167 Ga0307515_10208156 3300028794 Bacteria 1809
168 Ga0265338_10122560 3300028800 Bacteria 2069
169 Ga0265320_10017331 3300031240 Bacteria 4002
170 Ga0265331_10040923 3300031250 Bacteria 2253
171 Ga0265327_10002310 3300031251 Bacteria 20381
172 Ga0265316_10059336 3300031344 Bacteria 2976
173 Ga0265313_10077845 3300031595 Bacteria 1513
174 Ga0265314_10105653 3300031711 Bacteria 1800
175 Ga0265342_10137823 3300031712 Bacteria 1363
176 Ga0307516_10014691 3300031730 Bacteria 8273
177 Ga0307405_10024087 3300031731 Bacteria 3471
178 Ga0307413_10128946 3300031824 Bacteria 1727
179 Ga0307412_10009508 3300031911 Bacteria 5581
180 Ga0307409_100453356 3300031995 Bacteria 1238
181 Ga0307416_100016230 3300032002 Bacteria 5168
182 Ga0307510_10104057 3300033180 Bacteria 2614
183 Ga0373943_0170055 3300035170 Unclassified 1192
184 Ga0373927_0071414 3300035695 Bacteria 2247
185 Ga0373925_0113756 3300037068 Bacteria 2093
186 Ga0395905_0005061 3300037471 Bacteria 13571
187 Ga0436364_0529752 3300037853 Bacteria 4663
188 Ga0451800_1440841 3300041459 Bacteria 1433
189 Ga0439435_0068059 3300042436 Bacteria 1049
190 Ga0466961_0162879 3300044693 Bacteria 1390
191 Ga0466959_0055331 3300045049 Bacteria 2897
192 Ga0495627_002017 3300046453 Bacteria 10438
193 Ga0495590_0002729 3300046457 Bacteria 7285
194 Ga0495638_0000440 3300046460 Bacteria 50160
195 Ga0495638_0001973 3300046460 Bacteria 17547
196 Ga0495638_0005482 3300046460 Bacteria 9433
197 Ga0495638_0019185 3300046460 Bacteria 4526
198 Ga0495650_0000083 3300046471 Bacteria 237725
199 Ga0495650_0000217 3300046471 Bacteria 120688
200 Ga0495582_0168146 3300046473 Bacteria 1248
201 Ga0495584_0010039 3300046491 Bacteria 4860
202 Ga0495585_0149828 3300046492 Bacteria 1217
203 Ga0495583_0000002 3300046506 Bacteria 782521
204 Ga0495583_0000351 3300046506 Bacteria 72601
205 Ga0495583_0026820 3300046506 Bacteria 2850
206 Ga0495606_0010372 3300046507 Bacteria 7743
207 Ga0495610_0000157 3300046512 Bacteria 75701
208 Ga0495610_0010052 3300046512 Bacteria 5910
209 Ga0495610_0013395 3300046512 Bacteria 4875
210 Ga0495616_0000286 3300046513 Bacteria 40792
211 Ga0495616_0117995 3300046513 Bacteria 1227
212 Ga0495620_0024675 3300046515 Bacteria 2856
213 Ga0495620_0033976 3300046515 Bacteria 2309
214 Ga0495628_0250418 3300046516 Bacteria 1323
215 Ga0495631_0009346 3300046518 Bacteria 4898
216 Ga0495632_0044798 3300046519 Bacteria 2206
217 Ga0495632_0180418 3300046519 Bacteria 967
218 Ga0495637_0056566 3300046520 Bacteria 1623
219 Ga0495637_0064825 3300046520 Bacteria 1489
220 Ga0495643_0000093 3300046522 Bacteria 152412
221 Ga0495643_0266437 3300046522 Bacteria 793
222 Ga0495648_0000097 3300046524 Bacteria 109887
223 Ga0495648_0003568 3300046524 Bacteria 13615
224 Ga0495648_0032738 3300046524 Bacteria 3406
225 Ga0495648_0201887 3300046524 Bacteria 994
226 Ga0495663_0003193 3300046525 Bacteria 4775
227 Ga0495663_0018377 3300046525 Bacteria 1991
228 Ga0495654_0000042 3300046530 Bacteria 164346
229 Ga0495654_0203913 3300046530 Bacteria 845
230 Ga0495597_0128717 3300046542 Bacteria 1051
231 Ga0495622_0000566 3300046557 Bacteria 22206
232 Ga0495622_0000745 3300046557 Bacteria 18213
233 Ga0495633_0032115 3300046558 Bacteria 2538
234 Ga0495633_0047820 3300046558 Bacteria 2021
235 Ga0495668_0000587 3300046616 Bacteria 44244
236 Ga0495668_0006641 3300046616 Bacteria 7537
237 Ga0495668_0013954 3300046616 Bacteria 4723
238 Ga0495668_0021480 3300046616 Bacteria 3701
239 Ga0495611_0004517 3300046648 Bacteria 6003
240 Ga0495625_0000170 3300046660 Bacteria 102224
241 Ga0495625_0003323 3300046660 Bacteria 16204
242 Ga0495625_0004480 3300046660 Bacteria 13189
243 Ga0495625_0004911 3300046660 Bacteria 12447
244 Ga0495625_0015799 3300046660 Bacteria 5960
245 Ga0495625_0043822 3300046660 Bacteria 3242
246 Ga0495625_0048871 3300046660 Bacteria 3042
247 Ga0495625_0186236 3300046660 Bacteria 1377
248 Ga0495661_0123359 3300046665 Bacteria 1428
249 Ga0495669_0000023 3300046684 Bacteria 117158
250 Ga0495670_0256122 3300046691 Bacteria 933
251 Ga0495671_0072336 3300046692 Bacteria 1693
252 Ga0495671_0184213 3300046692 Bacteria 1014
253 Ga0495600_0005725 3300046809 Bacteria 7506
254 Ga0495660_0039095 3300046810 Bacteria 2636
255 Ga0495660_0112512 3300046810 Bacteria 1387
256 Ga0495660_0156982 3300046810 Bacteria 1119
257 Ga0495672_0004122 3300047320 Bacteria 12099
258 Ga0495683_0004660 3300047323 Bacteria 7727
259 Ga0495687_000076 3300047443 Bacteria 149259
260 Ga0495679_003056 3300047446 Bacteria 8223
261 Ga0495673_0000147 3300047469 Bacteria 125742
262 Ga0495673_0006447 3300047469 Bacteria 6895
263 Ga0495673_0011747 3300047469 Bacteria 4688
264 Ga0495673_0033295 3300047469 Bacteria 2393
265 Ga0495686_0001764 3300047472 Bacteria 22143
266 Ga0495686_0007138 3300047472 Bacteria 8412
267 Ga0495686_0012743 3300047472 Bacteria 5867
268 Ga0495686_0019911 3300047472 Bacteria 4478
269 Ga0495686_0069581 3300047472 Bacteria 2169
270 Ga0495686_0146979 3300047472 Bacteria 1386
271 Ga0495602_0204078 3300048088 Bacteria 1506
272 Ga0495615_0068097 3300048090 Bacteria 954
273 Ga0496102_0000163 3300048905 Bacteria 89673
274 Ga0496103_0000052 3300048906 Bacteria 149437
275 Ga0496104_0073135 3300048907 Bacteria 3261
276 Ga0496105_0001454 3300048908 Bacteria 16680
277 Ga0496106_0014673 3300048909 Bacteria 5791
278 Ga0496107_0000042 3300048910 Bacteria 75015
279 Ga0496109_0448111 3300048912 Bacteria 1219
280 Ga0496111_0023674 3300048914 Bacteria 4314
281 Ga0496113_0019371 3300048916 Bacteria 4759
282 Ga0496114_0019331 3300048917 Bacteria 5519
283 Ga0496115_0000078 3300048918 Bacteria 89817
284 Ga0496115_0062704 3300048918 Bacteria 2999
285 Ga0496116_0009792 3300048919 Bacteria 8127
286 Ga0496117_0000141 3300048920 Bacteria 158041
287 Ga0496118_0000103 3300048921 Bacteria 158099
288 Ga0496119_0048477 3300048922 Bacteria 2633
289 Ga0496121_0000156 3300048924 Bacteria 149376
290 Ga0496121_0000319 3300048924 Bacteria 100692
291 Ga0496121_0000794 3300048924 Bacteria 57780
292 Ga0496121_0004591 3300048924 Bacteria 18409
293 Ga0496121_0027518 3300048924 Bacteria 5319
294 Ga0496121_0194687 3300048924 Bacteria 1450
295 Ga0496122_0005782 3300048925 Bacteria 14559
296 Ga0496123_0007297 3300048926 Bacteria 10485
297 Ga0496123_0209255 3300048926 Bacteria 993
298 Ga0496124_0000041 3300048927 Bacteria 303887
299 Ga0496124_0047707 3300048927 Bacteria 3663
300 Ga0496125_0001443 3300048928 Bacteria 34571
301 Ga0496125_0011591 3300048928 Bacteria 8807
302 Ga0496126_0000155 3300048929 Bacteria 158816
303 Ga0496126_0009898 3300048929 Bacteria 10074
304 Ga0496126_0024130 3300048929 Bacteria 5875
305 Ga0496126_0508007 3300048929 Bacteria 962
306 Ga0495678_004170 3300049459 Bacteria 8525
307 Ga0495682_0001113 3300049460 Bacteria 15638
308 Ga0495682_0024811 3300049460 Bacteria 2234
309 Ga0501034_0044040 3300049571 Bacteria 4514
310 Ga0501047_0441166 3300049581 Bacteria 1132
311 Ga0501198_003137 3300049649 Bacteria 2247
312 Ga0501223_000106 3300049663 Bacteria 24016
313 Ga0501224_000007 3300049664 Bacteria 127654
314 Ga0501233_000050 3300049668 Bacteria 16101
315 Ga0501235_000245 3300049669 Bacteria 9923
316 Ga0501238_002676 3300049671 Bacteria 2146
317 Ga0501225_0000100 3300049705 Bacteria 27639
318 Ga0501234_003389 3300049707 Bacteria 2506
319 Ga0501226_000025 3300049853 Bacteria 91197
320 nmdc:mga0k408_126957_c1 3300050493 Bacteria 1513
321 nmdc:mga0k408_150298_c1 3300050493 Bacteria 1387
322 nmdc:mga0k408_16530_c1 3300050493 Bacteria 4095
323 nmdc:mga0sz30_12805_c1 3300050516 Bacteria 3269
324 Ga0500610_0000096 3300053079 Bacteria 26013
325 Ga0500578_0000692 3300053086 Bacteria 40321
326 Ga0500643_014159 3300053087 Bacteria 2784
327 Ga0500643_018371 3300053087 Bacteria 2321
328 Ga0500644_0000132 3300053088 Bacteria 45910
329 Ga0500644_0063815 3300053088 Bacteria 1306
330 Ga0500566_0251983 3300053094 Bacteria 858
331 Ga0500641_0087874 3300053096 Bacteria 1325
332 Ga0500650_0181632 3300053098 Bacteria 964
333 Ga0500554_002279 3300053102 Bacteria 3747
334 Ga0500556_0000013 3300053104 Bacteria 243797
335 Ga0500556_0007202 3300053104 Bacteria 3177
336 Ga0500594_0000944 3300053118 Bacteria 6251
337 Ga0500595_001269 3300053119 Bacteria 13814
338 Ga0500608_000079 3300053122 Bacteria 41088
339 Ga0500614_014838 3300053123 Bacteria 1731
340 Ga0500618_000059 3300053125 Bacteria 97360
341 Ga0500642_0000002 3300053130 Bacteria 795093
342 Ga0500642_0000837 3300053130 Bacteria 8979
343 Ga0500655_024744 3300053133 Bacteria 1137
344 Ga0500658_0001907 3300053134 Bacteria 8174
345 Ga0500559_0000412 3300053136 Bacteria 30720
346 Ga0500559_0009365 3300053136 Bacteria 4244
347 Ga0500559_0111862 3300053136 Bacteria 1265
348 Ga0500564_006325 3300053138 Bacteria 4933
349 Ga0500577_0008989 3300053142 Bacteria 2880
350 Ga0500616_0000074 3300053153 Bacteria 222910
351 Ga0500622_0005946 3300053156 Bacteria 7187
352 Ga0500622_0017816 3300053156 Bacteria 3778
353 Ga0500624_000101 3300053157 Bacteria 41193
354 Ga0500636_0004742 3300053177 Bacteria 7710
355 Ga0500645_000003 3300053730 Bacteria 305887
356 Ga0500645_000105 3300053730 Bacteria 67078
357 Ga0500645_003611 3300053730 Bacteria 6198
358 Ga0500645_006927 3300053730 Bacteria 3999
359 Ga0500609_002580 3300053731 Bacteria 2579
360 Ga0500601_000033 3300053737 Bacteria 29161
361 2511123768 2510917020 Bacteria 5657507
362 2585147639 2582581279 Bacteria 4980720
363 2585152040 2582581280 Bacteria 5994497
364 2585194474 2582581293 Bacteria 5907401
365 2587917588 2585428106 Bacteria 5179711
366 2596374570 2595698237 Bacteria 6712432
367 2600202855 2599185354 Bacteria 4398675
368 2643748655 2643221545 Bacteria 5083237
369 2643782942 2643221552 Bacteria 5708754
370 2643924054 2643221583 Bacteria 5218014
371 2643928252 2643221584 Bacteria 5511711
372 2644226887 2643221640 Bacteria 5258820
373 2644233645 2643221642 Bacteria 5357871
374 2644510330 2643221691 Bacteria 5093099
375 2792460473 2791355048 Bacteria 5832535
376 2819539417 2818991435 Bacteria 5433759
377 2819647709 2818991454 Bacteria 5563326
378 2830076957 2830075706 Bacteria 3855215
379 2842337140 2842333319 Bacteria 8899485
380 2843744567 2843744320 Bacteria 5659202
381 2849565535 2849560528 Bacteria 5393480
382 2849575649 2849573788 Bacteria 5421256
383 2851153249 2851153111 Bacteria 5542585
384 2857507161 2857504554 Bacteria 5369913
385 2884961859 2884960567 Bacteria 5437054
386 2889310544 2889306138 Bacteria 6358934
387 2898331711 2898329390 Bacteria 5168154
388 2902335762 2902330777 Bacteria 6395352
389 2919143511 2919138771 Bacteria 5281312
390 2928030147 2928027323 Bacteria 4382488
391 2928125133 2928125067 Bacteria 5937560
392 2928536028 2928531327 Bacteria 5101314
393 2984556854 2984555340 Bacteria 4247089
394 2984564986 2984564862 Bacteria 4339992
395 2990266009 2990265787 Bacteria 3943888
396 2993356050 2993356040 Bacteria 4247105
397 2993696199 2993693658 Bacteria 4040749
398 Ga0105240_10034129
399 SwRhRL2b_contig_1635877
400 JGI24741J21665_1001835
401 JGI24740J21852_10000779
402 JGI24737J22298_10001412
403 JGI25406J46586_10016685
404 Ga0055525_1000096
405 Ga0055542_1000012
406 Ga0055529_1000002
407 Ga0055529_1000021
408 Ga0055526_1010390
409 Ga0055537_1001969
410 Ga0055524_1010010
411 Ga0055524_1011340
412 Ga0055524_1021436
413 Ga0055536_1000653
414 Ga0055536_1000964
415 Ga0055528_1004650
416 Ga0055530_10000579
417 Ga0055530_10001170
418 Ga0055530_10001374
419 Ga0055530_10018714
420 Ga0055531_10000646
421 Ga0055531_10003351
422 Ga0055531_10006560
423 Ga0055531_10015275
424 Ga0055531_10020118
425 Ga0055531_10036604
426 Ga0065704_10070205
427 Ga0070658_10000196
428 Ga0070658_10002355
429 Ga0070666_10008776
430 Ga0070660_100016365
431 Ga0070661_100002495
432 Ga0070661_100006919
433 Ga0070675_100308949
434 Ga0070674_100118658
435 Ga0070659_100016509
436 Ga0070663_100270666
437 Ga0070678_100000055
438 Ga0068867_100002955
439 Ga0070684_100059523
440 Ga0068853_100074121
441 Ga0070665_100002302
442 Ga0068855_100000047
443 Ga0068855_100027779
444 Ga0070664_100006220
445 Ga0068857_100384080
446 Ga0068854_100023707
447 Ga0068856_100006207
448 Ga0068852_100174465
449 Ga0068859_100002646
450 Ga0068861_100000084
451 Ga0075369_10037077
452 Ga0075366_10007023
453 Ga0075366_10138359
454 Ga0097621_100028194
455 Ga0075370_10083706
456 Ga0075370_10100081
457 Ga0068871_100333516
458 Ga0068865_100095523
459 Ga0097620_100002646
460 Ga0105240_10000647
461 Ga0105240_10002690
462 Ga0105247_10045830
463 Ga0105243_10000227
464 Ga0105241_10000352
465 Ga0105248_10003056
466 Ga0105237_10001281
467 Ga0105237_10067799
468 Ga0105237_10120051
469 Ga0105238_10247266
470 Ga0105249_10630958
471 Ga0105239_10000105
472 Ga0105239_10001683
473 Ga0105239_10100931
474 Ga0157373_10010643
475 Ga0157371_10000094
476 Ga0157370_10151669
477 Ga0157369_10010530
478 Ga0157369_10112576
479 Ga0157369_10134641
480 Ga0157372_10075910
481 Ga0157372_10449669
482 Ga0157375_10386806
483 Ga0183365_10005
484 Ga0183363_1004
485 Ga0163161_10189807
486 Ga0209674_102709
487 Ga0207425_1016036
488 Ga0209646_1003506
489 Ga0209148_1000008
490 Ga0209565_1000140
491 Ga0209455_1000002
492 Ga0209673_1000630
493 Ga0209130_1002498
494 Ga0209675_1005092
495 Ga0209675_1023894
496 Ga0209676_1000043
497 Ga0209676_1000712
498 Ga0209676_1004038
499 Ga0209025_1000864
500 Ga0209564_1006541
501 Ga0209564_1022706
502 Ga0209564_1032062
503 Ga0209758_1000924
504 Ga0209050_1000049
505 Ga0209050_1000559
506 Ga0209050_1001103
507 Ga0209050_1001731
508 Ga0209050_1022876
509 Ga0209256_1001549
510 Ga0209256_1008649
511 Ga0209256_1009010
512 Ga0209256_1014548
513 Ga0209051_1002278
514 Ga0209257_1000134
515 Ga0209257_1000200
516 Ga0209257_1000452
517 Ga0209257_1000692
518 Ga0209257_1001064
519 Ga0209257_1001841
520 Ga0209257_1008106
521 Ga0209257_1018216
522 Ga0207656_10001687
523 Ga0207647_10016955
524 Ga0207647_10255250
525 Ga0207705_10000183
526 Ga0207654_10000020
527 Ga0207654_10103877
528 Ga0207695_10000003
529 Ga0207695_10009971
530 Ga0207695_10038057
531 Ga0207671_10028216
532 Ga0207657_10000140
533 Ga0207649_10002882
534 Ga0207649_10013619
535 Ga0207649_10496652
536 Ga0207694_10000011
537 Ga0207694_10000878
538 Ga0207659_10099885
539 Ga0207690_10000063
540 Ga0207706_10008063
541 Ga0207686_10095705
542 Ga0207709_10000093
543 Ga0207669_10000086
544 Ga0207704_10047594
545 Ga0207711_10001846
546 Ga0207667_10000006
547 Ga0207667_10000050
548 Ga0207640_10001108
549 Ga0207640_10282439
550 Ga0207677_10232238
551 Ga0207639_10010063
552 Ga0207678_10002329
553 Ga0207702_10000713
554 Ga0207702_10327762
555 Ga0207648_10059597
556 Ga0207674_10048345
557 Ga0207675_100000166
558 Ga0207683_10000181
559 Ga0207698_10035277
560 Ga0307517_10012028
561 Ga0307517_10215329
562 Ga0307515_10090947
563 Ga0307515_10115900
564 Ga0307515_10208156
565 Ga0265338_10122560
566 Ga0265320_10017331
567 Ga0265331_10040923
568 Ga0265327_10002310
569 Ga0265316_10059336
570 Ga0265313_10077845
571 Ga0265314_10105653
572 Ga0265342_10137823
573 Ga0307516_10014691
574 Ga0307405_10024087
575 Ga0307413_10128946
576 Ga0307412_10009508
577 Ga0307409_100453356
578 Ga0307416_100016230
579 Ga0307510_10104057
580 Ga0373943_0170055
581 Ga0373927_0071414
582 Ga0373925_0113756
583 Ga0395905_0005061
584 Ga0436364_0529752
585 Ga0451800_1440841
586 Ga0439435_0068059
587 Ga0466961_0162879
588 Ga0466959_0055331
589 Ga0495627_002017
590 Ga0495590_0002729
591 Ga0495638_0000440
592 Ga0495638_0001973
593 Ga0495638_0005482
594 Ga0495638_0019185
595 Ga0495650_0000083
596 Ga0495650_0000217
597 Ga0495582_0168146
598 Ga0495584_0010039
599 Ga0495585_0149828
600 Ga0495583_0000002
601 Ga0495583_0000351
602 Ga0495583_0026820
603 Ga0495606_0010372
604 Ga0495610_0000157
605 Ga0495610_0010052
606 Ga0495610_0013395
607 Ga0495616_0000286
608 Ga0495616_0117995
609 Ga0495620_0024675
610 Ga0495620_0033976
611 Ga0495628_0250418
612 Ga0495631_0009346
613 Ga0495632_0044798
614 Ga0495632_0180418
615 Ga0495637_0056566
616 Ga0495637_0064825
617 Ga0495643_0000093
618 Ga0495643_0266437
619 Ga0495648_0000097
620 Ga0495648_0003568
621 Ga0495648_0032738
622 Ga0495648_0201887
623 Ga0495663_0003193
624 Ga0495663_0018377
625 Ga0495654_0000042
626 Ga0495654_0203913
627 Ga0495597_0128717
628 Ga0495622_0000566
629 Ga0495622_0000745
630 Ga0495633_0032115
631 Ga0495633_0047820
632 Ga0495668_0000587
633 Ga0495668_0006641
634 Ga0495668_0013954
635 Ga0495668_0021480
636 Ga0495611_0004517
637 Ga0495625_0000170
638 Ga0495625_0003323
639 Ga0495625_0004480
640 Ga0495625_0004911
641 Ga0495625_0015799
642 Ga0495625_0043822
643 Ga0495625_0048871
644 Ga0495625_0186236
645 Ga0495661_0123359
646 Ga0495669_0000023
647 Ga0495670_0256122
648 Ga0495671_0072336
649 Ga0495671_0184213
650 Ga0495600_0005725
651 Ga0495660_0039095
652 Ga0495660_0112512
653 Ga0495660_0156982
654 Ga0495672_0004122
655 Ga0495683_0004660
656 Ga0495687_000076
657 Ga0495679_003056
658 Ga0495673_0000147
659 Ga0495673_0006447
660 Ga0495673_0011747
661 Ga0495673_0033295
662 Ga0495686_0001764
663 Ga0495686_0007138
664 Ga0495686_0012743
665 Ga0495686_0019911
666 Ga0495686_0069581
667 Ga0495686_0146979
668 Ga0495602_0204078
669 Ga0495615_0068097
670 Ga0496102_0000163
671 Ga0496103_0000052
672 Ga0496104_0073135
673 Ga0496105_0001454
674 Ga0496106_0014673
675 Ga0496107_0000042
676 Ga0496109_0448111
677 Ga0496111_0023674
678 Ga0496113_0019371
679 Ga0496114_0019331
680 Ga0496115_0000078
681 Ga0496115_0062704
682 Ga0496116_0009792
683 Ga0496117_0000141
684 Ga0496118_0000103
685 Ga0496119_0048477
686 Ga0496121_0000156
687 Ga0496121_0000319
688 Ga0496121_0000794
689 Ga0496121_0004591
690 Ga0496121_0027518
691 Ga0496121_0194687
692 Ga0496122_0005782
693 Ga0496123_0007297
694 Ga0496123_0209255
695 Ga0496124_0000041
696 Ga0496124_0047707
697 Ga0496125_0001443
698 Ga0496125_0011591
699 Ga0496126_0000155
700 Ga0496126_0009898
701 Ga0496126_0024130
702 Ga0496126_0508007
703 Ga0495678_004170
704 Ga0495682_0001113
705 Ga0495682_0024811
706 Ga0501034_0044040
707 Ga0501047_0441166
708 Ga0501198_003137
709 Ga0501223_000106
710 Ga0501224_000007
711 Ga0501233_000050
712 Ga0501235_000245
713 Ga0501238_002676
714 Ga0501225_0000100
715 Ga0501234_003389
716 Ga0501226_000025
717 nmdc:mga0k408_126957_c1
718 nmdc:mga0k408_150298_c1
719 nmdc:mga0k408_16530_c1
720 nmdc:mga0sz30_12805_c1
721 Ga0500610_0000096
722 Ga0500578_0000692
723 Ga0500643_014159
724 Ga0500643_018371
725 Ga0500644_0000132
726 Ga0500644_0063815
727 Ga0500566_0251983
728 Ga0500641_0087874
729 Ga0500650_0181632
730 Ga0500554_002279
731 Ga0500556_0000013
732 Ga0500556_0007202
733 Ga0500594_0000944
734 Ga0500595_001269
735 Ga0500608_000079
736 Ga0500614_014838
737 Ga0500618_000059
738 Ga0500642_0000002
739 Ga0500642_0000837
740 Ga0500655_024744
741 Ga0500658_0001907
742 Ga0500559_0000412
743 Ga0500559_0009365
744 Ga0500559_0111862
745 Ga0500564_006325
746 Ga0500577_0008989
747 Ga0500616_0000074
748 Ga0500622_0005946
749 Ga0500622_0017816
750 Ga0500624_000101
751 Ga0500636_0004742
752 Ga0500645_000003
753 Ga0500645_000105
754 Ga0500645_003611
755 Ga0500645_006927
756 Ga0500609_002580
757 Ga0500601_000033
758 2511123768
759 2585147639
760 2585152040
761 2585194474
762 2587917588
763 2596374570
764 2600202855
765 2643748655
766 2643782942
767 2643924054
768 2643928252
769 2644226887
770 2644233645
771 2644510330
772 2792460473
773 2819539417
774 2819647709
775 2830076957
776 2842337140
777 2843744567
778 2849565535
779 2849575649
780 2851153249
781 2857507161
782 2884961859
783 2889310544
784 2898331711
785 2902335762
786 2919143511
787 2928030147
788 2928125133
789 2928536028
790 2984556854
791 2984564986
792 2990266009
793 2993356050
794 2993696199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

28

223

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

34

269

0.97

PF08659

KR

KR domain

29

206

0.85

PF23441

23

234

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wwx-assembly1.cif.gz_A crystal structure of herbaspirillum huttiense l-arabinose 1-dehydrogenase (nad bound form) 0.9783 16 268
5wjs-assembly1.cif.gz_B crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh 0.9778 19 268
4lvu-assembly1.cif.gz_B-2 crystal structure of a putative short chain dehydrogenase from burkholderia thailandensis 0.972 19 268
7wwx-assembly1.cif.gz_A crystal structure of herbaspirillum huttiense l-arabinose 1-dehydrogenase (nad bound form) 0.9707 16 268
2d1y-assembly1.cif.gz_B crystal structure of tt0321 from thermus thermophilus hb8 0.9674 25 266
ID Description Score Start End Superfamily
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9615 24 267 3.40.50.720
4lvuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9609 19 268 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9472 24 268 3.40.50.720
3rihC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9458 24 265 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9448 24 265 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0L0MBF5-F1-model_v4 D-xylose 1-dehydrogenase (EC 1.1.1.175) 0.9868 16 266 GO:0047838
AF-A0A2T2PSP7-F1-model_v4 3-oxoacyl-ACP reductase 0.9853 16 266 GO:0016491
AF-A0A1M5K9F9-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9828 16 268 GO:0016491
AF-A0A2G6YA75-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9808 19 268 GO:0016491
AF-A0A1H1HW12-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family (SDR family oxidoreductase) 0.9732 16 268 GO:0016491

Map