F433761

General Info

Members Datasets Scaffolds Average Seq Length
397 238 794 150

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10125411|Ga0157370_101254112
Length 152
Sequence VPTVSNRVAVLHGVNFDVLERRDASVYGGISLSQLEQKISDWAHGLGLEPIFFQTNAEGEFCEYLHRSGDGLADAVIVNAGAWTHYSRAIADALELTRLPAVEVHLSDVEARDDWRRLSVFDGLVLAKVSGKGPDGYREALELLGRELGASA

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
106 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
126 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
132 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
236 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
237 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.78
Nodule 0
Rhizoplane 9.57
Rhizosphere 83.63
Stem 0
Stem Tuber 0
Unclassified 4.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10125411 3300013104 Bacteria 2397
2 JGI24746J21847_1000152 3300001977 Bacteria 8756
3 JGI24034J26672_10001207 3300002239 Bacteria 3385
4 JGI24742J22300_10014629 3300002244 Bacteria 1318
5 Ga0070658_10077842 3300005327 Bacteria 2721
6 Ga0070683_100002036 3300005329 Bacteria 15916
7 Ga0070683_100148547 3300005329 Bacteria 2222
8 Ga0070690_100033829 3300005330 Bacteria 3201
9 Ga0070680_100226119 3300005336 Bacteria 1580
10 Ga0068868_100000840 3300005338 Bacteria 20791
11 Ga0070660_100385011 3300005339 Bacteria 1158
12 Ga0070689_100066286 3300005340 Bacteria 2813
13 Ga0070661_100000145 3300005344 Bacteria 58346
14 Ga0070661_100939896 3300005344 Bacteria 715
15 Ga0070692_10183579 3300005345 Bacteria 1214
16 Ga0070688_100001424 3300005365 Bacteria 11907
17 Ga0070659_100248994 3300005366 Bacteria 1472
18 Ga0070667_100576733 3300005367 Bacteria 1035
19 Ga0070714_100059972 3300005435 Bacteria 3264
20 Ga0070714_100348218 3300005435 Bacteria 1391
21 Ga0070714_100548934 3300005435 Bacteria 1106
22 Ga0070713_100001073 3300005436 Bacteria 17481
23 Ga0070713_100130831 3300005436 Bacteria 2213
24 Ga0070700_100068761 3300005441 Bacteria 2253
25 Ga0070663_100039177 3300005455 Bacteria 3310
26 Ga0070663_100716376 3300005455 Bacteria 852
27 Ga0070662_100222014 3300005457 Bacteria 1508
28 Ga0070681_10079406 3300005458 Bacteria 3238
29 Ga0070681_10216984 3300005458 Bacteria 1829
30 Ga0070685_10000019 3300005466 Bacteria 105881
31 Ga0070679_100000129 3300005530 Bacteria 60559
32 Ga0070679_100004961 3300005530 Bacteria 12284
33 Ga0070684_100054054 3300005535 Bacteria 3498
34 Ga0070684_100174355 3300005535 Bacteria 1954
35 Ga0068853_100029866 3300005539 Bacteria 4599
36 Ga0068853_100130053 3300005539 Bacteria 2253
37 Ga0070672_100000001 3300005543 Bacteria 204624
38 Ga0070665_100000141 3300005548 Bacteria 135473
39 Ga0070665_100010197 3300005548 Bacteria 9504
40 Ga0070665_100178613 3300005548 Bacteria 2124
41 Ga0068855_100120638 3300005563 Bacteria 3001
42 Ga0070664_100107349 3300005564 Bacteria 2434
43 Ga0068854_100000113 3300005578 Bacteria 55436
44 Ga0068856_100001668 3300005614 Bacteria 23239
45 Ga0068856_100004779 3300005614 Bacteria 13422
46 Ga0068856_100269673 3300005614 Bacteria 1718
47 Ga0068856_100508562 3300005614 Bacteria 1226
48 Ga0068852_100017340 3300005616 Bacteria 5647
49 Ga0068866_10000003 3300005718 Bacteria 281675
50 Ga0068866_10020668 3300005718 Bacteria 3020
51 Ga0068866_10541882 3300005718 Bacteria 777
52 Ga0068861_101057586 3300005719 Bacteria 778
53 Ga0068863_100000129 3300005841 Bacteria 79654
54 Ga0068863_100036016 3300005841 Bacteria 4713
55 Ga0068863_100038453 3300005841 Bacteria 4552
56 Ga0068858_100000118 3300005842 Bacteria 83359
57 Ga0068860_100021542 3300005843 Bacteria 6241
58 Ga0068860_100053761 3300005843 Bacteria 3829
59 Ga0081455_10006044 3300005937 Bacteria 13101
60 Ga0075368_10134083 3300006042 Unclassified 1030
61 Ga0075363_100283134 3300006048 Bacteria 959
62 Ga0075364_10074191 3300006051 Unclassified 2243
63 Ga0075364_10199689 3300006051 Unclassified 1355
64 Ga0075364_10566379 3300006051 Bacteria 776
65 Ga0070715_10000029 3300006163 Bacteria 88994
66 Ga0070715_10265830 3300006163 Bacteria 903
67 Ga0070716_100063188 3300006173 Bacteria 2149
68 Ga0070712_100000978 3300006175 Bacteria 17209
69 Ga0075367_10634470 3300006178 Bacteria 679
70 Ga0068865_101379048 3300006881 Bacteria 629
71 Ga0075435_100416223 3300007076 Bacteria 1157
72 Ga0105251_10467789 3300009011 Bacteria 586
73 Ga0105245_10001571 3300009098 Bacteria 20730
74 Ga0105245_10006909 3300009098 Bacteria 9952
75 Ga0105242_10000059 3300009176 Bacteria 75563
76 Ga0105238_10000048 3300009551 Bacteria 146322
77 Ga0105249_10000076 3300009553 Bacteria 144450
78 Ga0105249_11300925 3300009553 Bacteria 798
79 Ga0105239_10140381 3300010375 Bacteria 2692
80 Ga0105239_10490218 3300010375 Bacteria 1397
81 Ga0105246_10072084 3300011119 Bacteria 2434
82 Ga0157371_10305628 3300013102 Bacteria 1152
83 Ga0157370_10332459 3300013104 Bacteria 1401
84 Ga0157370_11974326 3300013104 Bacteria 523
85 Ga0157374_10002573 3300013296 Bacteria 15291
86 Ga0157378_10010035 3300013297 Bacteria 8254
87 Ga0157378_11781736 3300013297 Unclassified 664
88 Ga0157372_10000060 3300013307 Bacteria 122372
89 Ga0157375_10000171 3300013308 Bacteria 61181
90 Ga0157375_10162588 3300013308 Bacteria 2375
91 Ga0157375_10455572 3300013308 Bacteria 1445
92 Ga0163163_10592730 3300014325 Bacteria 1171
93 Ga0163163_12361352 3300014325 Bacteria 590
94 Ga0157380_10000016 3300014326 Bacteria 126029
95 Ga0157380_10326706 3300014326 Bacteria 1425
96 Ga0157379_10157790 3300014968 Bacteria 2047
97 Ga0157379_10162849 3300014968 Bacteria 2013
98 Ga0157376_10079878 3300014969 Bacteria 2805
99 Ga0157376_11050026 3300014969 Unclassified 839
100 Ga0163161_10000022 3300017792 Bacteria 207890
101 Ga0207656_10382630 3300025321 Bacteria 706
102 Ga0207642_10000002 3300025899 Bacteria 658166
103 Ga0207642_10012601 3300025899 Bacteria 3058
104 Ga0207685_10000031 3300025905 Bacteria 77451
105 Ga0207654_10202536 3300025911 Bacteria 1307
106 Ga0207707_10106771 3300025912 Bacteria 2447
107 Ga0207695_10964223 3300025913 Bacteria 732
108 Ga0207693_10003006 3300025915 Bacteria 14589
109 Ga0207663_10190511 3300025916 Bacteria 1472
110 Ga0207660_10324293 3300025917 Unclassified 1230
111 Ga0207660_10793462 3300025917 Bacteria 773
112 Ga0207649_10000003 3300025920 Bacteria 388908
113 Ga0207652_10000211 3300025921 Bacteria 61784
114 Ga0207652_10025224 3300025921 Bacteria 4940
115 Ga0207694_10000056 3300025924 Bacteria 146908
116 Ga0207687_10002306 3300025927 Bacteria 12992
117 Ga0207687_10009791 3300025927 Bacteria 6272
118 Ga0207700_10000033 3300025928 Bacteria 123113
119 Ga0207700_10117097 3300025928 Bacteria 2154
120 Ga0207664_10044677 3300025929 Bacteria 3471
121 Ga0207664_10303261 3300025929 Bacteria 1406
122 Ga0207690_10044152 3300025932 Bacteria 2937
123 Ga0207690_10099640 3300025932 Bacteria 2072
124 Ga0207686_10000116 3300025934 Bacteria 64638
125 Ga0207670_10044405 3300025936 Bacteria 2940
126 Ga0207669_10000001 3300025937 Bacteria 377747
127 Ga0207665_10609439 3300025939 Archaea 853
128 Ga0207691_10000017 3300025940 Bacteria 134441
129 Ga0207661_10004623 3300025944 Bacteria 9646
130 Ga0207661_10051027 3300025944 Bacteria 3299
131 Ga0207661_10057791 3300025944 Bacteria 3121
132 Ga0207661_11625543 3300025944 Bacteria 591
133 Ga0207679_10190104 3300025945 Bacteria 1706
134 Ga0207667_10297845 3300025949 Bacteria 1648
135 Ga0207651_10224977 3300025960 Bacteria 1519
136 Ga0207712_10000052 3300025961 Bacteria 152874
137 Ga0207712_10611004 3300025961 Bacteria 944
138 Ga0207640_10000401 3300025981 Bacteria 27504
139 Ga0207658_10415641 3300025986 Bacteria 1185
140 Ga0207677_10000379 3300026023 Bacteria 30693
141 Ga0207703_10000061 3300026035 Bacteria 132671
142 Ga0207703_10101791 3300026035 Bacteria 2436
143 Ga0207639_10021823 3300026041 Bacteria 4603
144 Ga0207639_10060985 3300026041 Bacteria 2911
145 Ga0207678_10000556 3300026067 Bacteria 34074
146 Ga0207708_10051504 3300026075 Bacteria 3134
147 Ga0207708_10084523 3300026075 Bacteria 2440
148 Ga0207702_10000076 3300026078 Bacteria 112300
149 Ga0207702_10002397 3300026078 Bacteria 17842
150 Ga0207702_10262027 3300026078 Bacteria 1628
151 Ga0207702_10348174 3300026078 Bacteria 1417
152 Ga0207702_10884475 3300026078 Bacteria 885
153 Ga0207702_11156520 3300026078 Unclassified 768
154 Ga0207641_10000016 3300026088 Bacteria 307363
155 Ga0207641_10022213 3300026088 Bacteria 5222
156 Ga0207648_10000499 3300026089 Bacteria 43734
157 Ga0207675_101109317 3300026118 Bacteria 811
158 Ga0268266_10000056 3300028379 Bacteria 289176
159 Ga0268266_10000376 3300028379 Bacteria 68245
160 Ga0268266_10156594 3300028379 Bacteria 2058
161 Ga0268264_10015533 3300028381 Bacteria 6242
162 Ga0268264_10217194 3300028381 Bacteria 1758
163 Ga0265337_1000007 3300028556 Bacteria 98412
164 Ga0265326_10000019 3300028558 Bacteria 137370
165 Ga0265319_1000014 3300028563 Bacteria 177623
166 Ga0265319_1038989 3300028563 Bacteria 1613
167 Ga0265319_1124158 3300028563 Bacteria 804
168 Ga0265334_10143193 3300028573 Unclassified 846
169 Ga0265322_10000011 3300028654 Bacteria 167597
170 Ga0265336_10039515 3300028666 Bacteria 1446
171 Ga0265338_10000244 3300028800 Bacteria 100528
172 Ga0265338_10762894 3300028800 Bacteria 664
173 Ga0265324_10000997 3300029957 Bacteria 17408
174 Ga0265332_10024998 3300031238 Bacteria 2625
175 Ga0265328_10007834 3300031239 Bacteria 4438
176 Ga0265320_10000011 3300031240 Bacteria 249534
177 Ga0265320_10442584 3300031240 Bacteria 574
178 Ga0265325_10020611 3300031241 Bacteria 3632
179 Ga0265329_10005385 3300031242 Bacteria 5176
180 Ga0265339_10018826 3300031249 Bacteria 4064
181 Ga0265331_10001052 3300031250 Bacteria 21500
182 Ga0265331_10045803 3300031250 Bacteria 2110
183 Ga0265327_10000015 3300031251 Bacteria 496677
184 Ga0265316_10104715 3300031344 Bacteria 2147
185 Ga0265313_10061948 3300031595 Bacteria 1749
186 Ga0265314_10000119 3300031711 Bacteria 122334
187 Ga0265342_10140697 3300031712 Bacteria 1346
188 Ga0316576_10025114 3300031727 Bacteria 4168
189 Ga0316583_10095154 3300032133 Bacteria 1039
190 Ga0316574_0029203 3300035398 Bacteria 3330
191 Ga0373937_0232475 3300036401 Bacteria 1736
192 Ga0316582_0357511 3300036647 Bacteria 1005
193 Ga0316584_0002796 3300036712 Bacteria 11176
194 Ga0451833_1465791 3300041491 Bacteria 621
195 Ga0451847_0592842 3300041503 Bacteria 701
196 Ga0451853_1794266 3300041512 Bacteria 2614
197 Ga0451853_2812611 3300041512 Bacteria 2113
198 Ga0451853_2814964 3300041512 Bacteria 608
199 Ga0466963_0000004 3300044694 Bacteria 102526
200 Ga0466963_0009319 3300044694 Bacteria 5911
201 Ga0466957_0066197 3300044842 Bacteria 2227
202 Ga0466960_0055693 3300044901 Bacteria 1923
203 Ga0466958_0035543 3300045836 Bacteria 2977
204 Ga0466967_0000001 3300045976 Bacteria 229823
205 Ga0466967_0070386 3300045976 Bacteria 3130
206 Ga0495592_0000078 3300046454 Bacteria 85591
207 Ga0495592_0237612 3300046454 Bacteria 1210
208 Ga0495592_0655332 3300046454 Bacteria 635
209 Ga0495592_0675344 3300046454 Bacteria 623
210 Ga0495603_0000128 3300046455 Bacteria 37013
211 Ga0495603_0000584 3300046455 Bacteria 20514
212 Ga0495603_0001813 3300046455 Bacteria 12609
213 Ga0495629_0000106 3300046459 Bacteria 74178
214 Ga0495629_0470665 3300046459 Bacteria 849
215 Ga0495629_0584586 3300046459 Bacteria 748
216 Ga0495638_0039673 3300046460 Bacteria 2988
217 Ga0495641_0000005 3300046461 Bacteria 206626
218 Ga0495641_0015934 3300046461 Bacteria 3982
219 Ga0495641_0033658 3300046461 Bacteria 2430
220 Ga0495641_0048779 3300046461 Bacteria 1940
221 Ga0495651_0070978 3300046462 Bacteria 2649
222 Ga0495651_1016604 3300046462 Bacteria 502
223 Ga0495653_0034161 3300046463 Bacteria 4025
224 Ga0495662_0000001 3300046476 Bacteria 179185
225 Ga0495662_0004081 3300046476 Bacteria 7352
226 Ga0495664_0102961 3300046477 Bacteria 1721
227 Ga0495608_0000007 3300046511 Bacteria 313495
228 Ga0495608_0000240 3300046511 Bacteria 39700
229 Ga0495608_0044324 3300046511 Bacteria 2969
230 Ga0495618_0000014 3300046514 Bacteria 163136
231 Ga0495618_0544267 3300046514 Bacteria 696
232 Ga0495620_0000092 3300046515 Bacteria 72050
233 Ga0495628_0000808 3300046516 Bacteria 28939
234 Ga0495628_0004771 3300046516 Bacteria 11947
235 Ga0495628_0029657 3300046516 Bacteria 4434
236 Ga0495628_0149634 3300046516 Bacteria 1779
237 Ga0495630_0000014 3300046517 Bacteria 217229
238 Ga0495630_0040486 3300046517 Bacteria 3483
239 Ga0495630_0114790 3300046517 Bacteria 2041
240 Ga0495652_0004565 3300046529 Bacteria 13204
241 Ga0495652_0708452 3300046529 Bacteria 677
242 Ga0495640_0017459 3300046533 Bacteria 5350
243 Ga0495586_0058110 3300046535 Bacteria 2100
244 Ga0495587_0015176 3300046536 Bacteria 4814
245 Ga0495587_0178955 3300046536 Unclassified 1203
246 Ga0495587_0189571 3300046536 Bacteria 1164
247 Ga0495598_0001011 3300046537 Bacteria 5395
248 Ga0495645_0004192 3300046543 Bacteria 9857
249 Ga0495645_0121723 3300046543 Bacteria 1836
250 Ga0495667_0000045 3300046559 Bacteria 118562
251 Ga0495656_0000931 3300046615 Bacteria 9472
252 Ga0495634_0000045 3300046642 Bacteria 99087
253 Ga0495634_0002241 3300046642 Bacteria 16198
254 Ga0495634_0057456 3300046642 Bacteria 2597
255 Ga0495625_0000032 3300046660 Bacteria 233135
256 Ga0495635_0906433 3300046663 Bacteria 564
257 Ga0495657_0000001 3300046675 Bacteria 445641
258 Ga0495599_0004033 3300046678 Bacteria 8644
259 Ga0495599_0243704 3300046678 Bacteria 1095
260 Ga0495599_0370519 3300046678 Bacteria 856
261 Ga0495623_0211398 3300046679 Bacteria 1110
262 Ga0495647_0000021 3300046681 Bacteria 72778
263 Ga0495647_0001696 3300046681 Bacteria 6824
264 Ga0495647_0056320 3300046681 Bacteria 1541
265 Ga0495658_0000370 3300046683 Bacteria 25240
266 Ga0495658_0184301 3300046683 Bacteria 1296
267 Ga0495669_0000051 3300046684 Bacteria 80128
268 Ga0495669_0062282 3300046684 Bacteria 1690
269 Ga0495669_0202347 3300046684 Bacteria 949
270 Ga0495613_0000032 3300046689 Bacteria 139806
271 Ga0495624_0000085 3300046690 Bacteria 61809
272 Ga0495624_0000405 3300046690 Bacteria 34290
273 Ga0495624_0200933 3300046690 Unclassified 1211
274 Ga0495670_0117669 3300046691 Unclassified 1379
275 Ga0495649_0002413 3300046694 Bacteria 13181
276 Ga0495600_0010694 3300046809 Bacteria 5703
277 Ga0495600_0016321 3300046809 Bacteria 4711
278 Ga0495604_0000067 3300047317 Bacteria 90345
279 Ga0495604_0000577 3300047317 Bacteria 32087
280 Ga0495604_0026140 3300047317 Bacteria 4647
281 Ga0495674_0000010 3300047319 Bacteria 285794
282 Ga0495674_0963486 3300047319 Bacteria 656
283 Ga0495674_1025096 3300047319 Bacteria 631
284 Ga0495676_0000186 3300047321 Bacteria 49054
285 Ga0495676_0000956 3300047321 Bacteria 24242
286 Ga0495676_0175016 3300047321 Bacteria 1507
287 Ga0495676_0251995 3300047321 Unclassified 1204
288 Ga0495676_0276361 3300047321 Bacteria 1138
289 Ga0495680_0000267 3300047322 Bacteria 57953
290 Ga0495680_0000602 3300047322 Bacteria 40540
291 Ga0495675_0000017 3300047444 Bacteria 123394
292 Ga0495675_0105733 3300047444 Bacteria 1759
293 Ga0495686_0067860 3300047472 Bacteria 2201
294 Ga0495686_0106710 3300047472 Bacteria 1684
295 Ga0495686_0239799 3300047472 Bacteria 1023
296 Ga0495593_0020032 3300047673 Bacteria 3746
297 Ga0495602_0000007 3300048088 Bacteria 273212
298 Ga0495602_0000775 3300048088 Bacteria 30490
299 Ga0495602_0052816 3300048088 Bacteria 3606
300 Ga0495602_0572104 3300048088 Bacteria 780
301 Ga0495614_0079883 3300048089 Bacteria 1416
302 Ga0496100_0000061 3300048903 Bacteria 63790
303 Ga0496101_0000141 3300048904 Bacteria 63790
304 Ga0496102_0015525 3300048905 Bacteria 6634
305 Ga0496102_0228769 3300048905 Bacteria 1753
306 Ga0496103_0000057 3300048906 Bacteria 142223
307 Ga0496104_0000015 3300048907 Bacteria 374530
308 Ga0496104_0000025 3300048907 Bacteria 228519
309 Ga0496104_0000133 3300048907 Bacteria 69099
310 Ga0496104_0209609 3300048907 Bacteria 1860
311 Ga0496105_0000004 3300048908 Bacteria 475798
312 Ga0496105_0000023 3300048908 Bacteria 156126
313 Ga0496105_0000187 3300048908 Bacteria 41418
314 Ga0496106_0000094 3300048909 Bacteria 67511
315 Ga0496106_0369179 3300048909 Bacteria 1153
316 Ga0496107_0000045 3300048910 Bacteria 67420
317 Ga0496108_0000164 3300048911 Bacteria 62669
318 Ga0496108_0000582 3300048911 Bacteria 28516
319 Ga0496109_0000180 3300048912 Bacteria 62669
320 Ga0496109_0000446 3300048912 Bacteria 35477
321 Ga0496109_0617557 3300048912 Bacteria 1020
322 Ga0496109_0686783 3300048912 Bacteria 961
323 Ga0496109_1932949 3300048912 Bacteria 522
324 Ga0496110_0000114 3300048913 Bacteria 44437
325 Ga0496110_0045145 3300048913 Bacteria 3850
326 Ga0496110_0057447 3300048913 Bacteria 3425
327 Ga0496110_1143974 3300048913 Bacteria 687
328 Ga0496111_0000008 3300048914 Bacteria 96148
329 Ga0496111_0011403 3300048914 Bacteria 5985
330 Ga0496111_0087140 3300048914 Bacteria 2285
331 Ga0496111_0934753 3300048914 Bacteria 623
332 Ga0496112_0000006 3300048915 Bacteria 365227
333 Ga0496112_0143558 3300048915 Bacteria 2356
334 Ga0496112_0439406 3300048915 Bacteria 1243
335 Ga0496113_0030813 3300048916 Bacteria 3886
336 Ga0496113_0440832 3300048916 Bacteria 1046
337 Ga0496114_0008493 3300048917 Bacteria 8140
338 Ga0496114_0226580 3300048917 Bacteria 1641
339 Ga0496115_0015600 3300048918 Bacteria 5768
340 Ga0496119_0007485 3300048922 Bacteria 9818
341 Ga0496120_0056825 3300048923 Bacteria 2206
342 Ga0496121_0618628 3300048924 Bacteria 665
343 Ga0496124_0714336 3300048927 Bacteria 633
344 Ga0496125_0056470 3300048928 Bacteria 3188
345 Ga0496126_0018950 3300048929 Bacteria 6798
346 Ga0496126_0132314 3300048929 Bacteria 2154
347 Ga0501036_0852118 3300049572 Unclassified 749
348 Ga0501038_0410770 3300049574 Bacteria 1046
349 Ga0501042_0028513 3300049578 Bacteria 3934
350 Ga0501042_0035456 3300049578 Bacteria 3540
351 Ga0501042_0955898 3300049578 Unclassified 624
352 Ga0501043_0552359 3300049579 Bacteria 855
353 Ga0501043_0694963 3300049579 Bacteria 743
354 Ga0501047_0229683 3300049581 Bacteria 1709
355 Ga0501068_0384974 3300049584 Bacteria 903
356 Ga0501069_0479931 3300049585 Bacteria 740
357 Ga0501070_0260341 3300049586 Bacteria 1418
358 Ga0501070_0503826 3300049586 Bacteria 972
359 Ga0501071_0082783 3300049587 Bacteria 2350
360 Ga0501071_0685893 3300049587 Bacteria 789
361 Ga0501072_0166345 3300049588 Bacteria 1760
362 Ga0501075_0001056 3300049591 Bacteria 17694
363 Ga0501076_1124535 3300049592 Unclassified 647
364 Ga0501077_0289028 3300049593 Bacteria 1044
365 Ga0501077_0411626 3300049593 Bacteria 865
366 Ga0501079_0274612 3300049741 Bacteria 1317
367 Ga0501080_0171412 3300049742 Bacteria 2001
368 Ga0501081_0320786 3300049743 Bacteria 1139
369 Ga0501083_0057473 3300049744 Bacteria 2604
370 Ga0501044_0160839 3300049823 Bacteria 2222
371 nmdc:mga03n38_16307_c1 3300050490 Bacteria 2888
372 nmdc:mga00v17_267716_c1 3300050491 Bacteria 1109
373 nmdc:mga00v17_56619_c1 3300050491 Unclassified 2397
374 nmdc:mga0yw44_935165_c1 3300050492 Bacteria 587
375 nmdc:mga06z11_363674_c1 3300050494 Bacteria 867
376 nmdc:mga04h51_106004_c1 3300050495 Unclassified 1030
377 nmdc:mga0rr50_474650_c1 3300050513 Bacteria 1062
378 Ga0495601_0000038 3300053077 Bacteria 81122
379 Ga0495601_0000071 3300053077 Bacteria 56206
380 Ga0495601_0009380 3300053077 Bacteria 5788
381 Ga0495601_0009617 3300053077 Bacteria 5723
382 Ga0495601_0147306 3300053077 Bacteria 1537
383 Ga0495601_0249445 3300053077 Bacteria 1159
384 Ga0495612_0000414 3300053078 Bacteria 17054
385 Ga0495612_0027234 3300053078 Bacteria 2298
386 Ga0495612_0528203 3300053078 Bacteria 542
387 Ga0495655_0000002 3300053083 Bacteria 312752
388 Ga0495595_0000002 3300053084 Bacteria 445641
389 Ga0495595_0000111 3300053084 Bacteria 37420
390 Ga0495595_0003432 3300053084 Bacteria 6285
391 Ga0495595_0144836 3300053084 Bacteria 1167
392 Ga0495619_0000053 3300053085 Bacteria 98761
393 Ga0495619_0000081 3300053085 Bacteria 72034
394 Ga0500641_0013123 3300053096 Bacteria 3041
395 Ga0500614_001321 3300053123 Bacteria 5973
396 Ga0500628_000001 3300053129 Bacteria 564074
397 Ga0530510_0382623 3300061734 Bacteria 1059
398 Ga0157370_10125411
399 JGI24746J21847_1000152
400 JGI24034J26672_10001207
401 JGI24742J22300_10014629
402 Ga0070658_10077842
403 Ga0070683_100002036
404 Ga0070683_100148547
405 Ga0070690_100033829
406 Ga0070680_100226119
407 Ga0068868_100000840
408 Ga0070660_100385011
409 Ga0070689_100066286
410 Ga0070661_100000145
411 Ga0070661_100939896
412 Ga0070692_10183579
413 Ga0070688_100001424
414 Ga0070659_100248994
415 Ga0070667_100576733
416 Ga0070714_100059972
417 Ga0070714_100348218
418 Ga0070714_100548934
419 Ga0070713_100001073
420 Ga0070713_100130831
421 Ga0070700_100068761
422 Ga0070663_100039177
423 Ga0070663_100716376
424 Ga0070662_100222014
425 Ga0070681_10079406
426 Ga0070681_10216984
427 Ga0070685_10000019
428 Ga0070679_100000129
429 Ga0070679_100004961
430 Ga0070684_100054054
431 Ga0070684_100174355
432 Ga0068853_100029866
433 Ga0068853_100130053
434 Ga0070672_100000001
435 Ga0070665_100000141
436 Ga0070665_100010197
437 Ga0070665_100178613
438 Ga0068855_100120638
439 Ga0070664_100107349
440 Ga0068854_100000113
441 Ga0068856_100001668
442 Ga0068856_100004779
443 Ga0068856_100269673
444 Ga0068856_100508562
445 Ga0068852_100017340
446 Ga0068866_10000003
447 Ga0068866_10020668
448 Ga0068866_10541882
449 Ga0068861_101057586
450 Ga0068863_100000129
451 Ga0068863_100036016
452 Ga0068863_100038453
453 Ga0068858_100000118
454 Ga0068860_100021542
455 Ga0068860_100053761
456 Ga0081455_10006044
457 Ga0075368_10134083
458 Ga0075363_100283134
459 Ga0075364_10074191
460 Ga0075364_10199689
461 Ga0075364_10566379
462 Ga0070715_10000029
463 Ga0070715_10265830
464 Ga0070716_100063188
465 Ga0070712_100000978
466 Ga0075367_10634470
467 Ga0068865_101379048
468 Ga0075435_100416223
469 Ga0105251_10467789
470 Ga0105245_10001571
471 Ga0105245_10006909
472 Ga0105242_10000059
473 Ga0105238_10000048
474 Ga0105249_10000076
475 Ga0105249_11300925
476 Ga0105239_10140381
477 Ga0105239_10490218
478 Ga0105246_10072084
479 Ga0157371_10305628
480 Ga0157370_10332459
481 Ga0157370_11974326
482 Ga0157374_10002573
483 Ga0157378_10010035
484 Ga0157378_11781736
485 Ga0157372_10000060
486 Ga0157375_10000171
487 Ga0157375_10162588
488 Ga0157375_10455572
489 Ga0163163_10592730
490 Ga0163163_12361352
491 Ga0157380_10000016
492 Ga0157380_10326706
493 Ga0157379_10157790
494 Ga0157379_10162849
495 Ga0157376_10079878
496 Ga0157376_11050026
497 Ga0163161_10000022
498 Ga0207656_10382630
499 Ga0207642_10000002
500 Ga0207642_10012601
501 Ga0207685_10000031
502 Ga0207654_10202536
503 Ga0207707_10106771
504 Ga0207695_10964223
505 Ga0207693_10003006
506 Ga0207663_10190511
507 Ga0207660_10324293
508 Ga0207660_10793462
509 Ga0207649_10000003
510 Ga0207652_10000211
511 Ga0207652_10025224
512 Ga0207694_10000056
513 Ga0207687_10002306
514 Ga0207687_10009791
515 Ga0207700_10000033
516 Ga0207700_10117097
517 Ga0207664_10044677
518 Ga0207664_10303261
519 Ga0207690_10044152
520 Ga0207690_10099640
521 Ga0207686_10000116
522 Ga0207670_10044405
523 Ga0207669_10000001
524 Ga0207665_10609439
525 Ga0207691_10000017
526 Ga0207661_10004623
527 Ga0207661_10051027
528 Ga0207661_10057791
529 Ga0207661_11625543
530 Ga0207679_10190104
531 Ga0207667_10297845
532 Ga0207651_10224977
533 Ga0207712_10000052
534 Ga0207712_10611004
535 Ga0207640_10000401
536 Ga0207658_10415641
537 Ga0207677_10000379
538 Ga0207703_10000061
539 Ga0207703_10101791
540 Ga0207639_10021823
541 Ga0207639_10060985
542 Ga0207678_10000556
543 Ga0207708_10051504
544 Ga0207708_10084523
545 Ga0207702_10000076
546 Ga0207702_10002397
547 Ga0207702_10262027
548 Ga0207702_10348174
549 Ga0207702_10884475
550 Ga0207702_11156520
551 Ga0207641_10000016
552 Ga0207641_10022213
553 Ga0207648_10000499
554 Ga0207675_101109317
555 Ga0268266_10000056
556 Ga0268266_10000376
557 Ga0268266_10156594
558 Ga0268264_10015533
559 Ga0268264_10217194
560 Ga0265337_1000007
561 Ga0265326_10000019
562 Ga0265319_1000014
563 Ga0265319_1038989
564 Ga0265319_1124158
565 Ga0265334_10143193
566 Ga0265322_10000011
567 Ga0265336_10039515
568 Ga0265338_10000244
569 Ga0265338_10762894
570 Ga0265324_10000997
571 Ga0265332_10024998
572 Ga0265328_10007834
573 Ga0265320_10000011
574 Ga0265320_10442584
575 Ga0265325_10020611
576 Ga0265329_10005385
577 Ga0265339_10018826
578 Ga0265331_10001052
579 Ga0265331_10045803
580 Ga0265327_10000015
581 Ga0265316_10104715
582 Ga0265313_10061948
583 Ga0265314_10000119
584 Ga0265342_10140697
585 Ga0316576_10025114
586 Ga0316583_10095154
587 Ga0316574_0029203
588 Ga0373937_0232475
589 Ga0316582_0357511
590 Ga0316584_0002796
591 Ga0451833_1465791
592 Ga0451847_0592842
593 Ga0451853_1794266
594 Ga0451853_2812611
595 Ga0451853_2814964
596 Ga0466963_0000004
597 Ga0466963_0009319
598 Ga0466957_0066197
599 Ga0466960_0055693
600 Ga0466958_0035543
601 Ga0466967_0000001
602 Ga0466967_0070386
603 Ga0495592_0000078
604 Ga0495592_0237612
605 Ga0495592_0655332
606 Ga0495592_0675344
607 Ga0495603_0000128
608 Ga0495603_0000584
609 Ga0495603_0001813
610 Ga0495629_0000106
611 Ga0495629_0470665
612 Ga0495629_0584586
613 Ga0495638_0039673
614 Ga0495641_0000005
615 Ga0495641_0015934
616 Ga0495641_0033658
617 Ga0495641_0048779
618 Ga0495651_0070978
619 Ga0495651_1016604
620 Ga0495653_0034161
621 Ga0495662_0000001
622 Ga0495662_0004081
623 Ga0495664_0102961
624 Ga0495608_0000007
625 Ga0495608_0000240
626 Ga0495608_0044324
627 Ga0495618_0000014
628 Ga0495618_0544267
629 Ga0495620_0000092
630 Ga0495628_0000808
631 Ga0495628_0004771
632 Ga0495628_0029657
633 Ga0495628_0149634
634 Ga0495630_0000014
635 Ga0495630_0040486
636 Ga0495630_0114790
637 Ga0495652_0004565
638 Ga0495652_0708452
639 Ga0495640_0017459
640 Ga0495586_0058110
641 Ga0495587_0015176
642 Ga0495587_0178955
643 Ga0495587_0189571
644 Ga0495598_0001011
645 Ga0495645_0004192
646 Ga0495645_0121723
647 Ga0495667_0000045
648 Ga0495656_0000931
649 Ga0495634_0000045
650 Ga0495634_0002241
651 Ga0495634_0057456
652 Ga0495625_0000032
653 Ga0495635_0906433
654 Ga0495657_0000001
655 Ga0495599_0004033
656 Ga0495599_0243704
657 Ga0495599_0370519
658 Ga0495623_0211398
659 Ga0495647_0000021
660 Ga0495647_0001696
661 Ga0495647_0056320
662 Ga0495658_0000370
663 Ga0495658_0184301
664 Ga0495669_0000051
665 Ga0495669_0062282
666 Ga0495669_0202347
667 Ga0495613_0000032
668 Ga0495624_0000085
669 Ga0495624_0000405
670 Ga0495624_0200933
671 Ga0495670_0117669
672 Ga0495649_0002413
673 Ga0495600_0010694
674 Ga0495600_0016321
675 Ga0495604_0000067
676 Ga0495604_0000577
677 Ga0495604_0026140
678 Ga0495674_0000010
679 Ga0495674_0963486
680 Ga0495674_1025096
681 Ga0495676_0000186
682 Ga0495676_0000956
683 Ga0495676_0175016
684 Ga0495676_0251995
685 Ga0495676_0276361
686 Ga0495680_0000267
687 Ga0495680_0000602
688 Ga0495675_0000017
689 Ga0495675_0105733
690 Ga0495686_0067860
691 Ga0495686_0106710
692 Ga0495686_0239799
693 Ga0495593_0020032
694 Ga0495602_0000007
695 Ga0495602_0000775
696 Ga0495602_0052816
697 Ga0495602_0572104
698 Ga0495614_0079883
699 Ga0496100_0000061
700 Ga0496101_0000141
701 Ga0496102_0015525
702 Ga0496102_0228769
703 Ga0496103_0000057
704 Ga0496104_0000015
705 Ga0496104_0000025
706 Ga0496104_0000133
707 Ga0496104_0209609
708 Ga0496105_0000004
709 Ga0496105_0000023
710 Ga0496105_0000187
711 Ga0496106_0000094
712 Ga0496106_0369179
713 Ga0496107_0000045
714 Ga0496108_0000164
715 Ga0496108_0000582
716 Ga0496109_0000180
717 Ga0496109_0000446
718 Ga0496109_0617557
719 Ga0496109_0686783
720 Ga0496109_1932949
721 Ga0496110_0000114
722 Ga0496110_0045145
723 Ga0496110_0057447
724 Ga0496110_1143974
725 Ga0496111_0000008
726 Ga0496111_0011403
727 Ga0496111_0087140
728 Ga0496111_0934753
729 Ga0496112_0000006
730 Ga0496112_0143558
731 Ga0496112_0439406
732 Ga0496113_0030813
733 Ga0496113_0440832
734 Ga0496114_0008493
735 Ga0496114_0226580
736 Ga0496115_0015600
737 Ga0496119_0007485
738 Ga0496120_0056825
739 Ga0496121_0618628
740 Ga0496124_0714336
741 Ga0496125_0056470
742 Ga0496126_0018950
743 Ga0496126_0132314
744 Ga0501036_0852118
745 Ga0501038_0410770
746 Ga0501042_0028513
747 Ga0501042_0035456
748 Ga0501042_0955898
749 Ga0501043_0552359
750 Ga0501043_0694963
751 Ga0501047_0229683
752 Ga0501068_0384974
753 Ga0501069_0479931
754 Ga0501070_0260341
755 Ga0501070_0503826
756 Ga0501071_0082783
757 Ga0501071_0685893
758 Ga0501072_0166345
759 Ga0501075_0001056
760 Ga0501076_1124535
761 Ga0501077_0289028
762 Ga0501077_0411626
763 Ga0501079_0274612
764 Ga0501080_0171412
765 Ga0501081_0320786
766 Ga0501083_0057473
767 Ga0501044_0160839
768 nmdc:mga03n38_16307_c1
769 nmdc:mga00v17_267716_c1
770 nmdc:mga00v17_56619_c1
771 nmdc:mga0yw44_935165_c1
772 nmdc:mga06z11_363674_c1
773 nmdc:mga04h51_106004_c1
774 nmdc:mga0rr50_474650_c1
775 Ga0495601_0000038
776 Ga0495601_0000071
777 Ga0495601_0009380
778 Ga0495601_0009617
779 Ga0495601_0147306
780 Ga0495601_0249445
781 Ga0495612_0000414
782 Ga0495612_0027234
783 Ga0495612_0528203
784 Ga0495655_0000002
785 Ga0495595_0000002
786 Ga0495595_0000111
787 Ga0495595_0003432
788 Ga0495595_0144836
789 Ga0495619_0000053
790 Ga0495619_0000081
791 Ga0500641_0013123
792 Ga0500614_001321
793 Ga0500628_000001
794 Ga0530510_0382623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

7

145

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2uyg-assembly1.cif.gz_F crystallogaphic structure of the typeii 3-dehydroquinase from thermus thermophilus 0.9488 8 145
8idu-assembly1.cif.gz_A crystal structure of substrate bound-form dehydroquinate dehydratase from corynebacterium glutamicum 0.946 6 148
3n59-assembly2.cif.gz_P type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate 0.9435 7 146
2cjf-assembly1.cif.gz_C type ii dehydroquinase inhibitor complex 0.9416 4 147
3n7a-assembly2.cif.gz_X crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 2 0.9414 7 146
ID Description Score Start End Superfamily
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9413 7 146 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.928 7 146 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9253 1 147 3.40.50.9100
2c57B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9165 7 150 3.40.50.9100
4ckwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9141 7 146 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A538A1I7-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9991 41 147 GO:0003855
GO:0009423
GO:0019631
AF-A0A3C2DXA6-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9774 30 152 GO:0003855
GO:0009423
GO:0019631
AF-A0A1E7YWL1-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9764 33 148 GO:0003855
GO:0009423
GO:0019631
AF-A0A812VHC3-F1-model_v4 deleted 0.9749 22 150
AF-A0A538A1I7-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9718 41 147 GO:0003855
GO:0009423
GO:0019631

Map