F433758

General Info

Members Datasets Scaffolds Average Seq Length
397 266 792 424

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10116194|Ga0105239_101161942
Length 498
Sequence MHIRSGEHVFAGKSDERAVSICGGRACCGCGQKRICLLSERPIADIVHAGVCSTIAIDESGCCEGGAMKLQSYWTDTAPRFTPQAAEWPASVDVAVVGAGFTGLSAALALAARGARVAVLEAGDCVAFEASGRNGGHVNNGLAHDYGELADKVGVEQARAWYHAYDAAVDTIERLVREEAIDCGFARNGKLKLATKPAHYDALARSAERLRADEVDIDIELLDRARVRAGEIGSERFAGGLVYRRSAQMHMGRFANGLAAAVERKGGKIFLQSTVERIERGDNGKPATLHTTRGPLHAGQTLLANGAGRHGSYREFGWLRRRMVPVGSFIIATAPLGRERAQRLIAQRRTCTTVANIHHYFRLTDDDRLILGGRAHFGVSSLKSDARSAPILREGMLSIFPQLADVEIDYCWGGVVDMTRDRLPQAGERDGVWYSTGYSGHGTQMSVHMGQVMAQIMSGEAMANPWGGRAWPAIPGHFGPPWFLPLVGAYYRAKDRFS

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
91 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
175 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
176 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
180 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
181 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
182 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
183 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
184 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
185 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
186 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
187 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
188 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
191 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
208 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
222 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
230 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
231 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
234 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
235 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
236 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
237 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
238 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
239 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
240 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
241 2643221736 Bosea sp. Root483D1 Isolate Unclassified
242 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
243 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
244 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
245 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
246 2841760612 Bosea sp. Tri-49 Isolate Nodule
247 2844104063 Bosea sp. Tri-39 Isolate Nodule
248 2847085930 Erwinia persicina B64 Isolate Bulb
249 2851182111 Bosea sp. Tri-44 Isolate Nodule
250 2851246043 Bosea sp. Tri-54 Isolate Nodule
251 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
252 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
253 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
254 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
255 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
256 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
257 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
258 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
259 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
260 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
261 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
262 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
263 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
264 639633007 Azoarcus olearius BH72 Isolate Unclassified
265 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
266 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.18
Metatranscriptomes 0
Isolates 8.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.25
Endosphere 18.39
Nodule 1.26
Rhizoplane 0
Rhizosphere 66.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10116194 3300010375 Bacteria 2969
2 JGI24741J21665_1001602 3300001915 Bacteria 6351
3 JGI24740J21852_10000121 3300001979 Bacteria 29039
4 JGI24740J21852_10014072 3300001979 Bacteria 2963
5 JGI25155J39150_1000035 3300002704 Bacteria 99118
6 JGI25156J39149_1000012 3300002705 Bacteria 194393
7 JGI25154J39366_1000029 3300002738 Bacteria 194393
8 JGI25157J39369_1000014 3300002741 Bacteria 194393
9 JGI25152J39213_1002123 3300002773 Bacteria 7778
10 JGI25159J45721_1000054 3300002987 Bacteria 56576
11 JGI25159J45721_1004190 3300002987 Bacteria 4865
12 JGI25151J46595_10001430 3300003187 Bacteria 16253
13 JGI25151J46595_10003954 3300003187 Bacteria 7984
14 JGI25153J46596_10003502 3300003215 Bacteria 8762
15 rootH1_10003154 3300003316 Bacteria 20061
16 rootL2_10001152 3300003322 Bacteria 8628
17 JGI25160J50197_1000088 3300003354 Bacteria 93050
18 JGI25160J50197_1000119 3300003354 Bacteria 71366
19 JGI25161J50226_1000056 3300003374 Bacteria 103097
20 Ga0055538_1000231 3300003751 Bacteria 31098
21 Ga0055526_1004199 3300003771 Bacteria 8751
22 Ga0055526_1004858 3300003771 Bacteria 7923
23 Ga0055537_1000339 3300003773 Bacteria 31974
24 Ga0055524_1000299 3300003775 Bacteria 47507
25 Ga0055536_1020146 3300003781 Bacteria 2070
26 Ga0055534_1003838 3300003784 Bacteria 4586
27 Ga0055528_1002865 3300003790 Bacteria 8977
28 Ga0055530_10000854 3300003791 Bacteria 25157
29 Ga0055540_1000818 3300003792 Bacteria 20993
30 Ga0055531_10000935 3300003794 Bacteria 23574
31 Ga0055541_1000165 3300003841 Bacteria 32147
32 Ga0058692_1002319 3300003856 Bacteria 6433
33 Ga0055543_1000755 3300004625 Bacteria 16208
34 Ga0065165_1000551 3300005262 Bacteria 56364
35 Ga0065714_10067375 3300005288 Bacteria 5589
36 Ga0070676_10009475 3300005328 Bacteria 5260
37 Ga0070690_100006071 3300005330 Bacteria 6834
38 Ga0070670_100025939 3300005331 Bacteria 5043
39 Ga0070670_100085791 3300005331 Bacteria 2705
40 Ga0070666_10002707 3300005335 Bacteria 10698
41 Ga0068868_100011890 3300005338 Bacteria 6347
42 Ga0070661_100010840 3300005344 Bacteria 6346
43 Ga0070661_100141153 3300005344 Bacteria 1816
44 Ga0070661_100186668 3300005344 Bacteria 1580
45 Ga0070669_100002807 3300005353 Bacteria 12570
46 Ga0070675_100002247 3300005354 Bacteria 14312
47 Ga0070675_100006876 3300005354 Bacteria 8732
48 Ga0070671_100025526 3300005355 Bacteria 4850
49 Ga0070671_100078145 3300005355 Bacteria 2766
50 Ga0070673_100005124 3300005364 Bacteria 8357
51 Ga0070673_100008576 3300005364 Bacteria 6803
52 Ga0070667_100058895 3300005367 Bacteria 3248
53 Ga0070667_100196697 3300005367 Bacteria 1787
54 Ga0070714_100209043 3300005435 Bacteria 1788
55 Ga0070663_100000248 3300005455 Bacteria 27309
56 Ga0070663_100131479 3300005455 Bacteria 1901
57 Ga0070678_100013133 3300005456 Bacteria 5179
58 Ga0070662_100014736 3300005457 Bacteria 5225
59 Ga0070662_100101875 3300005457 Bacteria 2174
60 Ga0068867_100000984 3300005459 Bacteria 19443
61 Ga0068867_100041949 3300005459 Bacteria 3344
62 Ga0070685_10001923 3300005466 Bacteria 10778
63 Ga0070685_10041942 3300005466 Bacteria 2609
64 Ga0068853_100035960 3300005539 Bacteria 4209
65 Ga0068853_100102275 3300005539 Bacteria 2535
66 Ga0070672_100007829 3300005543 Bacteria 7290
67 Ga0070665_100000227 3300005548 Bacteria 93439
68 Ga0070665_100060232 3300005548 Bacteria 3805
69 Ga0068855_100000609 3300005563 Bacteria 43917
70 Ga0068855_100010932 3300005563 Bacteria 10955
71 Ga0068855_100123940 3300005563 Bacteria 2956
72 Ga0068855_100214425 3300005563 Bacteria 2162
73 Ga0070664_100000612 3300005564 Bacteria 27309
74 Ga0070664_100046583 3300005564 Bacteria 3662
75 Ga0068857_100184805 3300005577 Bacteria 1897
76 Ga0068854_100009249 3300005578 Bacteria 6358
77 Ga0068854_100010398 3300005578 Bacteria 6033
78 Ga0068854_100039055 3300005578 Bacteria 3341
79 Ga0068854_100119947 3300005578 Bacteria 1995
80 Ga0068856_100001062 3300005614 Bacteria 29080
81 Ga0068852_100050942 3300005616 Bacteria 3551
82 Ga0068864_100046205 3300005618 Bacteria 3735
83 Ga0068861_100081576 3300005719 Bacteria 2532
84 Ga0068851_10001399 3300005834 Bacteria 10544
85 Ga0068851_10061318 3300005834 Bacteria 1927
86 Ga0068851_10069016 3300005834 Bacteria 1825
87 Ga0068858_100004031 3300005842 Bacteria 14495
88 Ga0075365_10003593 3300006038 Bacteria 8026
89 Ga0075365_10024460 3300006038 Bacteria 3811
90 Ga0075368_10017774 3300006042 Bacteria 2665
91 Ga0075363_100008026 3300006048 Bacteria 4892
92 Ga0075432_10010495 3300006058 Bacteria 3144
93 Ga0075362_10009640 3300006177 Bacteria 3742
94 Ga0075362_10012833 3300006177 Bacteria 3338
95 Ga0075362_10027987 3300006177 Bacteria 2418
96 Ga0075367_10003071 3300006178 Bacteria 7833
97 Ga0075369_10026505 3300006186 Bacteria 2416
98 Ga0075366_10000282 3300006195 Bacteria 22748
99 Ga0075366_10010046 3300006195 Bacteria 5305
100 Ga0075366_10013027 3300006195 Bacteria 4728
101 Ga0075370_10015918 3300006353 Bacteria 4037
102 Ga0075370_10026369 3300006353 Bacteria 3219
103 Ga0068871_100094660 3300006358 Bacteria 2493
104 Ga0075430_100010626 3300006846 Bacteria 7800
105 Ga0075430_100019371 3300006846 Bacteria 5787
106 Ga0075429_100000391 3300006880 Bacteria 32193
107 Ga0068865_100123403 3300006881 Bacteria 1930
108 Ga0105240_10001044 3300009093 Bacteria 49217
109 Ga0105240_10005295 3300009093 Bacteria 19258
110 Ga0105240_10006221 3300009093 Bacteria 17557
111 Ga0105240_10040595 3300009093 Bacteria 5949
112 Ga0105240_10043932 3300009093 Bacteria 5682
113 Ga0105245_10084626 3300009098 Bacteria 2906
114 Ga0105245_10108441 3300009098 Bacteria 2579
115 Ga0105243_10102091 3300009148 Bacteria 2383
116 Ga0105241_10146119 3300009174 Bacteria 1930
117 Ga0105241_10186182 3300009174 Bacteria 1726
118 Ga0105237_10001808 3300009545 Bacteria 27606
119 Ga0105237_10013705 3300009545 Bacteria 8490
120 Ga0105237_10015986 3300009545 Bacteria 7803
121 Ga0105238_10000102 3300009551 Bacteria 94910
122 Ga0105238_10000111 3300009551 Bacteria 89931
123 Ga0105238_10006969 3300009551 Bacteria 11292
124 Ga0105249_10007119 3300009553 Bacteria 9765
125 Ga0105239_10001763 3300010375 Bacteria 28493
126 Ga0105239_10008101 3300010375 Bacteria 11995
127 Ga0105239_10008675 3300010375 Bacteria 11512
128 Ga0105246_10049156 3300011119 Bacteria 2887
129 Ga0157371_10001222 3300013102 Bacteria 27315
130 Ga0157374_10231376 3300013296 Bacteria 1815
131 Ga0157372_10001268 3300013307 Bacteria 27315
132 Ga0157375_10248491 3300013308 Bacteria 1939
133 Ga0157376_10034886 3300014969 Bacteria 4065
134 Ga0182006_1001634 3300015261 Bacteria 13236
135 Ga0182006_1005633 3300015261 Bacteria 5943
136 Ga0183362_10002 3300015683 Bacteria 1432711
137 Ga0163161_10000165 3300017792 Bacteria 60584
138 Ga0163161_10051349 3300017792 Bacteria 2986
139 Ga0209435_100002 3300025206 Bacteria 794178
140 Ga0209784_100066 3300025224 Bacteria 154427
141 Ga0209566_100125 3300025225 Bacteria 95628
142 Ga0209674_100344 3300025226 Bacteria 27195
143 Ga0209646_1000001 3300025246 Bacteria 3092932
144 Ga0209026_1000040 3300025250 Bacteria 277470
145 Ga0209759_1000001 3300025256 Bacteria 2799452
146 Ga0209129_1002422 3300025258 Bacteria 9168
147 Ga0209565_1000016 3300025263 Bacteria 477707
148 Ga0209673_1000995 3300025273 Bacteria 34587
149 Ga0209130_1000040 3300025284 Bacteria 262926
150 Ga0209130_1000190 3300025284 Bacteria 86573
151 Ga0209130_1002302 3300025284 Bacteria 9790
152 Ga0209675_1000401 3300025291 Bacteria 35752
153 Ga0209676_1000023 3300025292 Bacteria 589732
154 Ga0209025_1000174 3300025294 Bacteria 158915
155 Ga0209025_1000783 3300025294 Bacteria 52275
156 Ga0209025_1001126 3300025294 Bacteria 38269
157 Ga0209025_1016362 3300025294 Bacteria 4385
158 Ga0209025_1030704 3300025294 Bacteria 2564
159 Ga0209564_1001307 3300025295 Bacteria 26815
160 Ga0209564_1004644 3300025295 Bacteria 8263
161 Ga0209758_1000057 3300025297 Bacteria 333111
162 Ga0209050_1000022 3300025298 Bacteria 565239
163 Ga0209050_1010297 3300025298 Bacteria 4626
164 Ga0209256_1000001 3300025299 Bacteria 2166974
165 Ga0207426_1000188 3300025302 Bacteria 153510
166 Ga0207426_1002218 3300025302 Bacteria 13027
167 Ga0209051_1000013 3300025303 Bacteria 565239
168 Ga0209257_1001435 3300025304 Bacteria 28217
169 Ga0207697_10004886 3300025315 Bacteria 6320
170 Ga0207656_10011573 3300025321 Bacteria 3337
171 Ga0207682_10035993 3300025893 Bacteria 2002
172 Ga0207680_10001300 3300025903 Bacteria 11819
173 Ga0207647_10000500 3300025904 Bacteria 31386
174 Ga0207645_10042805 3300025907 Bacteria 2897
175 Ga0207643_10008486 3300025908 Bacteria 5513
176 Ga0207707_10009426 3300025912 Bacteria 8470
177 Ga0207695_10000007 3300025913 Bacteria 1092551
178 Ga0207695_10001698 3300025913 Bacteria 35307
179 Ga0207695_10009263 3300025913 Bacteria 12199
180 Ga0207695_10014078 3300025913 Bacteria 9499
181 Ga0207695_10014701 3300025913 Bacteria 9255
182 Ga0207695_10022351 3300025913 Bacteria 7182
183 Ga0207695_10037817 3300025913 Bacteria 5204
184 Ga0207695_10217555 3300025913 Bacteria 1819
185 Ga0207671_10003510 3300025914 Bacteria 15568
186 Ga0207671_10003884 3300025914 Bacteria 14588
187 Ga0207649_10006487 3300025920 Bacteria 6353
188 Ga0207649_10094680 3300025920 Bacteria 1963
189 Ga0207694_10000176 3300025924 Bacteria 66165
190 Ga0207694_10000199 3300025924 Bacteria 60220
191 Ga0207694_10003986 3300025924 Bacteria 11641
192 Ga0207694_10005080 3300025924 Bacteria 10170
193 Ga0207650_10008863 3300025925 Bacteria 6875
194 Ga0207650_10010601 3300025925 Bacteria 6329
195 Ga0207650_10048832 3300025925 Bacteria 3122
196 Ga0207650_10129691 3300025925 Bacteria 1972
197 Ga0207659_10010293 3300025926 Bacteria 5871
198 Ga0207644_10017245 3300025931 Bacteria 4873
199 Ga0207644_10018746 3300025931 Bacteria 4685
200 Ga0207706_10020155 3300025933 Bacteria 5992
201 Ga0207706_10229159 3300025933 Bacteria 1626
202 Ga0207709_10038900 3300025935 Bacteria 2837
203 Ga0207669_10071463 3300025937 Bacteria 2180
204 Ga0207704_10023016 3300025938 Bacteria 3350
205 Ga0207689_10065209 3300025942 Bacteria 2996
206 Ga0207679_10000490 3300025945 Bacteria 27325
207 Ga0207667_10000146 3300025949 Bacteria 106926
208 Ga0207667_10002981 3300025949 Bacteria 21034
209 Ga0207712_10000169 3300025961 Bacteria 67461
210 Ga0207668_10041697 3300025972 Bacteria 3105
211 Ga0207640_10001595 3300025981 Bacteria 12185
212 Ga0207640_10019836 3300025981 Bacteria 3980
213 Ga0207640_10030091 3300025981 Bacteria 3341
214 Ga0207658_10049576 3300025986 Bacteria 3086
215 Ga0207658_10197313 3300025986 Bacteria 1677
216 Ga0207703_10001066 3300026035 Bacteria 26163
217 Ga0207639_10001687 3300026041 Bacteria 14904
218 Ga0207639_10261766 3300026041 Bacteria 1513
219 Ga0207678_10000901 3300026067 Bacteria 27267
220 Ga0207678_10152761 3300026067 Bacteria 1972
221 Ga0207702_10001124 3300026078 Bacteria 27325
222 Ga0207648_10011610 3300026089 Bacteria 8294
223 Ga0207648_10011635 3300026089 Bacteria 8282
224 Ga0207648_10023140 3300026089 Bacteria 5572
225 Ga0207676_10016021 3300026095 Bacteria 5424
226 Ga0207674_10153419 3300026116 Bacteria 2259
227 Ga0207675_100161366 3300026118 Bacteria 2138
228 Ga0207683_10031899 3300026121 Bacteria 4575
229 Ga0207683_10218613 3300026121 Bacteria 1736
230 Ga0207698_10046129 3300026142 Bacteria 3288
231 Ga0207698_10158013 3300026142 Bacteria 1978
232 Ga0268266_10000006 3300028379 Bacteria 1410021
233 Ga0307515_10000047 3300028794 Bacteria 291475
234 Ga0307515_10001293 3300028794 Bacteria 56861
235 Ga0307515_10001625 3300028794 Bacteria 50019
236 Ga0307515_10017866 3300028794 Bacteria 12888
237 Ga0307515_10021154 3300028794 Bacteria 11550
238 Ga0307515_10029411 3300028794 Bacteria 9285
239 Ga0307515_10079855 3300028794 Bacteria 4277
240 Ga0307512_10050142 3300030522 Bacteria 3356
241 Ga0265332_10005816 3300031238 Bacteria 5655
242 Ga0307513_10001531 3300031456 Bacteria 33094
243 Ga0307513_10019211 3300031456 Bacteria 8141
244 Ga0307408_100000114 3300031548 Bacteria 89451
245 Ga0307408_100000939 3300031548 Bacteria 22685
246 Ga0307408_100001459 3300031548 Bacteria 17556
247 Ga0307408_100031255 3300031548 Bacteria 3707
248 Ga0307408_100098210 3300031548 Bacteria 2225
249 Ga0307514_10000560 3300031649 Bacteria 71030
250 Ga0307514_10000850 3300031649 Bacteria 49169
251 Ga0307514_10006070 3300031649 Bacteria 10616
252 Ga0307514_10017249 3300031649 Bacteria 5945
253 Ga0265314_10099800 3300031711 Bacteria 1869
254 Ga0307516_10002036 3300031730 Bacteria 27557
255 Ga0307406_10000738 3300031901 Bacteria 18317
256 Ga0307412_10042310 3300031911 Bacteria 2960
257 Ga0307412_10058649 3300031911 Bacteria 2576
258 Ga0307416_100169581 3300032002 Bacteria 2030
259 Ga0307414_10073698 3300032004 Bacteria 2471
260 Ga0307411_10000452 3300032005 Bacteria 14127
261 Ga0307411_10008681 3300032005 Bacteria 5283
262 Ga0307411_10138370 3300032005 Bacteria 1791
263 Ga0373946_0060159 3300035171 Bacteria 1614
264 Ga0373931_0001826 3300035691 Bacteria 9251
265 Ga0373925_0009219 3300037068 Bacteria 7183
266 Ga0395905_0020378 3300037471 Bacteria 6282
267 Ga0395905_0030906 3300037471 Bacteria 5044
268 Ga0395905_0031317 3300037471 Bacteria 5007
269 Ga0395905_0052431 3300037471 Bacteria 3818
270 Ga0395905_0197298 3300037471 Bacteria 1887
271 Ga0395901_0063480 3300038443 Bacteria 3844
272 Ga0395901_0125458 3300038443 Bacteria 2698
273 Ga0436365_0289460 3300039437 Bacteria 3173
274 Ga0436365_1044326 3300039437 Bacteria 1481
275 Ga0436361_0019740 3300039447 Bacteria 4403
276 Ga0436361_0539947 3300039447 Bacteria 2723
277 Ga0439438_009647 3300041405 Bacteria 3111
278 Ga0439439_0003184 3300041406 Bacteria 3593
279 Ga0439439_0017445 3300041406 Bacteria 1765
280 Ga0439447_012380 3300041407 Bacteria 2452
281 Ga0439466_0013518 3300041411 Bacteria 2987
282 Ga0439466_0017979 3300041411 Bacteria 2540
283 Ga0439465_0003011 3300041413 Bacteria 5506
284 Ga0439431_0001148 3300041997 Bacteria 5775
285 Ga0439431_0021207 3300041997 Bacteria 1558
286 Ga0439433_0000838 3300041999 Bacteria 6088
287 Ga0439442_005221 3300042002 Bacteria 2605
288 Ga0439442_010517 3300042002 Bacteria 1877
289 Ga0439445_0000111 3300042004 Bacteria 13692
290 Ga0439432_000115 3300042006 Bacteria 26036
291 Ga0439432_002292 3300042006 Bacteria 7215
292 Ga0439449_0000592 3300042007 Bacteria 13593
293 Ga0439449_0003187 3300042007 Bacteria 6391
294 Ga0439449_0004988 3300042007 Bacteria 5105
295 Ga0439452_000809 3300042010 Bacteria 14716
296 Ga0439457_001132 3300042014 Bacteria 8018
297 Ga0450919_000104 3300042121 Bacteria 8491
298 Ga0450921_000604 3300042123 Bacteria 1791
299 Ga0450890_000470 3300042127 Bacteria 5905
300 Ga0450891_000012 3300042129 Bacteria 13677
301 Ga0450892_000656 3300042130 Bacteria 3910
302 Ga0450896_001335 3300042133 Bacteria 2999
303 Ga0450908_004232 3300042184 Bacteria 2773
304 Ga0450909_005098 3300042185 Bacteria 1887
305 Ga0439434_0000605 3300042435 Bacteria 10328
306 Ga0439434_0018311 3300042435 Bacteria 2096
307 Ga0439434_0020681 3300042435 Bacteria 1977
308 Ga0450918_000256 3300042531 Bacteria 12019
309 Ga0450893_0001708 3300042532 Bacteria 3377
310 Ga0466965_0046237 3300044683 Bacteria 2154
311 Ga0466965_0081906 3300044683 Bacteria 1632
312 Ga0466965_0089925 3300044683 Bacteria 1561
313 Ga0466966_0022355 3300044684 Bacteria 4151
314 Ga0466961_0000867 3300044693 Bacteria 18878
315 Ga0453684_0000789 3300044712 Bacteria 108459
316 Ga0466960_0008368 3300044901 Bacteria 4235
317 Ga0466959_0062817 3300045049 Bacteria 2698
318 Ga0451576_0050768 3300045051 Bacteria 4349
319 Ga0495627_009112 3300046453 Bacteria 3665
320 Ga0495591_000650 3300046458 Bacteria 25660
321 Ga0495605_0045490 3300046474 Bacteria 2163
322 Ga0495605_0074605 3300046474 Bacteria 1596
323 Ga0495610_0031668 3300046512 Bacteria 2756
324 Ga0495610_0037445 3300046512 Bacteria 2469
325 Ga0495620_0003900 3300046515 Bacteria 8508
326 Ga0495632_0020148 3300046519 Bacteria 3618
327 Ga0495637_0005176 3300046520 Bacteria 6680
328 Ga0495643_0013487 3300046522 Bacteria 4887
329 Ga0495654_0000009 3300046530 Bacteria 381872
330 Ga0495609_0049521 3300046538 Bacteria 1875
331 Ga0495597_0037610 3300046542 Bacteria 2173
332 Ga0495625_0000052 3300046660 Bacteria 190656
333 Ga0495625_0002800 3300046660 Bacteria 18376
334 Ga0495670_0104856 3300046691 Bacteria 1459
335 Ga0495660_0068628 3300046810 Bacteria 1886
336 Ga0495687_000242 3300047443 Bacteria 75081
337 Ga0496116_0000143 3300048919 Bacteria 149129
338 Ga0496117_0122560 3300048920 Bacteria 1594
339 Ga0496118_0010901 3300048921 Bacteria 8940
340 Ga0496118_0031447 3300048921 Bacteria 4400
341 Ga0496119_0000012 3300048922 Bacteria 411917
342 Ga0496119_0001268 3300048922 Bacteria 31385
343 Ga0496120_0000263 3300048923 Bacteria 87504
344 Ga0496125_0024965 3300048928 Bacteria 5484
345 Ga0501034_0000178 3300049571 Bacteria 118886
346 Ga0501034_0012784 3300049571 Bacteria 8658
347 Ga0501265_001574 3300049762 Bacteria 2571
348 Ga0501266_000060 3300049763 Bacteria 16482
349 Ga0501035_0154820 3300049822 Bacteria 1987
350 nmdc:mga0k408_23517_c1 3300050493 Bacteria 3477
351 nmdc:mga06z11_22550_c1 3300050494 Bacteria 2943
352 nmdc:mga07m45_17755_c1 3300050496 Bacteria 3828
353 nmdc:mga07m45_19295_c1 3300050496 Bacteria 3694
354 nmdc:mga07m45_2965_c1 3300050496 Bacteria 8070
355 nmdc:mga07m45_74589_c1 3300050496 Bacteria 1933
356 nmdc:mga09592_728_c1 3300050508 Bacteria 25328
357 nmdc:mga0qj67_5599_c1 3300050509 Bacteria 9178
358 Ga0500610_0001411 3300053079 Bacteria 8165
359 Ga0500607_000211 3300053121 Bacteria 53358
360 Ga0500618_014256 3300053125 Bacteria 2034
361 Ga0500622_0020197 3300053156 Bacteria 3537
362 2511251062 2511231003 Bacteria 5606035
363 2521560974 2521172590 Bacteria 5047645
364 2553006130 2551306416 Bacteria 6152985
365 2587758712 2585428062 Bacteria 6842168
366 2643746305 2643221544 Bacteria 5886209
367 2644158810 2643221628 Bacteria 5745828
368 2644223083 2643221639 Bacteria 6649903
369 2644258014 2643221646 Bacteria 6433402
370 2644747059 2643221736 Bacteria 6608466
371 2776264265 2775506901 Bacteria 9631051
372 2776265203 2775506901 Bacteria 9631051
373 2776267574 2775506902 Bacteria 6208009
374 2809125499 2808606414 Bacteria 4917181
375 2819617358 2818991449 Bacteria 5518009
376 2841764104 2841760612 Bacteria 6454112
377 2844108441 2844104063 Bacteria 6440972
378 2847086930 2847085930 Bacteria 5070450
379 2851185430 2851182111 Bacteria 6047226
380 2851250539 2851246043 Bacteria 6439203
381 2857364729 2857357740 Bacteria 9937880
382 2894777077 2894772417 Bacteria 5305674
383 2904437823 2904434214 Bacteria 6230908
384 2904442400 2904439833 Bacteria 5931679
385 2904533672 2904530477 Bacteria 5876334
386 2904586626 2904584206 Bacteria 6028872
387 2904591560 2904589729 Bacteria 6113573
388 2904602302 2904601388 Bacteria 5884906
389 2919049822 2919046199 Bacteria 5567169
390 2919083374 2919079590 Bacteria 5946433
391 2923514827 2923510766 Bacteria 5926163
392 2928133678 2928130867 Bacteria 5467269
393 2945972660 2945972063 Bacteria 6086495
394 639785327 639633007 Bacteria 4376040
395 8002869580 8002869464 Bacteria 3588529
396 8057532092 8057529695 Bacteria 6306553
397 Ga0105239_10116194
398 JGI24741J21665_1001602
399 JGI24740J21852_10000121
400 JGI24740J21852_10014072
401 JGI25155J39150_1000035
402 JGI25156J39149_1000012
403 JGI25154J39366_1000029
404 JGI25157J39369_1000014
405 JGI25152J39213_1002123
406 JGI25159J45721_1000054
407 JGI25159J45721_1004190
408 JGI25151J46595_10001430
409 JGI25151J46595_10003954
410 JGI25153J46596_10003502
411 rootH1_10003154
412 rootL2_10001152
413 JGI25160J50197_1000088
414 JGI25160J50197_1000119
415 JGI25161J50226_1000056
416 Ga0055538_1000231
417 Ga0055526_1004199
418 Ga0055526_1004858
419 Ga0055537_1000339
420 Ga0055524_1000299
421 Ga0055536_1020146
422 Ga0055534_1003838
423 Ga0055528_1002865
424 Ga0055530_10000854
425 Ga0055540_1000818
426 Ga0055531_10000935
427 Ga0055541_1000165
428 Ga0058692_1002319
429 Ga0055543_1000755
430 Ga0065165_1000551
431 Ga0065714_10067375
432 Ga0070676_10009475
433 Ga0070690_100006071
434 Ga0070670_100025939
435 Ga0070670_100085791
436 Ga0070666_10002707
437 Ga0068868_100011890
438 Ga0070661_100010840
439 Ga0070661_100141153
440 Ga0070661_100186668
441 Ga0070669_100002807
442 Ga0070675_100002247
443 Ga0070675_100006876
444 Ga0070671_100025526
445 Ga0070671_100078145
446 Ga0070673_100005124
447 Ga0070673_100008576
448 Ga0070667_100058895
449 Ga0070667_100196697
450 Ga0070714_100209043
451 Ga0070663_100000248
452 Ga0070663_100131479
453 Ga0070678_100013133
454 Ga0070662_100014736
455 Ga0070662_100101875
456 Ga0068867_100000984
457 Ga0068867_100041949
458 Ga0070685_10001923
459 Ga0070685_10041942
460 Ga0068853_100035960
461 Ga0068853_100102275
462 Ga0070672_100007829
463 Ga0070665_100000227
464 Ga0070665_100060232
465 Ga0068855_100000609
466 Ga0068855_100010932
467 Ga0068855_100123940
468 Ga0068855_100214425
469 Ga0070664_100000612
470 Ga0070664_100046583
471 Ga0068857_100184805
472 Ga0068854_100009249
473 Ga0068854_100010398
474 Ga0068854_100039055
475 Ga0068854_100119947
476 Ga0068856_100001062
477 Ga0068852_100050942
478 Ga0068864_100046205
479 Ga0068861_100081576
480 Ga0068851_10001399
481 Ga0068851_10061318
482 Ga0068851_10069016
483 Ga0068858_100004031
484 Ga0075365_10003593
485 Ga0075365_10024460
486 Ga0075368_10017774
487 Ga0075363_100008026
488 Ga0075432_10010495
489 Ga0075362_10009640
490 Ga0075362_10012833
491 Ga0075362_10027987
492 Ga0075367_10003071
493 Ga0075369_10026505
494 Ga0075366_10000282
495 Ga0075366_10010046
496 Ga0075366_10013027
497 Ga0075370_10015918
498 Ga0075370_10026369
499 Ga0068871_100094660
500 Ga0075430_100010626
501 Ga0075430_100019371
502 Ga0075429_100000391
503 Ga0068865_100123403
504 Ga0105240_10001044
505 Ga0105240_10005295
506 Ga0105240_10006221
507 Ga0105240_10040595
508 Ga0105240_10043932
509 Ga0105245_10084626
510 Ga0105245_10108441
511 Ga0105243_10102091
512 Ga0105241_10146119
513 Ga0105241_10186182
514 Ga0105237_10001808
515 Ga0105237_10013705
516 Ga0105237_10015986
517 Ga0105238_10000102
518 Ga0105238_10000111
519 Ga0105238_10006969
520 Ga0105249_10007119
521 Ga0105239_10001763
522 Ga0105239_10008101
523 Ga0105239_10008675
524 Ga0105246_10049156
525 Ga0157371_10001222
526 Ga0157374_10231376
527 Ga0157372_10001268
528 Ga0157375_10248491
529 Ga0157376_10034886
530 Ga0182006_1001634
531 Ga0182006_1005633
532 Ga0183362_10002
533 Ga0163161_10000165
534 Ga0163161_10051349
535 Ga0209435_100002
536 Ga0209784_100066
537 Ga0209566_100125
538 Ga0209674_100344
539 Ga0209646_1000001
540 Ga0209026_1000040
541 Ga0209759_1000001
542 Ga0209129_1002422
543 Ga0209565_1000016
544 Ga0209673_1000995
545 Ga0209130_1000040
546 Ga0209130_1000190
547 Ga0209130_1002302
548 Ga0209675_1000401
549 Ga0209676_1000023
550 Ga0209025_1000174
551 Ga0209025_1000783
552 Ga0209025_1001126
553 Ga0209025_1016362
554 Ga0209025_1030704
555 Ga0209564_1001307
556 Ga0209564_1004644
557 Ga0209758_1000057
558 Ga0209050_1000022
559 Ga0209050_1010297
560 Ga0209256_1000001
561 Ga0207426_1000188
562 Ga0207426_1002218
563 Ga0209051_1000013
564 Ga0209257_1001435
565 Ga0207697_10004886
566 Ga0207656_10011573
567 Ga0207682_10035993
568 Ga0207680_10001300
569 Ga0207647_10000500
570 Ga0207645_10042805
571 Ga0207643_10008486
572 Ga0207707_10009426
573 Ga0207695_10000007
574 Ga0207695_10001698
575 Ga0207695_10009263
576 Ga0207695_10014078
577 Ga0207695_10014701
578 Ga0207695_10022351
579 Ga0207695_10037817
580 Ga0207695_10217555
581 Ga0207671_10003510
582 Ga0207671_10003884
583 Ga0207649_10006487
584 Ga0207649_10094680
585 Ga0207694_10000176
586 Ga0207694_10000199
587 Ga0207694_10003986
588 Ga0207694_10005080
589 Ga0207650_10008863
590 Ga0207650_10010601
591 Ga0207650_10048832
592 Ga0207650_10129691
593 Ga0207659_10010293
594 Ga0207644_10017245
595 Ga0207644_10018746
596 Ga0207706_10020155
597 Ga0207706_10229159
598 Ga0207709_10038900
599 Ga0207669_10071463
600 Ga0207704_10023016
601 Ga0207689_10065209
602 Ga0207679_10000490
603 Ga0207667_10000146
604 Ga0207667_10002981
605 Ga0207712_10000169
606 Ga0207668_10041697
607 Ga0207640_10001595
608 Ga0207640_10019836
609 Ga0207640_10030091
610 Ga0207658_10049576
611 Ga0207658_10197313
612 Ga0207703_10001066
613 Ga0207639_10001687
614 Ga0207639_10261766
615 Ga0207678_10000901
616 Ga0207678_10152761
617 Ga0207702_10001124
618 Ga0207648_10011610
619 Ga0207648_10011635
620 Ga0207648_10023140
621 Ga0207676_10016021
622 Ga0207674_10153419
623 Ga0207675_100161366
624 Ga0207683_10031899
625 Ga0207683_10218613
626 Ga0207698_10046129
627 Ga0207698_10158013
628 Ga0268266_10000006
629 Ga0307515_10000047
630 Ga0307515_10001293
631 Ga0307515_10001625
632 Ga0307515_10017866
633 Ga0307515_10021154
634 Ga0307515_10029411
635 Ga0307515_10079855
636 Ga0307512_10050142
637 Ga0265332_10005816
638 Ga0307513_10001531
639 Ga0307513_10019211
640 Ga0307408_100000114
641 Ga0307408_100000939
642 Ga0307408_100001459
643 Ga0307408_100031255
644 Ga0307408_100098210
645 Ga0307514_10000560
646 Ga0307514_10000850
647 Ga0307514_10006070
648 Ga0307514_10017249
649 Ga0265314_10099800
650 Ga0307516_10002036
651 Ga0307406_10000738
652 Ga0307412_10042310
653 Ga0307412_10058649
654 Ga0307416_100169581
655 Ga0307414_10073698
656 Ga0307411_10000452
657 Ga0307411_10008681
658 Ga0307411_10138370
659 Ga0373946_0060159
660 Ga0373931_0001826
661 Ga0373925_0009219
662 Ga0395905_0020378
663 Ga0395905_0030906
664 Ga0395905_0031317
665 Ga0395905_0052431
666 Ga0395905_0197298
667 Ga0395901_0063480
668 Ga0395901_0125458
669 Ga0436365_0289460
670 Ga0436365_1044326
671 Ga0436361_0019740
672 Ga0436361_0539947
673 Ga0439438_009647
674 Ga0439439_0003184
675 Ga0439439_0017445
676 Ga0439447_012380
677 Ga0439466_0013518
678 Ga0439466_0017979
679 Ga0439465_0003011
680 Ga0439431_0001148
681 Ga0439431_0021207
682 Ga0439433_0000838
683 Ga0439442_005221
684 Ga0439442_010517
685 Ga0439445_0000111
686 Ga0439432_000115
687 Ga0439432_002292
688 Ga0439449_0000592
689 Ga0439449_0003187
690 Ga0439449_0004988
691 Ga0439452_000809
692 Ga0439457_001132
693 Ga0450919_000104
694 Ga0450921_000604
695 Ga0450890_000470
696 Ga0450891_000012
697 Ga0450892_000656
698 Ga0450896_001335
699 Ga0450908_004232
700 Ga0450909_005098
701 Ga0439434_0000605
702 Ga0439434_0018311
703 Ga0439434_0020681
704 Ga0450918_000256
705 Ga0450893_0001708
706 Ga0466965_0046237
707 Ga0466965_0081906
708 Ga0466965_0089925
709 Ga0466966_0022355
710 Ga0466961_0000867
711 Ga0453684_0000789
712 Ga0466960_0008368
713 Ga0466959_0062817
714 Ga0451576_0050768
715 Ga0495627_009112
716 Ga0495591_000650
717 Ga0495605_0045490
718 Ga0495605_0074605
719 Ga0495610_0031668
720 Ga0495610_0037445
721 Ga0495620_0003900
722 Ga0495632_0020148
723 Ga0495637_0005176
724 Ga0495643_0013487
725 Ga0495654_0000009
726 Ga0495609_0049521
727 Ga0495597_0037610
728 Ga0495625_0000052
729 Ga0495625_0002800
730 Ga0495670_0104856
731 Ga0495660_0068628
732 Ga0495687_000242
733 Ga0496116_0000143
734 Ga0496117_0122560
735 Ga0496118_0010901
736 Ga0496118_0031447
737 Ga0496119_0000012
738 Ga0496119_0001268
739 Ga0496120_0000263
740 Ga0496125_0024965
741 Ga0501034_0000178
742 Ga0501034_0012784
743 Ga0501265_001574
744 Ga0501266_000060
745 Ga0501035_0154820
746 nmdc:mga0k408_23517_c1
747 nmdc:mga06z11_22550_c1
748 nmdc:mga07m45_17755_c1
749 nmdc:mga07m45_19295_c1
750 nmdc:mga07m45_2965_c1
751 nmdc:mga07m45_74589_c1
752 nmdc:mga09592_728_c1
753 nmdc:mga0qj67_5599_c1
754 Ga0500610_0001411
755 Ga0500607_000211
756 Ga0500618_014256
757 Ga0500622_0020197
758 2511251062
759 2521560974
760 2553006130
761 2587758712
762 2643746305
763 2644158810
764 2644223083
765 2644258014
766 2644747059
767 2776264265
768 2776265203
769 2776267574
770 2809125499
771 2819617358
772 2841764104
773 2844108441
774 2847086930
775 2851185430
776 2851250539
777 2857364729
778 2894777077
779 2904437823
780 2904442400
781 2904533672
782 2904586626
783 2904591560
784 2904602302
785 2919049822
786 2919083374
787 2923514827
788 2928133678
789 2945972660
790 639785327
791 8002869580
792 8057532092

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

93

174

0.93

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

96

165

0.91

PF01266

DAO

FAD dependent oxidoreductase

93

456

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hdh-assembly1.cif.gz_B pig heart short chain l-3-hydroxyacyl coa dehydrogenase revisited: sequence analysis and crystal structure determination 0.9173 30 60
2y0d-assembly1.cif.gz_D bcec mutation y10k 0.9136 28 58
6eod-assembly1.cif.gz_H structure of reductive aminase from aspergillus terreus in complex with nadph 0.9136 28 56
6fqz-assembly1.cif.gz_B plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate 0.9131 28 58
2y0d-assembly1.cif.gz_C bcec mutation y10k 0.9131 28 58
ID Description Score Start End Superfamily
af_Q46811_547_618_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 1.002 31 62 3.40.50.720
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9867 30 62 3.50.50.60
3fg2P02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9866 30 64 3.50.50.60
2ivdA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9855 30 62 3.50.50.60
5l1nB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9853 30 62 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A1N7NG36-F1-model_v4 Glycine/D-amino acid oxidase 0.9805 4 431 GO:0005737
AF-A0A529P2Y1-F1-model_v4 FAD-binding oxidoreductase 0.9755 50 432 GO:0005737
AF-A0A1N7NG36-F1-model_v4 Glycine/D-amino acid oxidase 0.9737 4 431 GO:0005737
AF-A0A0Q4W600-F1-model_v4 deleted 0.9705 4 432
AF-A0A3M5YXT7-F1-model_v4 deleted 0.9694 203 432

Map