F433760

General Info

Members Datasets Scaffolds Average Seq Length
397 199 794 391

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10000001|Ga0157370_10000001144
Length 463
Sequence MRKAGDAEHGVVRFGARLSGENHSIIKDDGAQTQKLLLNWRIWDRAPASIVKIREQGLWGMVQSLAKFSKRTDWNTEESALARAHRERVQTELPLADLTASNPTRCGFVYDGRLLAPLTDSRALEYDPQPLGLQRTREAVCGYYADHGVEVWPERVVMTTSTSEAYSFLFKLLCDPGDEIVVPQPGYPLFDFLGVLDDVRIKTAPLVYDHGWQIEPEGFRRALSAQARAIVLVHPNNPTGHFTKKWETEELANLCREQGIALIVDEVFLDYSFGGEKGESFASGLEGVDVFVVSGLSKIAGLPQMKAAWIVATGPHAPEVMSRLEVIADTFLSMNAPVQRAIPVWLEGRGEIQQQILNRVKANLAELDRQLANFDLVRRIEVEGGWYAVLRIPAVRPDEKTVLELLERGVWVHPGYFFGMAESGWLVVSLLGSVEEFKTGVQLIVDYFRTHQGTNNCLVGVKP

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.26
Rhizosphere 97.98
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10000001 3300013104 Bacteria 529517
2 rootH2_10003366 3300003320 Bacteria 16665
3 rootL2_10222745 3300003322 Bacteria 3014
4 Ga0065715_10002164 3300005293 Bacteria 7382
5 Ga0070658_10018718 3300005327 Bacteria 5548
6 Ga0070658_10027544 3300005327 Bacteria 4559
7 Ga0070658_10043821 3300005327 Unclassified 3615
8 Ga0070676_10017099 3300005328 Bacteria 4011
9 Ga0070683_100021465 3300005329 Bacteria 5765
10 Ga0070683_100140006 3300005329 Bacteria 2292
11 Ga0070690_100013903 3300005330 Bacteria 4773
12 Ga0070670_100005335 3300005331 Bacteria 10837
13 Ga0070670_100009560 3300005331 Bacteria 8275
14 Ga0070680_100014573 3300005336 Bacteria 6148
15 Ga0070680_100024417 3300005336 Bacteria 4829
16 Ga0070682_100182293 3300005337 Bacteria 1468
17 Ga0068868_100020981 3300005338 Bacteria 4918
18 Ga0070689_100000011 3300005340 Bacteria 218327
19 Ga0070689_100017085 3300005340 Bacteria 5323
20 Ga0070661_100010035 3300005344 Bacteria 6574
21 Ga0070661_100052757 3300005344 Unclassified 2976
22 Ga0070668_100031669 3300005347 Bacteria 4024
23 Ga0070669_100015831 3300005353 Bacteria 5378
24 Ga0070671_100005443 3300005355 Bacteria 10162
25 Ga0070671_100014395 3300005355 Bacteria 6391
26 Ga0070713_100020605 3300005436 Bacteria 5058
27 Ga0070713_100034981 3300005436 Bacteria 4041
28 Ga0070713_100087761 3300005436 Bacteria 2669
29 Ga0070713_100115417 3300005436 Bacteria 2347
30 Ga0070701_10023701 3300005438 Bacteria 2960
31 Ga0070694_100035708 3300005444 Bacteria 3288
32 Ga0070708_100093414 3300005445 Unclassified 2742
33 Ga0070706_100000048 3300005467 Bacteria 142843
34 Ga0070707_100028062 3300005468 Bacteria 5355
35 Ga0070707_100316183 3300005468 Unclassified 1517
36 Ga0070699_100089546 3300005518 Bacteria 2689
37 Ga0070679_100174390 3300005530 Bacteria 2123
38 Ga0070684_100003332 3300005535 Bacteria 12021
39 Ga0070697_100000161 3300005536 Bacteria 54619
40 Ga0070697_100043850 3300005536 Bacteria 3622
41 Ga0068853_100000074 3300005539 Bacteria 69174
42 Ga0068853_100022492 3300005539 Bacteria 5266
43 Ga0070672_100054425 3300005543 Bacteria 3132
44 Ga0070686_100022791 3300005544 Bacteria 3734
45 Ga0070665_100008390 3300005548 Bacteria 10449
46 Ga0070665_100022721 3300005548 Bacteria 6314
47 Ga0070665_100114271 3300005548 Bacteria 2702
48 Ga0070665_100128250 3300005548 Bacteria 2539
49 Ga0068855_100001215 3300005563 Bacteria 31959
50 Ga0068855_100003203 3300005563 Bacteria 20029
51 Ga0068855_100010470 3300005563 Bacteria 11190
52 Ga0068855_100023784 3300005563 Bacteria 7339
53 Ga0068857_100001254 3300005577 Bacteria 19874
54 Ga0068857_100024193 3300005577 Bacteria 5346
55 Ga0068856_100003456 3300005614 Bacteria 15972
56 Ga0068856_100004477 3300005614 Bacteria 13900
57 Ga0068856_100008315 3300005614 Bacteria 10112
58 Ga0068856_100129465 3300005614 Bacteria 2528
59 Ga0068856_100192969 3300005614 Unclassified 2050
60 Ga0068856_100222384 3300005614 Bacteria 1903
61 Ga0068852_100000073 3300005616 Bacteria 69820
62 Ga0068852_100000157 3300005616 Bacteria 45299
63 Ga0068859_100000040 3300005617 Bacteria 162782
64 Ga0068859_100024035 3300005617 Bacteria 6115
65 Ga0068859_100036071 3300005617 Bacteria 4963
66 Ga0068859_100205183 3300005617 Unclassified 2056
67 Ga0068864_100005109 3300005618 Bacteria 10753
68 Ga0068864_100036276 3300005618 Unclassified 4202
69 Ga0068866_10007111 3300005718 Bacteria 4678
70 Ga0068861_100036765 3300005719 Bacteria 3637
71 Ga0068851_10022659 3300005834 Bacteria 3063
72 Ga0068863_100004315 3300005841 Bacteria 14010
73 Ga0068863_100029377 3300005841 Bacteria 5247
74 Ga0068858_100056261 3300005842 Bacteria 3636
75 Ga0068858_100065610 3300005842 Bacteria 3359
76 Ga0068858_100134131 3300005842 Bacteria 2322
77 Ga0068860_100014746 3300005843 Bacteria 7642
78 Ga0068860_100030486 3300005843 Bacteria 5187
79 Ga0068862_100179504 3300005844 Bacteria 1899
80 Ga0081455_10033054 3300005937 Bacteria 4652
81 Ga0070717_10001564 3300006028 Bacteria 15848
82 Ga0097621_100001548 3300006237 Bacteria 15728
83 Ga0097621_100004777 3300006237 Bacteria 9480
84 Ga0068871_100001595 3300006358 Bacteria 15248
85 Ga0068871_100263328 3300006358 Bacteria 1504
86 Ga0075428_100055382 3300006844 Bacteria 4345
87 Ga0075428_100102226 3300006844 Bacteria 3125
88 Ga0075431_100114231 3300006847 Bacteria 2787
89 Ga0075431_100192394 3300006847 Bacteria 2090
90 Ga0075434_100281628 3300006871 Bacteria 1682
91 Ga0068865_100005433 3300006881 Bacteria 7729
92 Ga0075436_100076223 3300006914 Unclassified 2322
93 Ga0097620_100000040 3300006931 Bacteria 162782
94 Ga0097620_100024035 3300006931 Bacteria 6115
95 Ga0097620_100036072 3300006931 Bacteria 4963
96 Ga0097620_100205183 3300006931 Unclassified 2056
97 Ga0105240_10000110 3300009093 Bacteria 171018
98 Ga0105240_10001139 3300009093 Bacteria 46550
99 Ga0105240_10003498 3300009093 Bacteria 24350
100 Ga0105240_10011865 3300009093 Bacteria 12096
101 Ga0105240_10013709 3300009093 Bacteria 11108
102 Ga0105240_10017198 3300009093 Bacteria 9756
103 Ga0105240_10095064 3300009093 Bacteria 3634
104 Ga0105240_10095222 3300009093 Bacteria 3630
105 Ga0105245_10001870 3300009098 Bacteria 19126
106 Ga0105245_10003381 3300009098 Bacteria 14291
107 Ga0105245_10005417 3300009098 Bacteria 11215
108 Ga0105245_10022119 3300009098 Bacteria 5583
109 Ga0105245_10108133 3300009098 Bacteria 2582
110 Ga0105245_10335346 3300009098 Bacteria 1494
111 Ga0105247_10012244 3300009101 Bacteria 5154
112 Ga0105247_10037455 3300009101 Bacteria 2960
113 Ga0105247_10073745 3300009101 Bacteria 2139
114 Ga0114129_10367677 3300009147 Bacteria 1902
115 Ga0105241_10000063 3300009174 Bacteria 80541
116 Ga0105241_10000111 3300009174 Bacteria 58391
117 Ga0105241_10002420 3300009174 Bacteria 14007
118 Ga0105241_10003751 3300009174 Bacteria 11269
119 Ga0105241_10050445 3300009174 Bacteria 3171
120 Ga0105242_10042700 3300009176 Bacteria 3664
121 Ga0105248_10000004 3300009177 Bacteria 695244
122 Ga0105248_10018351 3300009177 Bacteria 7727
123 Ga0105248_10018480 3300009177 Bacteria 7705
124 Ga0105248_10053790 3300009177 Bacteria 4516
125 Ga0105248_10077627 3300009177 Bacteria 3734
126 Ga0105248_10340909 3300009177 Bacteria 1687
127 Ga0105237_10024254 3300009545 Bacteria 6207
128 Ga0105238_10000022 3300009551 Bacteria 204310
129 Ga0105238_10060628 3300009551 Bacteria 3787
130 Ga0105238_10119736 3300009551 Bacteria 2613
131 Ga0105238_10190043 3300009551 Bacteria 2030
132 Ga0105238_10206318 3300009551 Unclassified 1941
133 Ga0105238_10206844 3300009551 Bacteria 1939
134 Ga0105239_10004574 3300010375 Bacteria 16490
135 Ga0105239_10004929 3300010375 Bacteria 15757
136 Ga0105239_10071038 3300010375 Bacteria 3824
137 Ga0105239_10325747 3300010375 Bacteria 1733
138 Ga0105239_10333265 3300010375 Bacteria 1712
139 Ga0105246_10007035 3300011119 Bacteria 6885
140 Ga0157373_10194792 3300013100 Bacteria 1428
141 Ga0157370_10054728 3300013104 Bacteria 3803
142 Ga0157370_10087131 3300013104 Bacteria 2933
143 Ga0157369_10000017 3300013105 Bacteria 246520
144 Ga0157369_10001016 3300013105 Bacteria 35331
145 Ga0157369_10001500 3300013105 Bacteria 28635
146 Ga0157369_10002310 3300013105 Bacteria 22945
147 Ga0157369_10003062 3300013105 Bacteria 19966
148 Ga0157369_10006657 3300013105 Bacteria 13354
149 Ga0157369_10054883 3300013105 Unclassified 4302
150 Ga0157369_10086996 3300013105 Bacteria 3337
151 Ga0157369_10140214 3300013105 Bacteria 2558
152 Ga0157369_10344282 3300013105 Bacteria 1549
153 Ga0157374_10015655 3300013296 Bacteria 6658
154 Ga0157374_10224342 3300013296 Unclassified 1845
155 Ga0157374_10358663 3300013296 Bacteria 1449
156 Ga0157378_10000059 3300013297 Bacteria 95905
157 Ga0157378_10011342 3300013297 Bacteria 7799
158 Ga0157378_10095372 3300013297 Unclassified 2709
159 Ga0157378_10103040 3300013297 Bacteria 2607
160 Ga0157378_10231152 3300013297 Bacteria 1762
161 Ga0163162_10021422 3300013306 Bacteria 6366
162 Ga0163162_10097665 3300013306 Unclassified 3026
163 Ga0157372_10000019 3300013307 Bacteria 209591
164 Ga0157372_10001397 3300013307 Bacteria 26011
165 Ga0157372_10018587 3300013307 Bacteria 7477
166 Ga0157372_10025697 3300013307 Bacteria 6405
167 Ga0157372_10041919 3300013307 Bacteria 5061
168 Ga0157372_10059676 3300013307 Bacteria 4267
169 Ga0157372_10174147 3300013307 Bacteria 2490
170 Ga0157372_10199760 3300013307 Bacteria 2316
171 Ga0157372_10251112 3300013307 Unclassified 2053
172 Ga0163163_10001614 3300014325 Bacteria 18969
173 Ga0163163_10004504 3300014325 Bacteria 11893
174 Ga0157380_10006794 3300014326 Bacteria 8083
175 Ga0157380_10042960 3300014326 Unclassified 3536
176 Ga0157379_10015131 3300014968 Bacteria 6767
177 Ga0157379_10037896 3300014968 Bacteria 4300
178 Ga0157379_10210181 3300014968 Bacteria 1761
179 Ga0157376_10015352 3300014969 Bacteria 5784
180 Ga0157376_10171039 3300014969 Bacteria 1979
181 Ga0207656_10003195 3300025321 Bacteria 5603
182 Ga0207656_10045459 3300025321 Unclassified 1879
183 Ga0207642_10005440 3300025899 Bacteria 4158
184 Ga0207710_10001637 3300025900 Bacteria 10933
185 Ga0207710_10005232 3300025900 Bacteria 5607
186 Ga0207710_10018844 3300025900 Bacteria 2938
187 Ga0207680_10034144 3300025903 Bacteria 2908
188 Ga0207680_10121139 3300025903 Bacteria 1711
189 Ga0207647_10006895 3300025904 Bacteria 8234
190 Ga0207645_10019428 3300025907 Bacteria 4454
191 Ga0207705_10036218 3300025909 Bacteria 3531
192 Ga0207705_10053257 3300025909 Bacteria 2915
193 Ga0207705_10053811 3300025909 Unclassified 2901
194 Ga0207684_10000121 3300025910 Bacteria 143066
195 Ga0207654_10000148 3300025911 Bacteria 44438
196 Ga0207654_10000215 3300025911 Bacteria 35610
197 Ga0207654_10046778 3300025911 Unclassified 2469
198 Ga0207695_10000026 3300025913 Bacteria 624558
199 Ga0207695_10000096 3300025913 Bacteria 265048
200 Ga0207695_10000168 3300025913 Bacteria 193087
201 Ga0207695_10000398 3300025913 Bacteria 97114
202 Ga0207695_10013431 3300025913 Bacteria 9768
203 Ga0207695_10013487 3300025913 Bacteria 9744
204 Ga0207695_10063165 3300025913 Bacteria 3818
205 Ga0207671_10000022 3300025914 Bacteria 277803
206 Ga0207671_10005196 3300025914 Bacteria 12100
207 Ga0207657_10067767 3300025919 Bacteria 3034
208 Ga0207649_10007625 3300025920 Bacteria 5884
209 Ga0207649_10034882 3300025920 Unclassified 3018
210 Ga0207652_10221913 3300025921 Unclassified 1703
211 Ga0207646_10091965 3300025922 Bacteria 2715
212 Ga0207694_10000009 3300025924 Bacteria 460687
213 Ga0207694_10009788 3300025924 Bacteria 7235
214 Ga0207687_10008473 3300025927 Bacteria 6722
215 Ga0207687_10173709 3300025927 Unclassified 1664
216 Ga0207700_10014109 3300025928 Bacteria 5225
217 Ga0207700_10290565 3300025928 Unclassified 1409
218 Ga0207644_10089323 3300025931 Bacteria 2293
219 Ga0207686_10184562 3300025934 Unclassified 1482
220 Ga0207709_10025016 3300025935 Unclassified 3415
221 Ga0207670_10033896 3300025936 Bacteria 3294
222 Ga0207670_10052082 3300025936 Bacteria 2752
223 Ga0207691_10026803 3300025940 Bacteria 5408
224 Ga0207711_10000032 3300025941 Bacteria 199046
225 Ga0207711_10055226 3300025941 Bacteria 3410
226 Ga0207711_10126841 3300025941 Unclassified 2284
227 Ga0207689_10001414 3300025942 Bacteria 22916
228 Ga0207661_10001567 3300025944 Bacteria 15569
229 Ga0207661_10011133 3300025944 Bacteria 6504
230 Ga0207679_10109054 3300025945 Bacteria 2181
231 Ga0207667_10001656 3300025949 Bacteria 28065
232 Ga0207667_10003253 3300025949 Bacteria 20044
233 Ga0207667_10003259 3300025949 Bacteria 20031
234 Ga0207667_10012010 3300025949 Bacteria 10023
235 Ga0207640_10102717 3300025981 Unclassified 2008
236 Ga0207658_10027822 3300025986 Bacteria 3976
237 Ga0207677_10002816 3300026023 Bacteria 9175
238 Ga0207677_10049484 3300026023 Unclassified 2836
239 Ga0207677_10086238 3300026023 Unclassified 2269
240 Ga0207703_10063325 3300026035 Bacteria 3032
241 Ga0207639_10000065 3300026041 Bacteria 98610
242 Ga0207639_10100499 3300026041 Bacteria 2336
243 Ga0207639_10337351 3300026041 Bacteria 1343
244 Ga0207678_10033647 3300026067 Bacteria 4464
245 Ga0207678_10187072 3300026067 Unclassified 1769
246 Ga0207708_10001189 3300026075 Bacteria 19603
247 Ga0207702_10001772 3300026078 Bacteria 21238
248 Ga0207702_10008208 3300026078 Bacteria 8826
249 Ga0207702_10045602 3300026078 Unclassified 3687
250 Ga0207641_10015820 3300026088 Bacteria 6178
251 Ga0207641_10038300 3300026088 Bacteria 4008
252 Ga0207648_10004418 3300026089 Bacteria 14442
253 Ga0207676_10027514 3300026095 Unclassified 4236
254 Ga0207674_10002547 3300026116 Bacteria 22963
255 Ga0207675_100004586 3300026118 Bacteria 13319
256 Ga0207675_100017396 3300026118 Bacteria 6710
257 Ga0207675_100411401 3300026118 Bacteria 1334
258 Ga0207698_10000018 3300026142 Bacteria 176540
259 Ga0207698_10000028 3300026142 Bacteria 117250
260 Ga0207698_10013761 3300026142 Bacteria 5352
261 Ga0268266_10002423 3300028379 Bacteria 20083
262 Ga0268266_10002773 3300028379 Bacteria 18294
263 Ga0265318_10025754 3300028577 Bacteria 2319
264 Ga0265323_10019975 3300028653 Bacteria 2583
265 Ga0265338_10007111 3300028800 Bacteria 14017
266 Ga0265338_10018475 3300028800 Bacteria 7463
267 Ga0265338_10038081 3300028800 Bacteria 4563
268 Ga0265338_10047480 3300028800 Bacteria 3920
269 Ga0265338_10056098 3300028800 Bacteria 3498
270 Ga0265330_10001094 3300031235 Bacteria 16318
271 Ga0265330_10001536 3300031235 Bacteria 13287
272 Ga0265330_10010151 3300031235 Bacteria 4449
273 Ga0265328_10017076 3300031239 Unclassified 2815
274 Ga0265325_10002174 3300031241 Bacteria 13358
275 Ga0265325_10013045 3300031241 Bacteria 4738
276 Ga0265325_10047197 3300031241 Bacteria 2230
277 Ga0265340_10018031 3300031247 Bacteria 3648
278 Ga0265340_10037400 3300031247 Bacteria 2405
279 Ga0265339_10000073 3300031249 Bacteria 87912
280 Ga0265339_10005566 3300031249 Bacteria 8374
281 Ga0265339_10008886 3300031249 Bacteria 6360
282 Ga0265339_10020422 3300031249 Unclassified 3871
283 Ga0265339_10072712 3300031249 Bacteria 1829
284 Ga0265316_10002312 3300031344 Bacteria 19919
285 Ga0265316_10004661 3300031344 Bacteria 13579
286 Ga0265316_10009144 3300031344 Bacteria 9129
287 Ga0265316_10150054 3300031344 Bacteria 1746
288 Ga0265316_10232152 3300031344 Unclassified 1358
289 Ga0265314_10002940 3300031711 Bacteria 16878
290 Ga0265314_10011923 3300031711 Bacteria 7136
291 Ga0265314_10129401 3300031711 Bacteria 1577
292 Ga0265342_10007340 3300031712 Bacteria 8086
293 Ga0265342_10009299 3300031712 Bacteria 6940
294 Ga0265342_10025558 3300031712 Bacteria 3710
295 Ga0265342_10029942 3300031712 Bacteria 3377
296 Ga0265342_10041423 3300031712 Bacteria 2789
297 Ga0316576_10032401 3300031727 Bacteria 3714
298 Ga0373931_0076470 3300035691 Bacteria 1839
299 Ga0373937_0130139 3300036401 Unclassified 2350
300 Ga0373937_0151251 3300036401 Unclassified 2174
301 Ga0373937_0277515 3300036401 Bacteria 1582
302 Ga0373937_0468747 3300036401 Bacteria 1196
303 Ga0316582_0023789 3300036647 Bacteria 3655
304 Ga0316584_0227721 3300036712 Bacteria 1367
305 Ga0395905_0012868 3300037471 Bacteria 8042
306 Ga0436365_0993760 3300039437 Unclassified 1688
307 Ga0466961_0068921 3300044693 Bacteria 2246
308 Ga0466961_0177774 3300044693 Bacteria 1322
309 Ga0453684_0077097 3300044712 Bacteria 4181
310 Ga0451576_0046807 3300045051 Bacteria 4553
311 Ga0451576_0112986 3300045051 Bacteria 2827
312 Ga0466967_0010336 3300045976 Bacteria 6995
313 Ga0466967_0487152 3300045976 Bacteria 1209
314 Ga0495603_0052580 3300046455 Bacteria 2418
315 Ga0495603_0075197 3300046455 Bacteria 1983
316 Ga0495629_0000032 3300046459 Bacteria 123692
317 Ga0495641_0084490 3300046461 Bacteria 1421
318 Ga0495650_0001665 3300046471 Bacteria 20527
319 Ga0495580_0001130 3300046472 Bacteria 23534
320 Ga0495580_0010011 3300046472 Bacteria 7413
321 Ga0495580_0034706 3300046472 Bacteria 3630
322 Ga0495580_0061254 3300046472 Bacteria 2642
323 Ga0495582_0004653 3300046473 Bacteria 7716
324 Ga0495582_0006335 3300046473 Bacteria 6582
325 Ga0495582_0110923 3300046473 Bacteria 1541
326 Ga0495639_0003430 3300046475 Bacteria 6866
327 Ga0495594_0002500 3300046499 Bacteria 9575
328 Ga0495594_0008499 3300046499 Bacteria 5292
329 Ga0495606_0059772 3300046507 Bacteria 2444
330 Ga0495634_0013813 3300046642 Bacteria 5833
331 Ga0495625_0000440 3300046660 Bacteria 62404
332 Ga0495635_0002545 3300046663 Bacteria 12480
333 Ga0495647_0005765 3300046681 Unclassified 4072
334 Ga0495658_0000032 3300046683 Bacteria 70764
335 Ga0495658_0154168 3300046683 Bacteria 1413
336 Ga0495613_0003654 3300046689 Bacteria 11527
337 Ga0495613_0126354 3300046689 Bacteria 1834
338 Ga0495581_0000814 3300047315 Bacteria 16574
339 Ga0495676_0037832 3300047321 Bacteria 4013
340 Ga0495680_0001036 3300047322 Bacteria 30811
341 Ga0495687_035883 3300047443 Bacteria 2224
342 Ga0495684_0158433 3300047471 Bacteria 1690
343 Ga0495686_0008736 3300047472 Bacteria 7391
344 Ga0495593_0047225 3300047673 Unclassified 2291
345 Ga0495614_0000631 3300048089 Bacteria 14730
346 Ga0496100_0021209 3300048903 Bacteria 3910
347 Ga0496101_0043114 3300048904 Bacteria 3223
348 Ga0496104_0061298 3300048907 Bacteria 3566
349 Ga0496112_0055903 3300048915 Bacteria 3883
350 Ga0496114_0000773 3300048917 Bacteria 23911
351 Ga0501032_0001821 3300049569 Bacteria 16847
352 Ga0501033_0011659 3300049570 Bacteria 6722
353 Ga0501034_0001382 3300049571 Bacteria 32652
354 Ga0501034_0008364 3300049571 Bacteria 10941
355 Ga0501036_0000814 3300049572 Bacteria 23171
356 Ga0501037_0004060 3300049573 Bacteria 10616
357 Ga0501039_0004429 3300049575 Bacteria 10603
358 Ga0501040_0033083 3300049576 Bacteria 3501
359 Ga0501041_0069190 3300049577 Bacteria 2165
360 Ga0501042_0144179 3300049578 Bacteria 1717
361 Ga0501043_0002168 3300049579 Bacteria 16750
362 Ga0501043_0013883 3300049579 Bacteria 6302
363 Ga0501046_0000227 3300049580 Bacteria 58747
364 Ga0501046_0000783 3300049580 Bacteria 30741
365 Ga0501047_0000011 3300049581 Bacteria 409778
366 Ga0501048_0003030 3300049582 Bacteria 12827
367 Ga0501048_0004771 3300049582 Bacteria 10329
368 Ga0501048_0040947 3300049582 Bacteria 3319
369 Ga0501067_0001582 3300049583 Bacteria 12458
370 Ga0501068_0000562 3300049584 Bacteria 18872
371 Ga0501068_0004197 3300049584 Bacteria 7817
372 Ga0501069_0000891 3300049585 Bacteria 14251
373 Ga0501070_0007296 3300049586 Bacteria 9387
374 Ga0501070_0046437 3300049586 Bacteria 3611
375 Ga0501072_0000009 3300049588 Bacteria 206584
376 Ga0501072_0026652 3300049588 Bacteria 4506
377 Ga0501073_0000325 3300049589 Bacteria 31963
378 Ga0501073_0004511 3300049589 Bacteria 10463
379 Ga0501073_0018940 3300049589 Bacteria 4974
380 Ga0501074_0000466 3300049590 Bacteria 24434
381 Ga0501074_0000567 3300049590 Bacteria 22887
382 Ga0501075_0027833 3300049591 Bacteria 4168
383 Ga0501077_0032746 3300049593 Bacteria 3309
384 Ga0501079_0003259 3300049741 Bacteria 11901
385 Ga0501079_0005643 3300049741 Bacteria 9339
386 Ga0501080_0000021 3300049742 Bacteria 91749
387 Ga0501080_0004751 3300049742 Bacteria 12114
388 Ga0501083_0000144 3300049744 Bacteria 48521
389 Ga0501083_0004466 3300049744 Bacteria 9882
390 Ga0501044_0045456 3300049823 Bacteria 4548
391 Ga0501045_0047666 3300049824 Bacteria 3122
392 nmdc:mga08y16_9996_c1 3300050511 Bacteria 9955
393 Ga0495619_0001032 3300053085 Bacteria 18269
394 Ga0501084_0000004 3300054114 Bacteria 267128
395 Ga0501084_0000522 3300054114 Bacteria 29401
396 Ga0501082_0003396 3300060353 Bacteria 13899
397 Ga0501082_0009375 3300060353 Bacteria 8430
398 Ga0157370_10000001
399 rootH2_10003366
400 rootL2_10222745
401 Ga0065715_10002164
402 Ga0070658_10018718
403 Ga0070658_10027544
404 Ga0070658_10043821
405 Ga0070676_10017099
406 Ga0070683_100021465
407 Ga0070683_100140006
408 Ga0070690_100013903
409 Ga0070670_100005335
410 Ga0070670_100009560
411 Ga0070680_100014573
412 Ga0070680_100024417
413 Ga0070682_100182293
414 Ga0068868_100020981
415 Ga0070689_100000011
416 Ga0070689_100017085
417 Ga0070661_100010035
418 Ga0070661_100052757
419 Ga0070668_100031669
420 Ga0070669_100015831
421 Ga0070671_100005443
422 Ga0070671_100014395
423 Ga0070713_100020605
424 Ga0070713_100034981
425 Ga0070713_100087761
426 Ga0070713_100115417
427 Ga0070701_10023701
428 Ga0070694_100035708
429 Ga0070708_100093414
430 Ga0070706_100000048
431 Ga0070707_100028062
432 Ga0070707_100316183
433 Ga0070699_100089546
434 Ga0070679_100174390
435 Ga0070684_100003332
436 Ga0070697_100000161
437 Ga0070697_100043850
438 Ga0068853_100000074
439 Ga0068853_100022492
440 Ga0070672_100054425
441 Ga0070686_100022791
442 Ga0070665_100008390
443 Ga0070665_100022721
444 Ga0070665_100114271
445 Ga0070665_100128250
446 Ga0068855_100001215
447 Ga0068855_100003203
448 Ga0068855_100010470
449 Ga0068855_100023784
450 Ga0068857_100001254
451 Ga0068857_100024193
452 Ga0068856_100003456
453 Ga0068856_100004477
454 Ga0068856_100008315
455 Ga0068856_100129465
456 Ga0068856_100192969
457 Ga0068856_100222384
458 Ga0068852_100000073
459 Ga0068852_100000157
460 Ga0068859_100000040
461 Ga0068859_100024035
462 Ga0068859_100036071
463 Ga0068859_100205183
464 Ga0068864_100005109
465 Ga0068864_100036276
466 Ga0068866_10007111
467 Ga0068861_100036765
468 Ga0068851_10022659
469 Ga0068863_100004315
470 Ga0068863_100029377
471 Ga0068858_100056261
472 Ga0068858_100065610
473 Ga0068858_100134131
474 Ga0068860_100014746
475 Ga0068860_100030486
476 Ga0068862_100179504
477 Ga0081455_10033054
478 Ga0070717_10001564
479 Ga0097621_100001548
480 Ga0097621_100004777
481 Ga0068871_100001595
482 Ga0068871_100263328
483 Ga0075428_100055382
484 Ga0075428_100102226
485 Ga0075431_100114231
486 Ga0075431_100192394
487 Ga0075434_100281628
488 Ga0068865_100005433
489 Ga0075436_100076223
490 Ga0097620_100000040
491 Ga0097620_100024035
492 Ga0097620_100036072
493 Ga0097620_100205183
494 Ga0105240_10000110
495 Ga0105240_10001139
496 Ga0105240_10003498
497 Ga0105240_10011865
498 Ga0105240_10013709
499 Ga0105240_10017198
500 Ga0105240_10095064
501 Ga0105240_10095222
502 Ga0105245_10001870
503 Ga0105245_10003381
504 Ga0105245_10005417
505 Ga0105245_10022119
506 Ga0105245_10108133
507 Ga0105245_10335346
508 Ga0105247_10012244
509 Ga0105247_10037455
510 Ga0105247_10073745
511 Ga0114129_10367677
512 Ga0105241_10000063
513 Ga0105241_10000111
514 Ga0105241_10002420
515 Ga0105241_10003751
516 Ga0105241_10050445
517 Ga0105242_10042700
518 Ga0105248_10000004
519 Ga0105248_10018351
520 Ga0105248_10018480
521 Ga0105248_10053790
522 Ga0105248_10077627
523 Ga0105248_10340909
524 Ga0105237_10024254
525 Ga0105238_10000022
526 Ga0105238_10060628
527 Ga0105238_10119736
528 Ga0105238_10190043
529 Ga0105238_10206318
530 Ga0105238_10206844
531 Ga0105239_10004574
532 Ga0105239_10004929
533 Ga0105239_10071038
534 Ga0105239_10325747
535 Ga0105239_10333265
536 Ga0105246_10007035
537 Ga0157373_10194792
538 Ga0157370_10054728
539 Ga0157370_10087131
540 Ga0157369_10000017
541 Ga0157369_10001016
542 Ga0157369_10001500
543 Ga0157369_10002310
544 Ga0157369_10003062
545 Ga0157369_10006657
546 Ga0157369_10054883
547 Ga0157369_10086996
548 Ga0157369_10140214
549 Ga0157369_10344282
550 Ga0157374_10015655
551 Ga0157374_10224342
552 Ga0157374_10358663
553 Ga0157378_10000059
554 Ga0157378_10011342
555 Ga0157378_10095372
556 Ga0157378_10103040
557 Ga0157378_10231152
558 Ga0163162_10021422
559 Ga0163162_10097665
560 Ga0157372_10000019
561 Ga0157372_10001397
562 Ga0157372_10018587
563 Ga0157372_10025697
564 Ga0157372_10041919
565 Ga0157372_10059676
566 Ga0157372_10174147
567 Ga0157372_10199760
568 Ga0157372_10251112
569 Ga0163163_10001614
570 Ga0163163_10004504
571 Ga0157380_10006794
572 Ga0157380_10042960
573 Ga0157379_10015131
574 Ga0157379_10037896
575 Ga0157379_10210181
576 Ga0157376_10015352
577 Ga0157376_10171039
578 Ga0207656_10003195
579 Ga0207656_10045459
580 Ga0207642_10005440
581 Ga0207710_10001637
582 Ga0207710_10005232
583 Ga0207710_10018844
584 Ga0207680_10034144
585 Ga0207680_10121139
586 Ga0207647_10006895
587 Ga0207645_10019428
588 Ga0207705_10036218
589 Ga0207705_10053257
590 Ga0207705_10053811
591 Ga0207684_10000121
592 Ga0207654_10000148
593 Ga0207654_10000215
594 Ga0207654_10046778
595 Ga0207695_10000026
596 Ga0207695_10000096
597 Ga0207695_10000168
598 Ga0207695_10000398
599 Ga0207695_10013431
600 Ga0207695_10013487
601 Ga0207695_10063165
602 Ga0207671_10000022
603 Ga0207671_10005196
604 Ga0207657_10067767
605 Ga0207649_10007625
606 Ga0207649_10034882
607 Ga0207652_10221913
608 Ga0207646_10091965
609 Ga0207694_10000009
610 Ga0207694_10009788
611 Ga0207687_10008473
612 Ga0207687_10173709
613 Ga0207700_10014109
614 Ga0207700_10290565
615 Ga0207644_10089323
616 Ga0207686_10184562
617 Ga0207709_10025016
618 Ga0207670_10033896
619 Ga0207670_10052082
620 Ga0207691_10026803
621 Ga0207711_10000032
622 Ga0207711_10055226
623 Ga0207711_10126841
624 Ga0207689_10001414
625 Ga0207661_10001567
626 Ga0207661_10011133
627 Ga0207679_10109054
628 Ga0207667_10001656
629 Ga0207667_10003253
630 Ga0207667_10003259
631 Ga0207667_10012010
632 Ga0207640_10102717
633 Ga0207658_10027822
634 Ga0207677_10002816
635 Ga0207677_10049484
636 Ga0207677_10086238
637 Ga0207703_10063325
638 Ga0207639_10000065
639 Ga0207639_10100499
640 Ga0207639_10337351
641 Ga0207678_10033647
642 Ga0207678_10187072
643 Ga0207708_10001189
644 Ga0207702_10001772
645 Ga0207702_10008208
646 Ga0207702_10045602
647 Ga0207641_10015820
648 Ga0207641_10038300
649 Ga0207648_10004418
650 Ga0207676_10027514
651 Ga0207674_10002547
652 Ga0207675_100004586
653 Ga0207675_100017396
654 Ga0207675_100411401
655 Ga0207698_10000018
656 Ga0207698_10000028
657 Ga0207698_10013761
658 Ga0268266_10002423
659 Ga0268266_10002773
660 Ga0265318_10025754
661 Ga0265323_10019975
662 Ga0265338_10007111
663 Ga0265338_10018475
664 Ga0265338_10038081
665 Ga0265338_10047480
666 Ga0265338_10056098
667 Ga0265330_10001094
668 Ga0265330_10001536
669 Ga0265330_10010151
670 Ga0265328_10017076
671 Ga0265325_10002174
672 Ga0265325_10013045
673 Ga0265325_10047197
674 Ga0265340_10018031
675 Ga0265340_10037400
676 Ga0265339_10000073
677 Ga0265339_10005566
678 Ga0265339_10008886
679 Ga0265339_10020422
680 Ga0265339_10072712
681 Ga0265316_10002312
682 Ga0265316_10004661
683 Ga0265316_10009144
684 Ga0265316_10150054
685 Ga0265316_10232152
686 Ga0265314_10002940
687 Ga0265314_10011923
688 Ga0265314_10129401
689 Ga0265342_10007340
690 Ga0265342_10009299
691 Ga0265342_10025558
692 Ga0265342_10029942
693 Ga0265342_10041423
694 Ga0316576_10032401
695 Ga0373931_0076470
696 Ga0373937_0130139
697 Ga0373937_0151251
698 Ga0373937_0277515
699 Ga0373937_0468747
700 Ga0316582_0023789
701 Ga0316584_0227721
702 Ga0395905_0012868
703 Ga0436365_0993760
704 Ga0466961_0068921
705 Ga0466961_0177774
706 Ga0453684_0077097
707 Ga0451576_0046807
708 Ga0451576_0112986
709 Ga0466967_0010336
710 Ga0466967_0487152
711 Ga0495603_0052580
712 Ga0495603_0075197
713 Ga0495629_0000032
714 Ga0495641_0084490
715 Ga0495650_0001665
716 Ga0495580_0001130
717 Ga0495580_0010011
718 Ga0495580_0034706
719 Ga0495580_0061254
720 Ga0495582_0004653
721 Ga0495582_0006335
722 Ga0495582_0110923
723 Ga0495639_0003430
724 Ga0495594_0002500
725 Ga0495594_0008499
726 Ga0495606_0059772
727 Ga0495634_0013813
728 Ga0495625_0000440
729 Ga0495635_0002545
730 Ga0495647_0005765
731 Ga0495658_0000032
732 Ga0495658_0154168
733 Ga0495613_0003654
734 Ga0495613_0126354
735 Ga0495581_0000814
736 Ga0495676_0037832
737 Ga0495680_0001036
738 Ga0495687_035883
739 Ga0495684_0158433
740 Ga0495686_0008736
741 Ga0495593_0047225
742 Ga0495614_0000631
743 Ga0496100_0021209
744 Ga0496101_0043114
745 Ga0496104_0061298
746 Ga0496112_0055903
747 Ga0496114_0000773
748 Ga0501032_0001821
749 Ga0501033_0011659
750 Ga0501034_0001382
751 Ga0501034_0008364
752 Ga0501036_0000814
753 Ga0501037_0004060
754 Ga0501039_0004429
755 Ga0501040_0033083
756 Ga0501041_0069190
757 Ga0501042_0144179
758 Ga0501043_0002168
759 Ga0501043_0013883
760 Ga0501046_0000227
761 Ga0501046_0000783
762 Ga0501047_0000011
763 Ga0501048_0003030
764 Ga0501048_0004771
765 Ga0501048_0040947
766 Ga0501067_0001582
767 Ga0501068_0000562
768 Ga0501068_0004197
769 Ga0501069_0000891
770 Ga0501070_0007296
771 Ga0501070_0046437
772 Ga0501072_0000009
773 Ga0501072_0026652
774 Ga0501073_0000325
775 Ga0501073_0004511
776 Ga0501073_0018940
777 Ga0501074_0000466
778 Ga0501074_0000567
779 Ga0501075_0027833
780 Ga0501077_0032746
781 Ga0501079_0003259
782 Ga0501079_0005643
783 Ga0501080_0000021
784 Ga0501080_0004751
785 Ga0501083_0000144
786 Ga0501083_0004466
787 Ga0501044_0045456
788 Ga0501045_0047666
789 nmdc:mga08y16_9996_c1
790 Ga0495619_0001032
791 Ga0501084_0000004
792 Ga0501084_0000522
793 Ga0501082_0003396
794 Ga0501082_0009375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

117

444

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dyd-assembly1.cif.gz_B human tyrosine aminotransferase 0.8897 30 382
3pdx-assembly1.cif.gz_A-2 crystal structural of mouse tyrosine aminotransferase 0.8818 30 385
1xi9-assembly1.cif.gz_C alanine aminotransferase from pyrococcus furiosus pfu-1397077-001 0.8669 3 386
4cvq-assembly1.cif.gz_B crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution 0.8648 1 384
2dou-assembly1.cif.gz_B probable n-succinyldiaminopimelate aminotransferase (ttha0342) from thermus thermophilus hb8 0.8631 16 381
ID Description Score Start End Superfamily
3nraA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8969 293 386 3.90.1150.10
3dzzB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8953 289 386 3.90.1150.10
4ix8B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8946 47 282 3.40.640.10
3l8aA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8945 289 381 3.90.1150.10
af_P04694_91_334_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8909 47 282 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A0K1QGR7-F1-model_v4 Putative aminotransferase 0.9825 1 386 GO:0008483
GO:0009058
GO:0030170
AF-A0A0K1QGR7-F1-model_v4 Putative aminotransferase 0.98 1 386 GO:0008483
GO:0009058
GO:0030170
AF-A0A0F2QZS4-F1-model_v4 alanine transaminase (EC 2.6.1.2) 0.975 3 383 GO:0008483
GO:0009058
GO:0030170
AF-A0A7V3VVK8-F1-model_v4 Pyridoxal phosphate-dependent aminotransferase 0.9677 3 382 GO:0008483
GO:0009058
GO:0030170
AF-A0A534QBH0-F1-model_v4 Pyridoxal phosphate-dependent aminotransferase 0.9657 3 383 GO:0008483
GO:0009058
GO:0030170

Map