F433754

General Info

Members Datasets Scaffolds Average Seq Length
397 207 794 114

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_11868680|Ga0105237_118686802
Length 114
Sequence MLIFKIVHNDEWRAAEAADIYCGSAKDQADGFLHFSTEEQLIGTLTRYYADAEDLVLVAIDAESLGEALKYEPSTAGALYPHLYGDLPLSAVRWARPIARDAQGEFAPAELICR

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
200 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
201 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
202 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
203 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.03
Nodule 0
Rhizoplane 1.26
Rhizosphere 92.7
Stem 0
Stem Tuber 0
Unclassified 14.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_11868680 3300009545 Unclassified 608
2 JGI25165J46597_1000036 3300003214 Bacteria 286380
3 Ga0070658_10021167 3300005327 Bacteria 5209
4 Ga0070658_10029785 3300005327 Bacteria 4386
5 Ga0070658_10146680 3300005327 Bacteria 1974
6 Ga0070658_10200445 3300005327 Bacteria 1684
7 Ga0070658_10949475 3300005327 Bacteria 748
8 Ga0070676_10003084 3300005328 Bacteria 8610
9 Ga0070676_10384367 3300005328 Bacteria 973
10 Ga0070683_100599843 3300005329 Bacteria 1054
11 Ga0070683_101416309 3300005329 Bacteria 668
12 Ga0070670_100241417 3300005331 Bacteria 1573
13 Ga0070670_100452032 3300005331 Bacteria 1139
14 Ga0070670_100676746 3300005331 Bacteria 927
15 Ga0068869_101081291 3300005334 Unclassified 701
16 Ga0070666_10272560 3300005335 Bacteria 1201
17 Ga0070680_101465864 3300005336 Bacteria 591
18 Ga0068868_100215307 3300005338 Bacteria 1607
19 Ga0068868_100343582 3300005338 Bacteria 1277
20 Ga0068868_100398004 3300005338 Bacteria 1188
21 Ga0068868_100860691 3300005338 Unclassified 821
22 Ga0070660_100363174 3300005339 Bacteria 1193
23 Ga0070660_100445020 3300005339 Unclassified 1074
24 Ga0070661_100031637 3300005344 Unclassified 3827
25 Ga0070661_100393428 3300005344 Bacteria 1095
26 Ga0070661_100793586 3300005344 Bacteria 777
27 Ga0070661_101773299 3300005344 Bacteria 524
28 Ga0070675_100436320 3300005354 Bacteria 1173
29 Ga0070671_100044371 3300005355 Bacteria 3695
30 Ga0070674_100747026 3300005356 Unclassified 840
31 Ga0070673_100377196 3300005364 Bacteria 1264
32 Ga0070659_100184703 3300005366 Bacteria 1712
33 Ga0070659_100897050 3300005366 Bacteria 775
34 Ga0070667_100128112 3300005367 Bacteria 2213
35 Ga0070667_100212343 3300005367 Bacteria 1720
36 Ga0070667_101844397 3300005367 Bacteria 569
37 Ga0070714_101268128 3300005435 Unclassified 719
38 Ga0070713_100514549 3300005436 Bacteria 1130
39 Ga0070701_10319861 3300005438 Bacteria 960
40 Ga0070700_100363188 3300005441 Bacteria 1077
41 Ga0070700_100668389 3300005441 Bacteria 822
42 Ga0070678_100032733 3300005456 Bacteria 3601
43 Ga0070678_100301146 3300005456 Bacteria 1362
44 Ga0070678_101305617 3300005456 Bacteria 675
45 Ga0070678_101448009 3300005456 Unclassified 642
46 Ga0070662_101639352 3300005457 Bacteria 555
47 Ga0070681_10071861 3300005458 Bacteria 3425
48 Ga0070681_10180906 3300005458 Bacteria 2030
49 Ga0068867_100010889 3300005459 Bacteria 6415
50 Ga0068867_100032708 3300005459 Bacteria 3763
51 Ga0068867_100421118 3300005459 Unclassified 1131
52 Ga0070679_100140524 3300005530 Bacteria 2394
53 Ga0070684_100158085 3300005535 Bacteria 2055
54 Ga0068853_100621591 3300005539 Bacteria 1027
55 Ga0070695_100401458 3300005545 Bacteria 1039
56 Ga0070693_100725369 3300005547 Unclassified 730
57 Ga0070665_100000381 3300005548 Bacteria 65638
58 Ga0070665_100033021 3300005548 Bacteria 5207
59 Ga0070665_100664024 3300005548 Bacteria 1055
60 Ga0070665_101071562 3300005548 Bacteria 818
61 Ga0070665_101285112 3300005548 Bacteria 742
62 Ga0068855_100121122 3300005563 Bacteria 2994
63 Ga0068855_100343782 3300005563 Bacteria 1644
64 Ga0068855_100345044 3300005563 Bacteria 1641
65 Ga0068855_100375135 3300005563 Bacteria 1563
66 Ga0068855_100635658 3300005563 Bacteria 1148
67 Ga0068855_101901226 3300005563 Unclassified 603
68 Ga0068857_101480998 3300005577 Bacteria 661
69 Ga0068854_100388816 3300005578 Bacteria 1151
70 Ga0070702_100334935 3300005615 Unclassified 1060
71 Ga0068852_100040826 3300005616 Unclassified 3917
72 Ga0068852_100042502 3300005616 Bacteria 3847
73 Ga0068852_100398153 3300005616 Bacteria 1354
74 Ga0068859_101283600 3300005617 Unclassified 807
75 Ga0068864_100381011 3300005618 Bacteria 1337
76 Ga0068864_101759907 3300005618 Unclassified 625
77 Ga0068864_102199430 3300005618 Bacteria 558
78 Ga0068866_10033241 3300005718 Bacteria 2500
79 Ga0068861_101451318 3300005719 Bacteria 672
80 Ga0068861_102498056 3300005719 Bacteria 520
81 Ga0068870_10154771 3300005840 Bacteria 1354
82 Ga0068870_10321550 3300005840 Bacteria 983
83 Ga0068863_102316630 3300005841 Unclassified 547
84 Ga0068858_100379194 3300005842 Bacteria 1357
85 Ga0068858_100758674 3300005842 Bacteria 945
86 Ga0068860_101008722 3300005843 Bacteria 850
87 Ga0068862_100882814 3300005844 Bacteria 878
88 Ga0068862_101114841 3300005844 Bacteria 785
89 Ga0075365_10353490 3300006038 Bacteria 1036
90 Ga0097621_100000209 3300006237 Bacteria 38414
91 Ga0097621_100016590 3300006237 Bacteria 5571
92 Ga0097621_100057973 3300006237 Bacteria 3169
93 Ga0068871_100002253 3300006358 Bacteria 13111
94 Ga0068871_100063684 3300006358 Bacteria 3017
95 Ga0068871_100238310 3300006358 Bacteria 1581
96 Ga0068871_100320009 3300006358 Bacteria 1366
97 Ga0068871_100691328 3300006358 Unclassified 934
98 Ga0068865_100002773 3300006881 Bacteria 10412
99 Ga0068865_100124755 3300006881 Bacteria 1920
100 Ga0097620_101283436 3300006931 Unclassified 807
101 Ga0099795_10142862 3300007788 Bacteria 975
102 Ga0099795_10611425 3300007788 Bacteria 519
103 Ga0105240_10312373 3300009093 Bacteria 1794
104 Ga0105240_10402381 3300009093 Bacteria 1542
105 Ga0105240_10461801 3300009093 Bacteria 1419
106 Ga0105240_10643081 3300009093 Unclassified 1163
107 Ga0105240_10785161 3300009093 Bacteria 1033
108 Ga0105240_10840821 3300009093 Bacteria 991
109 Ga0105240_11288063 3300009093 Bacteria 771
110 Ga0105245_10239856 3300009098 Bacteria 1757
111 Ga0105245_10603148 3300009098 Bacteria 1125
112 Ga0105245_11737248 3300009098 Bacteria 676
113 Ga0105243_10020198 3300009148 Bacteria 5051
114 Ga0105243_12432326 3300009148 Bacteria 562
115 Ga0105241_10250600 3300009174 Unclassified 1501
116 Ga0105241_10395436 3300009174 Bacteria 1211
117 Ga0105241_10467314 3300009174 Bacteria 1119
118 Ga0105241_10663065 3300009174 Bacteria 949
119 Ga0105242_10012177 3300009176 Bacteria 6617
120 Ga0105242_10019567 3300009176 Bacteria 5307
121 Ga0105242_10023524 3300009176 Bacteria 4855
122 Ga0105242_10083778 3300009176 Bacteria 2671
123 Ga0105242_10332781 3300009176 Bacteria 1397
124 Ga0105248_10000005 3300009177 Bacteria 673111
125 Ga0105248_11252641 3300009177 Unclassified 839
126 Ga0105248_13154656 3300009177 Unclassified 525
127 Ga0105237_10121075 3300009545 Bacteria 2612
128 Ga0105237_10940034 3300009545 Bacteria 871
129 Ga0105237_12640457 3300009545 Unclassified 513
130 Ga0105238_10090833 3300009551 Bacteria 3041
131 Ga0105238_10099827 3300009551 Unclassified 2886
132 Ga0105238_10407488 3300009551 Bacteria 1353
133 Ga0105238_11555664 3300009551 Bacteria 691
134 Ga0105238_11755710 3300009551 Bacteria 652
135 Ga0105238_12193502 3300009551 Bacteria 587
136 Ga0105249_11426422 3300009553 Bacteria 764
137 Ga0105147_106867 3300009982 Bacteria 963
138 Ga0099796_10006309 3300010159 Bacteria 3026
139 Ga0099796_10319760 3300010159 Bacteria 662
140 Ga0105239_10144837 3300010375 Bacteria 2649
141 Ga0105239_10348491 3300010375 Bacteria 1672
142 Ga0105239_10428406 3300010375 Bacteria 1499
143 Ga0105239_10698569 3300010375 Bacteria 1160
144 Ga0105246_10007171 3300011119 Bacteria 6829
145 Ga0157370_10285470 3300013104 Unclassified 1525
146 Ga0157370_10478090 3300013104 Bacteria 1145
147 Ga0157369_10009212 3300013105 Bacteria 11296
148 Ga0157369_10114533 3300013105 Bacteria 2863
149 Ga0157374_10022605 3300013296 Bacteria 5610
150 Ga0157374_10444207 3300013296 Bacteria 1298
151 Ga0157378_10148084 3300013297 Unclassified 2185
152 Ga0157378_10431040 3300013297 Bacteria 1305
153 Ga0157378_11430909 3300013297 Bacteria 735
154 Ga0163162_10037764 3300013306 Bacteria 4820
155 Ga0163162_10062534 3300013306 Bacteria 3763
156 Ga0163162_10107516 3300013306 Bacteria 2885
157 Ga0163162_12052858 3300013306 Bacteria 655
158 Ga0157375_10237407 3300013308 Bacteria 1982
159 Ga0157375_12148781 3300013308 Bacteria 665
160 Ga0157375_12769485 3300013308 Bacteria 586
161 Ga0163163_10000015 3300014325 Bacteria 214881
162 Ga0163163_10212669 3300014325 Bacteria 1983
163 Ga0157380_10142171 3300014326 Bacteria 2063
164 Ga0157380_11831357 3300014326 Bacteria 666
165 Ga0157379_10000349 3300014968 Bacteria 37189
166 Ga0157379_10044600 3300014968 Bacteria 3958
167 Ga0157379_10883687 3300014968 Bacteria 847
168 Ga0157376_10007081 3300014969 Bacteria 7964
169 Ga0157376_10313541 3300014969 Bacteria 1489
170 Ga0157376_10551929 3300014969 Bacteria 1140
171 Ga0157376_12840970 3300014969 Unclassified 524
172 Ga0163161_10009672 3300017792 Bacteria 6671
173 Ga0213876_10029834 3300021384 Unclassified 2874
174 Ga0213876_10220719 3300021384 Bacteria 1008
175 Ga0207427_108078 3300025231 Bacteria 1193
176 Ga0209233_1000015 3300025261 Bacteria 980563
177 Ga0209233_1008503 3300025261 Bacteria 3173
178 Ga0207642_10003420 3300025899 Bacteria 5009
179 Ga0207688_10121855 3300025901 Bacteria 1522
180 Ga0207680_10463481 3300025903 Bacteria 900
181 Ga0207645_10064758 3300025907 Bacteria 2335
182 Ga0207645_10413303 3300025907 Bacteria 908
183 Ga0207705_10034376 3300025909 Unclassified 3624
184 Ga0207705_10177225 3300025909 Bacteria 1607
185 Ga0207705_10419110 3300025909 Bacteria 1036
186 Ga0207705_11203936 3300025909 Bacteria 581
187 Ga0207654_10154382 3300025911 Bacteria 1477
188 Ga0207654_10165173 3300025911 Bacteria 1433
189 Ga0207654_10578295 3300025911 Bacteria 800
190 Ga0207654_10919541 3300025911 Bacteria 635
191 Ga0207707_10205821 3300025912 Bacteria 1715
192 Ga0207707_10209264 3300025912 Bacteria 1699
193 Ga0207695_10274394 3300025913 Bacteria 1581
194 Ga0207695_10523346 3300025913 Bacteria 1068
195 Ga0207660_11345279 3300025917 Unclassified 579
196 Ga0207657_10242423 3300025919 Bacteria 1439
197 Ga0207657_10706212 3300025919 Unclassified 783
198 Ga0207649_10715110 3300025920 Bacteria 777
199 Ga0207652_10471973 3300025921 Bacteria 1130
200 Ga0207652_10621724 3300025921 Unclassified 967
201 Ga0207652_10938803 3300025921 Bacteria 763
202 Ga0207652_11194068 3300025921 Bacteria 662
203 Ga0207681_10261098 3300025923 Bacteria 1356
204 Ga0207694_10064968 3300025924 Bacteria 2845
205 Ga0207694_10119933 3300025924 Unclassified 2099
206 Ga0207694_11513857 3300025924 Bacteria 566
207 Ga0207650_10296786 3300025925 Bacteria 1319
208 Ga0207650_10365735 3300025925 Bacteria 1189
209 Ga0207659_11327306 3300025926 Unclassified 617
210 Ga0207687_10114495 3300025927 Bacteria 2007
211 Ga0207687_10961529 3300025927 Bacteria 732
212 Ga0207687_11116009 3300025927 Bacteria 677
213 Ga0207700_10597143 3300025928 Bacteria 982
214 Ga0207700_11440886 3300025928 Bacteria 612
215 Ga0207664_11465308 3300025929 Bacteria 604
216 Ga0207644_10042012 3300025931 Bacteria 3238
217 Ga0207690_10808056 3300025932 Unclassified 775
218 Ga0207706_10268703 3300025933 Bacteria 1488
219 Ga0207686_10036832 3300025934 Unclassified 2949
220 Ga0207686_10247084 3300025934 Bacteria 1301
221 Ga0207686_11512848 3300025934 Unclassified 553
222 Ga0207709_10018456 3300025935 Bacteria 3908
223 Ga0207669_10728498 3300025937 Unclassified 817
224 Ga0207669_10737597 3300025937 Bacteria 812
225 Ga0207704_10003862 3300025938 Bacteria 6807
226 Ga0207704_10236592 3300025938 Bacteria 1362
227 Ga0207691_11278203 3300025940 Bacteria 606
228 Ga0207711_10000002 3300025941 Bacteria 1228676
229 Ga0207711_10407365 3300025941 Bacteria 1264
230 Ga0207711_11380294 3300025941 Unclassified 647
231 Ga0207689_10156513 3300025942 Bacteria 1878
232 Ga0207689_10780986 3300025942 Unclassified 806
233 Ga0207661_10043243 3300025944 Bacteria 3555
234 Ga0207661_10966047 3300025944 Unclassified 785
235 Ga0207661_11184012 3300025944 Bacteria 703
236 Ga0207667_10050836 3300025949 Bacteria 4372
237 Ga0207667_10329461 3300025949 Bacteria 1559
238 Ga0207667_10694713 3300025949 Bacteria 1020
239 Ga0207667_10869591 3300025949 Bacteria 895
240 Ga0207667_11377282 3300025949 Bacteria 679
241 Ga0207651_10009917 3300025960 Bacteria 5245
242 Ga0207712_10294212 3300025961 Bacteria 1330
243 Ga0207712_12095568 3300025961 Unclassified 506
244 Ga0207640_10291874 3300025981 Bacteria 1286
245 Ga0207658_10079228 3300025986 Bacteria 2512
246 Ga0207658_10120620 3300025986 Bacteria 2090
247 Ga0207658_11890317 3300025986 Unclassified 544
248 Ga0207677_10140027 3300026023 Bacteria 1851
249 Ga0207677_10236896 3300026023 Bacteria 1474
250 Ga0207677_10263290 3300026023 Bacteria 1406
251 Ga0207703_10302862 3300026035 Bacteria 1458
252 Ga0207639_11068843 3300026041 Bacteria 756
253 Ga0207639_11490361 3300026041 Bacteria 635
254 Ga0207708_10412714 3300026075 Bacteria 1118
255 Ga0207702_10253042 3300026078 Bacteria 1655
256 Ga0207702_10982972 3300026078 Bacteria 837
257 Ga0207702_11546443 3300026078 Bacteria 657
258 Ga0207648_10007588 3300026089 Bacteria 10640
259 Ga0207648_10020227 3300026089 Bacteria 5999
260 Ga0207648_10295581 3300026089 Bacteria 1451
261 Ga0207676_10165016 3300026095 Bacteria 1923
262 Ga0207674_10797054 3300026116 Bacteria 912
263 Ga0207674_11051231 3300026116 Unclassified 783
264 Ga0207674_11277308 3300026116 Bacteria 704
265 Ga0207675_101752893 3300026118 Bacteria 640
266 Ga0207683_10047876 3300026121 Bacteria 3744
267 Ga0207683_10165517 3300026121 Bacteria 2001
268 Ga0207683_10465516 3300026121 Bacteria 1166
269 Ga0207698_10056440 3300026142 Bacteria 3033
270 Ga0207698_10326233 3300026142 Bacteria 1440
271 Ga0207698_10628723 3300026142 Bacteria 1061
272 Ga0268266_10000900 3300028379 Bacteria 38445
273 Ga0268266_10041761 3300028379 Bacteria 3915
274 Ga0268266_10049573 3300028379 Bacteria 3601
275 Ga0268266_10779326 3300028379 Bacteria 923
276 Ga0268266_11111522 3300028379 Bacteria 765
277 Ga0268266_11163524 3300028379 Bacteria 746
278 Ga0268265_11833286 3300028380 Bacteria 613
279 Ga0268264_10308087 3300028381 Bacteria 1493
280 Ga0268264_10566888 3300028381 Bacteria 1116
281 Ga0265338_10007775 3300028800 Bacteria 13191
282 Ga0265330_10109472 3300031235 Bacteria 1181
283 Ga0265320_10152875 3300031240 Unclassified 1042
284 Ga0265325_10000950 3300031241 Bacteria 20939
285 Ga0265329_10083551 3300031242 Bacteria 1011
286 Ga0265340_10336219 3300031247 Bacteria 668
287 Ga0265339_10001402 3300031249 Bacteria 17911
288 Ga0265331_10072446 3300031250 Bacteria 1610
289 Ga0265331_10087118 3300031250 Bacteria 1446
290 Ga0265316_10060892 3300031344 Bacteria 2933
291 Ga0265316_10260692 3300031344 Bacteria 1271
292 Ga0265313_10000672 3300031595 Bacteria 35190
293 Ga0265313_10033278 3300031595 Bacteria 2622
294 Ga0265313_10404694 3300031595 Bacteria 535
295 Ga0265314_10259050 3300031711 Bacteria 994
296 Ga0265314_10481165 3300031711 Bacteria 656
297 Ga0265342_10636578 3300031712 Bacteria 536
298 Ga0307516_10046235 3300031730 Bacteria 4296
299 Ga0307516_10064348 3300031730 Bacteria 3547
300 Ga0373950_0015636 3300034818 Bacteria 1289
301 Ga0373926_0373925 3300035083 Bacteria 561
302 Ga0373936_0098088 3300035113 Bacteria 1234
303 Ga0373927_0015623 3300035695 Bacteria 5014
304 Ga0373947_0357764 3300035725 Bacteria 980
305 Ga0395898_0045842 3300037466 Bacteria 4296
306 Ga0395901_0079597 3300038443 Bacteria 3422
307 Ga0395901_1515765 3300038443 Unclassified 626
308 Ga0436365_1000935 3300039437 Bacteria 517
309 Ga0436365_1627614 3300039437 Bacteria 14353
310 Ga0451793_0490877 3300041452 Bacteria 1902
311 Ga0451802_0323929 3300041460 Bacteria 861
312 Ga0466957_0844063 3300044842 Bacteria 652
313 Ga0466959_0096241 3300045049 Bacteria 2123
314 Ga0495651_0171288 3300046462 Bacteria 1546
315 Ga0495653_0407502 3300046463 Bacteria 863
316 Ga0495585_0076239 3300046492 Bacteria 1822
317 Ga0495606_0226478 3300046507 Bacteria 1050
318 Ga0495618_0137327 3300046514 Bacteria 1564
319 Ga0495630_1166592 3300046517 Unclassified 583
320 Ga0495648_0337206 3300046524 Unclassified 693
321 Ga0495652_0051025 3300046529 Bacteria 3535
322 Ga0495652_1008398 3300046529 Bacteria 544
323 Ga0495587_0183746 3300046536 Bacteria 1185
324 Ga0495609_0122417 3300046538 Bacteria 1117
325 Ga0495622_0082770 3300046557 Bacteria 1476
326 Ga0495633_0367838 3300046558 Unclassified 651
327 Ga0495624_0424757 3300046690 Bacteria 797
328 Ga0495674_0163232 3300047319 Bacteria 1863
329 Ga0495672_0072397 3300047320 Bacteria 1947
330 Ga0495672_0425440 3300047320 Unclassified 603
331 Ga0495675_0753978 3300047444 Bacteria 542
332 Ga0495673_0108296 3300047469 Bacteria 1114
333 Ga0495593_0385979 3300047673 Bacteria 700
334 Ga0495602_0101444 3300048088 Bacteria 2361
335 Ga0496102_1675606 3300048905 Unclassified 554
336 Ga0496112_1924572 3300048915 Unclassified 503
337 Ga0496115_0308015 3300048918 Bacteria 1297
338 Ga0496126_0209208 3300048929 Bacteria 1643
339 Ga0496126_0588517 3300048929 Bacteria 878
340 Ga0501031_0626811 3300049568 Bacteria 691
341 Ga0501033_0076484 3300049570 Bacteria 2457
342 Ga0501033_0212833 3300049570 Bacteria 1378
343 Ga0501033_0232239 3300049570 Unclassified 1310
344 Ga0501033_0329517 3300049570 Bacteria 1071
345 Ga0501033_0361535 3300049570 Bacteria 1016
346 Ga0501034_0285358 3300049571 Bacteria 1590
347 Ga0501034_0288979 3300049571 Bacteria 1578
348 Ga0501034_0496111 3300049571 Bacteria 1135
349 Ga0501037_0413095 3300049573 Bacteria 924
350 Ga0501038_0304092 3300049574 Bacteria 1251
351 Ga0501043_0044360 3300049579 Bacteria 3496
352 Ga0501043_0290205 3300049579 Bacteria 1252
353 Ga0501043_1079916 3300049579 Bacteria 568
354 Ga0501047_0009625 3300049581 Bacteria 9138
355 Ga0501047_0045014 3300049581 Bacteria 4266
356 Ga0501047_0178906 3300049581 Bacteria 1988
357 Ga0501047_0253318 3300049581 Bacteria 1609
358 Ga0501047_0358612 3300049581 Bacteria 1294
359 Ga0501047_0585756 3300049581 Bacteria 938
360 Ga0501048_0397474 3300049582 Bacteria 985
361 Ga0501048_1085036 3300049582 Bacteria 576
362 Ga0501070_0464053 3300049586 Bacteria 1020
363 Ga0501073_0008918 3300049589 Bacteria 7410
364 Ga0501073_0144472 3300049589 Bacteria 1649
365 Ga0501073_0189525 3300049589 Bacteria 1423
366 Ga0501073_0222758 3300049589 Bacteria 1303
367 Ga0501073_0265158 3300049589 Unclassified 1185
368 Ga0501074_0334558 3300049590 Unclassified 1075
369 Ga0501080_0127007 3300049742 Bacteria 2362
370 Ga0501080_0378438 3300049742 Bacteria 1276
371 Ga0501083_0375900 3300049744 Bacteria 924
372 Ga0501083_0636431 3300049744 Unclassified 694
373 Ga0501035_0087809 3300049822 Bacteria 2740
374 Ga0501035_0214305 3300049822 Bacteria 1647
375 Ga0501035_0798569 3300049822 Bacteria 754
376 Ga0501044_0053542 3300049823 Bacteria 4151
377 Ga0501044_0500565 3300049823 Bacteria 1116
378 Ga0501044_0557224 3300049823 Bacteria 1043
379 Ga0501044_0946517 3300049823 Bacteria 734
380 nmdc:mga0yw44_406770_c1 3300050492 Bacteria 920
381 nmdc:mga0n895_1111463_c1 3300050512 Bacteria 767
382 nmdc:mga0rr50_337916_c1 3300050513 Bacteria 1265
383 Ga0495601_0144153 3300053077 Bacteria 1554
384 Ga0500635_0073853 3300053080 Bacteria 1214
385 Ga0495595_0009145 3300053084 Bacteria 4093
386 Ga0495619_0176368 3300053085 Bacteria 1478
387 Ga0500643_000003 3300053087 Bacteria 876659
388 Ga0500566_0331835 3300053094 Unclassified 704
389 Ga0500595_003515 3300053119 Bacteria 7287
390 Ga0500595_012701 3300053119 Bacteria 3248
391 Ga0500614_172473 3300053123 Bacteria 659
392 Ga0500655_024804 3300053133 Bacteria 1136
393 Ga0500573_0000037 3300053140 Bacteria 107603
394 Ga0500577_0312009 3300053142 Unclassified 687
395 Ga0500619_306833 3300053154 Unclassified 511
396 Ga0501084_0245047 3300054114 Bacteria 1513
397 Ga0501082_0622836 3300060353 Bacteria 944
398 Ga0105237_11868680
399 JGI25165J46597_1000036
400 Ga0070658_10021167
401 Ga0070658_10029785
402 Ga0070658_10146680
403 Ga0070658_10200445
404 Ga0070658_10949475
405 Ga0070676_10003084
406 Ga0070676_10384367
407 Ga0070683_100599843
408 Ga0070683_101416309
409 Ga0070670_100241417
410 Ga0070670_100452032
411 Ga0070670_100676746
412 Ga0068869_101081291
413 Ga0070666_10272560
414 Ga0070680_101465864
415 Ga0068868_100215307
416 Ga0068868_100343582
417 Ga0068868_100398004
418 Ga0068868_100860691
419 Ga0070660_100363174
420 Ga0070660_100445020
421 Ga0070661_100031637
422 Ga0070661_100393428
423 Ga0070661_100793586
424 Ga0070661_101773299
425 Ga0070675_100436320
426 Ga0070671_100044371
427 Ga0070674_100747026
428 Ga0070673_100377196
429 Ga0070659_100184703
430 Ga0070659_100897050
431 Ga0070667_100128112
432 Ga0070667_100212343
433 Ga0070667_101844397
434 Ga0070714_101268128
435 Ga0070713_100514549
436 Ga0070701_10319861
437 Ga0070700_100363188
438 Ga0070700_100668389
439 Ga0070678_100032733
440 Ga0070678_100301146
441 Ga0070678_101305617
442 Ga0070678_101448009
443 Ga0070662_101639352
444 Ga0070681_10071861
445 Ga0070681_10180906
446 Ga0068867_100010889
447 Ga0068867_100032708
448 Ga0068867_100421118
449 Ga0070679_100140524
450 Ga0070684_100158085
451 Ga0068853_100621591
452 Ga0070695_100401458
453 Ga0070693_100725369
454 Ga0070665_100000381
455 Ga0070665_100033021
456 Ga0070665_100664024
457 Ga0070665_101071562
458 Ga0070665_101285112
459 Ga0068855_100121122
460 Ga0068855_100343782
461 Ga0068855_100345044
462 Ga0068855_100375135
463 Ga0068855_100635658
464 Ga0068855_101901226
465 Ga0068857_101480998
466 Ga0068854_100388816
467 Ga0070702_100334935
468 Ga0068852_100040826
469 Ga0068852_100042502
470 Ga0068852_100398153
471 Ga0068859_101283600
472 Ga0068864_100381011
473 Ga0068864_101759907
474 Ga0068864_102199430
475 Ga0068866_10033241
476 Ga0068861_101451318
477 Ga0068861_102498056
478 Ga0068870_10154771
479 Ga0068870_10321550
480 Ga0068863_102316630
481 Ga0068858_100379194
482 Ga0068858_100758674
483 Ga0068860_101008722
484 Ga0068862_100882814
485 Ga0068862_101114841
486 Ga0075365_10353490
487 Ga0097621_100000209
488 Ga0097621_100016590
489 Ga0097621_100057973
490 Ga0068871_100002253
491 Ga0068871_100063684
492 Ga0068871_100238310
493 Ga0068871_100320009
494 Ga0068871_100691328
495 Ga0068865_100002773
496 Ga0068865_100124755
497 Ga0097620_101283436
498 Ga0099795_10142862
499 Ga0099795_10611425
500 Ga0105240_10312373
501 Ga0105240_10402381
502 Ga0105240_10461801
503 Ga0105240_10643081
504 Ga0105240_10785161
505 Ga0105240_10840821
506 Ga0105240_11288063
507 Ga0105245_10239856
508 Ga0105245_10603148
509 Ga0105245_11737248
510 Ga0105243_10020198
511 Ga0105243_12432326
512 Ga0105241_10250600
513 Ga0105241_10395436
514 Ga0105241_10467314
515 Ga0105241_10663065
516 Ga0105242_10012177
517 Ga0105242_10019567
518 Ga0105242_10023524
519 Ga0105242_10083778
520 Ga0105242_10332781
521 Ga0105248_10000005
522 Ga0105248_11252641
523 Ga0105248_13154656
524 Ga0105237_10121075
525 Ga0105237_10940034
526 Ga0105237_12640457
527 Ga0105238_10090833
528 Ga0105238_10099827
529 Ga0105238_10407488
530 Ga0105238_11555664
531 Ga0105238_11755710
532 Ga0105238_12193502
533 Ga0105249_11426422
534 Ga0105147_106867
535 Ga0099796_10006309
536 Ga0099796_10319760
537 Ga0105239_10144837
538 Ga0105239_10348491
539 Ga0105239_10428406
540 Ga0105239_10698569
541 Ga0105246_10007171
542 Ga0157370_10285470
543 Ga0157370_10478090
544 Ga0157369_10009212
545 Ga0157369_10114533
546 Ga0157374_10022605
547 Ga0157374_10444207
548 Ga0157378_10148084
549 Ga0157378_10431040
550 Ga0157378_11430909
551 Ga0163162_10037764
552 Ga0163162_10062534
553 Ga0163162_10107516
554 Ga0163162_12052858
555 Ga0157375_10237407
556 Ga0157375_12148781
557 Ga0157375_12769485
558 Ga0163163_10000015
559 Ga0163163_10212669
560 Ga0157380_10142171
561 Ga0157380_11831357
562 Ga0157379_10000349
563 Ga0157379_10044600
564 Ga0157379_10883687
565 Ga0157376_10007081
566 Ga0157376_10313541
567 Ga0157376_10551929
568 Ga0157376_12840970
569 Ga0163161_10009672
570 Ga0213876_10029834
571 Ga0213876_10220719
572 Ga0207427_108078
573 Ga0209233_1000015
574 Ga0209233_1008503
575 Ga0207642_10003420
576 Ga0207688_10121855
577 Ga0207680_10463481
578 Ga0207645_10064758
579 Ga0207645_10413303
580 Ga0207705_10034376
581 Ga0207705_10177225
582 Ga0207705_10419110
583 Ga0207705_11203936
584 Ga0207654_10154382
585 Ga0207654_10165173
586 Ga0207654_10578295
587 Ga0207654_10919541
588 Ga0207707_10205821
589 Ga0207707_10209264
590 Ga0207695_10274394
591 Ga0207695_10523346
592 Ga0207660_11345279
593 Ga0207657_10242423
594 Ga0207657_10706212
595 Ga0207649_10715110
596 Ga0207652_10471973
597 Ga0207652_10621724
598 Ga0207652_10938803
599 Ga0207652_11194068
600 Ga0207681_10261098
601 Ga0207694_10064968
602 Ga0207694_10119933
603 Ga0207694_11513857
604 Ga0207650_10296786
605 Ga0207650_10365735
606 Ga0207659_11327306
607 Ga0207687_10114495
608 Ga0207687_10961529
609 Ga0207687_11116009
610 Ga0207700_10597143
611 Ga0207700_11440886
612 Ga0207664_11465308
613 Ga0207644_10042012
614 Ga0207690_10808056
615 Ga0207706_10268703
616 Ga0207686_10036832
617 Ga0207686_10247084
618 Ga0207686_11512848
619 Ga0207709_10018456
620 Ga0207669_10728498
621 Ga0207669_10737597
622 Ga0207704_10003862
623 Ga0207704_10236592
624 Ga0207691_11278203
625 Ga0207711_10000002
626 Ga0207711_10407365
627 Ga0207711_11380294
628 Ga0207689_10156513
629 Ga0207689_10780986
630 Ga0207661_10043243
631 Ga0207661_10966047
632 Ga0207661_11184012
633 Ga0207667_10050836
634 Ga0207667_10329461
635 Ga0207667_10694713
636 Ga0207667_10869591
637 Ga0207667_11377282
638 Ga0207651_10009917
639 Ga0207712_10294212
640 Ga0207712_12095568
641 Ga0207640_10291874
642 Ga0207658_10079228
643 Ga0207658_10120620
644 Ga0207658_11890317
645 Ga0207677_10140027
646 Ga0207677_10236896
647 Ga0207677_10263290
648 Ga0207703_10302862
649 Ga0207639_11068843
650 Ga0207639_11490361
651 Ga0207708_10412714
652 Ga0207702_10253042
653 Ga0207702_10982972
654 Ga0207702_11546443
655 Ga0207648_10007588
656 Ga0207648_10020227
657 Ga0207648_10295581
658 Ga0207676_10165016
659 Ga0207674_10797054
660 Ga0207674_11051231
661 Ga0207674_11277308
662 Ga0207675_101752893
663 Ga0207683_10047876
664 Ga0207683_10165517
665 Ga0207683_10465516
666 Ga0207698_10056440
667 Ga0207698_10326233
668 Ga0207698_10628723
669 Ga0268266_10000900
670 Ga0268266_10041761
671 Ga0268266_10049573
672 Ga0268266_10779326
673 Ga0268266_11111522
674 Ga0268266_11163524
675 Ga0268265_11833286
676 Ga0268264_10308087
677 Ga0268264_10566888
678 Ga0265338_10007775
679 Ga0265330_10109472
680 Ga0265320_10152875
681 Ga0265325_10000950
682 Ga0265329_10083551
683 Ga0265340_10336219
684 Ga0265339_10001402
685 Ga0265331_10072446
686 Ga0265331_10087118
687 Ga0265316_10060892
688 Ga0265316_10260692
689 Ga0265313_10000672
690 Ga0265313_10033278
691 Ga0265313_10404694
692 Ga0265314_10259050
693 Ga0265314_10481165
694 Ga0265342_10636578
695 Ga0307516_10046235
696 Ga0307516_10064348
697 Ga0373950_0015636
698 Ga0373926_0373925
699 Ga0373936_0098088
700 Ga0373927_0015623
701 Ga0373947_0357764
702 Ga0395898_0045842
703 Ga0395901_0079597
704 Ga0395901_1515765
705 Ga0436365_1000935
706 Ga0436365_1627614
707 Ga0451793_0490877
708 Ga0451802_0323929
709 Ga0466957_0844063
710 Ga0466959_0096241
711 Ga0495651_0171288
712 Ga0495653_0407502
713 Ga0495585_0076239
714 Ga0495606_0226478
715 Ga0495618_0137327
716 Ga0495630_1166592
717 Ga0495648_0337206
718 Ga0495652_0051025
719 Ga0495652_1008398
720 Ga0495587_0183746
721 Ga0495609_0122417
722 Ga0495622_0082770
723 Ga0495633_0367838
724 Ga0495624_0424757
725 Ga0495674_0163232
726 Ga0495672_0072397
727 Ga0495672_0425440
728 Ga0495675_0753978
729 Ga0495673_0108296
730 Ga0495593_0385979
731 Ga0495602_0101444
732 Ga0496102_1675606
733 Ga0496112_1924572
734 Ga0496115_0308015
735 Ga0496126_0209208
736 Ga0496126_0588517
737 Ga0501031_0626811
738 Ga0501033_0076484
739 Ga0501033_0212833
740 Ga0501033_0232239
741 Ga0501033_0329517
742 Ga0501033_0361535
743 Ga0501034_0285358
744 Ga0501034_0288979
745 Ga0501034_0496111
746 Ga0501037_0413095
747 Ga0501038_0304092
748 Ga0501043_0044360
749 Ga0501043_0290205
750 Ga0501043_1079916
751 Ga0501047_0009625
752 Ga0501047_0045014
753 Ga0501047_0178906
754 Ga0501047_0253318
755 Ga0501047_0358612
756 Ga0501047_0585756
757 Ga0501048_0397474
758 Ga0501048_1085036
759 Ga0501070_0464053
760 Ga0501073_0008918
761 Ga0501073_0144472
762 Ga0501073_0189525
763 Ga0501073_0222758
764 Ga0501073_0265158
765 Ga0501074_0334558
766 Ga0501080_0127007
767 Ga0501080_0378438
768 Ga0501083_0375900
769 Ga0501083_0636431
770 Ga0501035_0087809
771 Ga0501035_0214305
772 Ga0501035_0798569
773 Ga0501044_0053542
774 Ga0501044_0500565
775 Ga0501044_0557224
776 Ga0501044_0946517
777 nmdc:mga0yw44_406770_c1
778 nmdc:mga0n895_1111463_c1
779 nmdc:mga0rr50_337916_c1
780 Ga0495601_0144153
781 Ga0500635_0073853
782 Ga0495595_0009145
783 Ga0495619_0176368
784 Ga0500643_000003
785 Ga0500566_0331835
786 Ga0500595_003515
787 Ga0500595_012701
788 Ga0500614_172473
789 Ga0500655_024804
790 Ga0500573_0000037
791 Ga0500577_0312009
792 Ga0500619_306833
793 Ga0501084_0245047
794 Ga0501082_0622836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06108

DUF952

Protein of unknown function (DUF952)

6

95

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o0q-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 from caulobacter crescentus. northeast structural genomics consortium target ccr55 0.917 4 108
2o0p-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55. 0.913 4 108
2jqn-assembly1.cif.gz_A solution nmr structure of cc0527 from caulobacter crescentus. northeast structural genomics target ccr55 0.8614 4 106
2o0q-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 from caulobacter crescentus. northeast structural genomics consortium target ccr55 0.8483 4 108
2o0p-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55. 0.8451 4 108
ID Description Score Start End Superfamily
2o0pA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.9033 4 108 3.20.170.20
af_Q0DQS8_1_107_3.20.170.20 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8848 12 107 3.20.170.20
2jqnA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8614 4 106 3.20.170.20
2o0pA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8355 4 108 3.20.170.20
af_O07206_8_119_3.20.170.20 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8192 4 107 3.20.170.20
ID Description Score Start End GO Terms
AF-A0A7V9MW51-F1-model_v4 DUF952 domain-containing protein 0.9997 1 113
AF-A0A2M7CTI4-F1-model_v4 Uncharacterized protein 0.9858 33 98
AF-A0A2D6JGD2-F1-model_v4 Glutathione S-transferase 0.9574 3 100
AF-A0A439ZUE4-F1-model_v4 Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) (DHOdehase) (DHOD) (DHODase) (Dihydroorotate oxidase) 0.9569 1 112 GO:0005737
GO:0005886
GO:0006207
GO:0044205
GO:0106430
AF-A0A5C5WEY3-F1-model_v4 DUF952 domain-containing protein 0.9565 1 100

Map