F433767

General Info

Members Datasets Scaffolds Average Seq Length
397 245 794 500

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10076804|Ga0157374_100768042
Length 521
Sequence VPENVQQQLCAEDLMCGIIGAVAKSPVNQLLYDGLLVLQHRGQDAAGMVTGAGSTFHMHKDSGLVRDVFRTRNMRALMGTTGIAHCRYPTAGSAENSAEAQPLYVNSPFGIVLGHNGNLTNAAQLKRELFRQDLRHVNTSSDSEVLLNVLAHELQDATGSYALDPTTIFQAVAGVHRRCRGAYAVVAMIAGYGLLAFRDPYGIRPLVIGCAETEAGKEYVVASESVALDVLGFKLVRDVAPGEAIFIDEDGNFYSRQCAATPSLNPCVFEFVYLARPDSVIDGISVYETRLRMGRSLADKIQREYPSLGIDVVIPIPDSSRPSAMELAKQLDVSYREGFIKNRYIGRTFIMPGQGVRKKSVRQKLNAIGMEFKGKNVLLVDDSIVRGTTSREIVQMARDAGANKVFFASASPPVRYPNVYGIDMPSPRELIANGRTDVEIAAEIGADCLIYQDLDALLDDVRSVNPRVTSLEASCFSGVYVTGDVTPEYLAGVEADRNDIELGRGSSIATTQLDLNLATTD

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
137 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
138 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
231 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
236 2547132512 Azospira oryzae 6a3 Isolate Unclassified
237 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
238 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
239 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
240 2738541280 Massilia sp. GV090 Isolate Unclassified
241 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
242 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
243 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
244 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
245 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 0
Isolates 2.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.03
Nodule 0
Rhizoplane 1.26
Rhizosphere 90.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10076804 3300013296 Bacteria 3158
2 Ga0065715_10098988 3300005293 Bacteria 3472
3 Ga0070690_100003356 3300005330 Bacteria 8737
4 Ga0070670_100000454 3300005331 Bacteria 33113
5 Ga0070670_100205818 3300005331 Bacteria 1710
6 Ga0070677_10004921 3300005333 Bacteria 4386
7 Ga0068869_100001041 3300005334 Bacteria 16142
8 Ga0068869_100022533 3300005334 Bacteria 4341
9 Ga0068869_100054203 3300005334 Bacteria 2918
10 Ga0070666_10009480 3300005335 Bacteria 6070
11 Ga0070680_100030971 3300005336 Bacteria 4299
12 Ga0070689_100007317 3300005340 Bacteria 7703
13 Ga0070691_10011400 3300005341 Bacteria 4059
14 Ga0070675_100056300 3300005354 Bacteria 3240
15 Ga0070675_100076316 3300005354 Bacteria 2787
16 Ga0070671_100038546 3300005355 Bacteria 3967
17 Ga0070674_100014970 3300005356 Bacteria 4832
18 Ga0070674_100017673 3300005356 Bacteria 4494
19 Ga0070674_100025218 3300005356 Bacteria 3868
20 Ga0070659_100031072 3300005366 Bacteria 4135
21 Ga0070714_100001046 3300005435 Bacteria 19736
22 Ga0070701_10015697 3300005438 Bacteria 3504
23 Ga0070701_10031736 3300005438 Bacteria 2623
24 Ga0070700_100036780 3300005441 Bacteria 2972
25 Ga0070694_100012828 3300005444 Bacteria 5223
26 Ga0070694_100040607 3300005444 Bacteria 3101
27 Ga0070694_100076628 3300005444 Bacteria 2315
28 Ga0070663_100136396 3300005455 Bacteria 1869
29 Ga0070681_10009557 3300005458 Bacteria 9542
30 Ga0068867_100040204 3300005459 Bacteria 3411
31 Ga0068867_100057968 3300005459 Bacteria 2869
32 Ga0068867_100084788 3300005459 Bacteria 2394
33 Ga0070698_100003286 3300005471 Bacteria 17771
34 Ga0070686_100005665 3300005544 Bacteria 6919
35 Ga0070696_100020922 3300005546 Bacteria 4434
36 Ga0070693_100009957 3300005547 Bacteria 4747
37 Ga0070665_100114767 3300005548 Bacteria 2696
38 Ga0070704_100009231 3300005549 Bacteria 5951
39 Ga0070704_100018600 3300005549 Bacteria 4447
40 Ga0070704_100096453 3300005549 Bacteria 2217
41 Ga0070704_100110870 3300005549 Bacteria 2087
42 Ga0070664_100037290 3300005564 Bacteria 4086
43 Ga0068857_100014080 3300005577 Bacteria 6961
44 Ga0070702_100002350 3300005615 Bacteria 8131
45 Ga0068859_100001598 3300005617 Bacteria 23129
46 Ga0068859_100118842 3300005617 Bacteria 2709
47 Ga0068859_100142407 3300005617 Bacteria 2471
48 Ga0068859_100154768 3300005617 Bacteria 2369
49 Ga0068864_100040098 3300005618 Bacteria 4005
50 Ga0068866_10042200 3300005718 Bacteria 2269
51 Ga0068861_100002607 3300005719 Bacteria 11803
52 Ga0068870_10019778 3300005840 Bacteria 3270
53 Ga0068863_100143101 3300005841 Bacteria 2286
54 Ga0068858_100009875 3300005842 Bacteria 9069
55 Ga0068858_100012890 3300005842 Bacteria 7883
56 Ga0068858_100096608 3300005842 Bacteria 2753
57 Ga0068862_100023465 3300005844 Bacteria 5169
58 Ga0068862_100142414 3300005844 Bacteria 2129
59 Ga0075369_10018337 3300006186 Bacteria 2848
60 Ga0075366_10000424 3300006195 Bacteria 19783
61 Ga0075366_10020805 3300006195 Bacteria 3808
62 Ga0097621_100003765 3300006237 Bacteria 10513
63 Ga0097621_100004603 3300006237 Bacteria 9629
64 Ga0068871_100045478 3300006358 Bacteria 3533
65 Ga0068871_100109166 3300006358 Bacteria 2326
66 Ga0075428_100024788 3300006844 Bacteria 6636
67 Ga0075430_100042385 3300006846 Bacteria 3849
68 Ga0075431_100001349 3300006847 Bacteria 22469
69 Ga0075431_100046921 3300006847 Bacteria 4454
70 Ga0075429_100000003 3300006880 Bacteria 130377
71 Ga0075429_100038881 3300006880 Bacteria 4142
72 Ga0068865_100000713 3300006881 Bacteria 18690
73 Ga0068865_100074551 3300006881 Bacteria 2417
74 Ga0097620_100001598 3300006931 Bacteria 23129
75 Ga0097620_100118835 3300006931 Bacteria 2709
76 Ga0097620_100142407 3300006931 Bacteria 2471
77 Ga0097620_100154767 3300006931 Bacteria 2369
78 Ga0099794_10015086 3300007265 Bacteria 3403
79 Ga0105240_10023620 3300009093 Bacteria 8122
80 Ga0105240_10105655 3300009093 Bacteria 3418
81 Ga0105240_10143485 3300009093 Bacteria 2852
82 Ga0111539_10001653 3300009094 Bacteria 29768
83 Ga0111539_10025117 3300009094 Bacteria 7302
84 Ga0111539_10101075 3300009094 Bacteria 3385
85 Ga0111539_10302214 3300009094 Bacteria 1862
86 Ga0105243_10071714 3300009148 Bacteria 2802
87 Ga0105243_10130357 3300009148 Bacteria 2132
88 Ga0105242_10004877 3300009176 Bacteria 10384
89 Ga0105242_10114665 3300009176 Bacteria 2303
90 Ga0105248_10044870 3300009177 Bacteria 4958
91 Ga0105248_10046625 3300009177 Bacteria 4858
92 Ga0105237_10010128 3300009545 Bacteria 10049
93 Ga0105238_10039800 3300009551 Bacteria 4766
94 Ga0105239_10010647 3300010375 Bacteria 10287
95 Ga0157370_10004076 3300013104 Bacteria 16934
96 Ga0163162_10122948 3300013306 Bacteria 2700
97 Ga0163162_10218962 3300013306 Bacteria 2034
98 Ga0163163_10070713 3300014325 Bacteria 3476
99 Ga0182008_10040648 3300014497 Bacteria 2321
100 Ga0157376_10063095 3300014969 Bacteria 3120
101 Ga0213872_10000090 3300021361 Bacteria 83813
102 Ga0207697_10012728 3300025315 Bacteria 3522
103 Ga0207682_10002577 3300025893 Bacteria 8087
104 Ga0207645_10007639 3300025907 Bacteria 7618
105 Ga0207643_10010954 3300025908 Bacteria 4892
106 Ga0207707_10005396 3300025912 Bacteria 11175
107 Ga0207695_10024092 3300025913 Bacteria 6858
108 Ga0207671_10007481 3300025914 Bacteria 9472
109 Ga0207671_10030957 3300025914 Bacteria 3989
110 Ga0207660_10035358 3300025917 Bacteria 3469
111 Ga0207646_10216812 3300025922 Bacteria 1729
112 Ga0207659_10007546 3300025926 Bacteria 6698
113 Ga0207687_10033025 3300025927 Bacteria 3509
114 Ga0207664_10028347 3300025929 Bacteria 4254
115 Ga0207644_10030920 3300025931 Bacteria 3727
116 Ga0207690_10044682 3300025932 Bacteria 2922
117 Ga0207706_10087800 3300025933 Bacteria 2735
118 Ga0207686_10014539 3300025934 Bacteria 4384
119 Ga0207709_10043783 3300025935 Bacteria 2700
120 Ga0207670_10138310 3300025936 Bacteria 1793
121 Ga0207669_10014364 3300025937 Bacteria 3966
122 Ga0207704_10007580 3300025938 Bacteria 5138
123 Ga0207665_10051912 3300025939 Bacteria 2762
124 Ga0207691_10011509 3300025940 Bacteria 8491
125 Ga0207711_10031799 3300025941 Bacteria 4457
126 Ga0207689_10000483 3300025942 Bacteria 37602
127 Ga0207689_10002666 3300025942 Bacteria 16499
128 Ga0207689_10021931 3300025942 Bacteria 5371
129 Ga0207679_10048561 3300025945 Bacteria 3091
130 Ga0207667_10204622 3300025949 Bacteria 2024
131 Ga0207651_10050338 3300025960 Bacteria 2828
132 Ga0207708_10001176 3300026075 Bacteria 19697
133 Ga0207708_10001678 3300026075 Bacteria 16404
134 Ga0207648_10000988 3300026089 Bacteria 32083
135 Ga0207648_10011529 3300026089 Bacteria 8323
136 Ga0207648_10148881 3300026089 Bacteria 2065
137 Ga0207674_10020112 3300026116 Bacteria 7219
138 Ga0207675_100008910 3300026118 Bacteria 9414
139 Ga0207675_100011127 3300026118 Bacteria 8429
140 Ga0207683_10011719 3300026121 Bacteria 7485
141 Ga0207683_10015166 3300026121 Bacteria 6558
142 Ga0209968_1000181 3300027526 Bacteria 10958
143 Ga0209588_1005875 3300027671 Bacteria 3537
144 Ga0209966_1000013 3300027695 Bacteria 83121
145 Ga0209813_10007476 3300027866 Bacteria 2725
146 Ga0207428_10033295 3300027907 Bacteria 4234
147 Ga0207428_10085056 3300027907 Bacteria 2464
148 Ga0268266_10055630 3300028379 Bacteria 3402
149 Ga0268264_10007889 3300028381 Bacteria 8858
150 Ga0265336_10001323 3300028666 Bacteria 11566
151 Ga0265324_10000002 3300029957 Bacteria 382754
152 Ga0265324_10000212 3300029957 Bacteria 44577
153 Ga0265324_10030819 3300029957 Bacteria 1880
154 Ga0265332_10000020 3300031238 Bacteria 219119
155 Ga0265332_10008101 3300031238 Bacteria 4723
156 Ga0265328_10000002 3300031239 Bacteria 275819
157 Ga0265328_10001596 3300031239 Bacteria 10415
158 Ga0265328_10020298 3300031239 Bacteria 2544
159 Ga0265320_10017571 3300031240 Bacteria 3965
160 Ga0265325_10000071 3300031241 Bacteria 70383
161 Ga0265331_10000012 3300031250 Bacteria 297201
162 Ga0265331_10002569 3300031250 Bacteria 12206
163 Ga0265331_10026054 3300031250 Bacteria 2945
164 Ga0265331_10029881 3300031250 Bacteria 2717
165 Ga0265327_10000173 3300031251 Bacteria 138925
166 Ga0265327_10000295 3300031251 Bacteria 96706
167 Ga0265327_10008616 3300031251 Bacteria 7559
168 Ga0265327_10016587 3300031251 Bacteria 4667
169 Ga0265327_10019218 3300031251 Bacteria 4208
170 Ga0265316_10024174 3300031344 Bacteria 5098
171 Ga0265316_10049073 3300031344 Bacteria 3327
172 Ga0307509_10000006 3300031507 Bacteria 421538
173 Ga0307509_10001421 3300031507 Bacteria 40413
174 Ga0307408_100115124 3300031548 Bacteria 2073
175 Ga0316575_10000031 3300031665 Bacteria 34008
176 Ga0316575_10000803 3300031665 Bacteria 9515
177 Ga0316575_10029115 3300031665 Bacteria 2155
178 Ga0265314_10000452 3300031711 Bacteria 54864
179 Ga0265314_10001647 3300031711 Bacteria 24450
180 Ga0307411_10015878 3300032005 Bacteria 4245
181 Ga0307415_100038742 3300032126 Bacteria 3144
182 Ga0316583_10008115 3300032133 Bacteria 3784
183 Ga0373934_0002797 3300035086 Bacteria 6394
184 Ga0373953_0000820 3300035117 Bacteria 8686
185 Ga0373954_0000777 3300035118 Bacteria 12289
186 Ga0373956_0000035 3300035119 Bacteria 43792
187 Ga0373957_0002849 3300035120 Bacteria 4998
188 Ga0373960_0010708 3300035121 Bacteria 2246
189 Ga0373960_0014543 3300035121 Bacteria 1996
190 Ga0373955_0024789 3300035172 Bacteria 3071
191 Ga0373935_0013106 3300035692 Bacteria 4997
192 Ga0373927_0010143 3300035695 Bacteria 6300
193 Ga0373933_0002883 3300035724 Bacteria 9612
194 Ga0373933_0116598 3300035724 Bacteria 1669
195 Ga0373947_0115753 3300035725 Bacteria 1699
196 Ga0373937_0000233 3300036401 Bacteria 54240
197 Ga0373937_0157744 3300036401 Bacteria 2127
198 Ga0373937_0212102 3300036401 Bacteria 1822
199 Ga0316582_0048335 3300036647 Bacteria 2689
200 Ga0373925_0018124 3300037068 Bacteria 5114
201 Ga0373925_0083017 3300037068 Bacteria 2439
202 Ga0395899_0123736 3300037312 Bacteria 1851
203 Ga0395900_0088383 3300037418 Bacteria 3186
204 Ga0395900_0095032 3300037418 Bacteria 3062
205 Ga0395905_0001278 3300037471 Bacteria 31041
206 Ga0316581_0002978 3300037588 Bacteria 4158
207 Ga0400490_53660 3300038726 Bacteria 19438
208 Ga0400483_113154 3300039062 Bacteria 1602
209 Ga0400483_195378 3300039062 Bacteria 81541
210 Ga0400483_250036 3300039062 Bacteria 396353
211 Ga0436361_0059180 3300039447 Bacteria 3651
212 Ga0436361_0337832 3300039447 Bacteria 3119
213 Ga0436361_0692684 3300039447 Bacteria 133303
214 Ga0450911_000854 3300042115 Bacteria 8313
215 Ga0451577_0000002 3300042876 Bacteria 1731375
216 Ga0451577_0000635 3300042876 Bacteria 56126
217 Ga0451577_0021915 3300042876 Bacteria 5839
218 Ga0451577_0034802 3300042876 Bacteria 4539
219 Ga0451577_0040328 3300042876 Bacteria 4193
220 Ga0451577_0054154 3300042876 Bacteria 3582
221 Ga0451577_0073638 3300042876 Bacteria 3047
222 Ga0453683_0000003 3300044673 Bacteria 942572
223 Ga0453683_0076007 3300044673 Bacteria 2103
224 Ga0453684_0000002 3300044712 Bacteria 1731375
225 Ga0453684_0000005 3300044712 Bacteria 1431632
226 Ga0453684_0000029 3300044712 Bacteria 757969
227 Ga0453684_0000069 3300044712 Bacteria 456439
228 Ga0453684_0000102 3300044712 Bacteria 366870
229 Ga0453684_0002009 3300044712 Bacteria 52070
230 Ga0453684_0005277 3300044712 Bacteria 25815
231 Ga0453684_0050141 3300044712 Bacteria 5494
232 Ga0453684_0058162 3300044712 Bacteria 4995
233 Ga0451576_0000004 3300045051 Bacteria 1312238
234 Ga0451576_0000034 3300045051 Bacteria 390778
235 Ga0451576_0000386 3300045051 Bacteria 102813
236 Ga0451576_0000418 3300045051 Bacteria 98732
237 Ga0451576_0001188 3300045051 Bacteria 46552
238 Ga0451576_0007978 3300045051 Bacteria 12519
239 Ga0451576_0023729 3300045051 Bacteria 6636
240 Ga0451576_0160601 3300045051 Bacteria 2345
241 Ga0451576_0200501 3300045051 Bacteria 2084
242 Ga0495592_0004975 3300046454 Bacteria 9779
243 Ga0495592_0014819 3300046454 Bacteria 5918
244 Ga0495629_0077846 3300046459 Bacteria 2315
245 Ga0495651_0000178 3300046462 Bacteria 47161
246 Ga0495651_0041919 3300046462 Bacteria 3555
247 Ga0495653_0065917 3300046463 Bacteria 2724
248 Ga0495639_0016227 3300046475 Bacteria 3232
249 Ga0495664_0017065 3300046477 Bacteria 4146
250 Ga0495607_0018542 3300046501 Bacteria 4435
251 Ga0495618_0016534 3300046514 Bacteria 4515
252 Ga0495628_0001910 3300046516 Bacteria 18904
253 Ga0495628_0003831 3300046516 Bacteria 13406
254 Ga0495630_0006027 3300046517 Bacteria 8582
255 Ga0495666_0074619 3300046526 Bacteria 1608
256 Ga0495652_0001931 3300046529 Bacteria 22040
257 Ga0495665_0007327 3300046531 Bacteria 5962
258 Ga0495640_0053978 3300046533 Bacteria 2754
259 Ga0495586_0012285 3300046535 Bacteria 4544
260 Ga0495587_0014186 3300046536 Bacteria 5002
261 Ga0495598_0008418 3300046537 Bacteria 2402
262 Ga0495609_0032897 3300046538 Bacteria 2354
263 Ga0495597_0047068 3300046542 Bacteria 1910
264 Ga0495645_0000492 3300046543 Bacteria 27357
265 Ga0495667_0005180 3300046559 Bacteria 8810
266 Ga0495635_0024036 3300046663 Bacteria 4248
267 Ga0495659_0000033 3300046664 Bacteria 64915
268 Ga0495657_0039421 3300046675 Bacteria 3246
269 Ga0495657_0089192 3300046675 Bacteria 1981
270 Ga0495599_0000384 3300046678 Bacteria 25474
271 Ga0495599_0003891 3300046678 Bacteria 8782
272 Ga0495599_0035329 3300046678 Bacteria 3137
273 Ga0495658_0018238 3300046683 Bacteria 3644
274 Ga0495613_0111712 3300046689 Bacteria 1968
275 Ga0495671_0000651 3300046692 Bacteria 25271
276 Ga0495660_0002258 3300046810 Bacteria 12399
277 Ga0495604_0113402 3300047317 Bacteria 1973
278 Ga0495636_0007479 3300047318 Bacteria 4300
279 Ga0495674_0006517 3300047319 Bacteria 11201
280 Ga0495672_0000191 3300047320 Bacteria 88319
281 Ga0495675_0045806 3300047444 Bacteria 2785
282 Ga0495675_0092907 3300047444 Bacteria 1893
283 Ga0495684_0086599 3300047471 Bacteria 2374
284 Ga0495686_0004325 3300047472 Bacteria 11741
285 Ga0496100_0049052 3300048903 Bacteria 2728
286 Ga0496102_0159431 3300048905 Bacteria 2122
287 Ga0496108_0070193 3300048911 Bacteria 2957
288 Ga0496114_0003464 3300048917 Bacteria 12110
289 Ga0496114_0038386 3300048917 Bacteria 3962
290 Ga0496121_0002132 3300048924 Bacteria 31087
291 Ga0496125_0004737 3300048928 Bacteria 15506
292 Ga0496125_0033201 3300048928 Bacteria 4572
293 Ga0501300_000671 3300049523 Bacteria 5133
294 Ga0501031_0001459 3300049568 Bacteria 14679
295 Ga0501031_0010586 3300049568 Bacteria 6005
296 Ga0501031_0121360 3300049568 Bacteria 1707
297 Ga0501032_0001298 3300049569 Bacteria 20031
298 Ga0501032_0003220 3300049569 Bacteria 12557
299 Ga0501032_0040131 3300049569 Bacteria 3182
300 Ga0501033_0000449 3300049570 Bacteria 39220
301 Ga0501033_0005135 3300049570 Bacteria 10409
302 Ga0501033_0054486 3300049570 Bacteria 2958
303 Ga0501034_0000468 3300049571 Bacteria 66573
304 Ga0501034_0120793 3300049571 Bacteria 2606
305 Ga0501034_0245575 3300049571 Bacteria 1735
306 Ga0501036_0005463 3300049572 Bacteria 10303
307 Ga0501036_0011502 3300049572 Bacteria 7329
308 Ga0501036_0016514 3300049572 Bacteria 6166
309 Ga0501036_0143567 3300049572 Bacteria 2013
310 Ga0501038_0001163 3300049574 Bacteria 23887
311 Ga0501038_0005649 3300049574 Bacteria 11605
312 Ga0501038_0006960 3300049574 Bacteria 10440
313 Ga0501038_0011367 3300049574 Bacteria 8125
314 Ga0501039_0004546 3300049575 Bacteria 10477
315 Ga0501039_0017095 3300049575 Bacteria 5562
316 Ga0501040_0001956 3300049576 Bacteria 13274
317 Ga0501040_0045339 3300049576 Bacteria 2998
318 Ga0501041_0001264 3300049577 Bacteria 13891
319 Ga0501041_0001454 3300049577 Bacteria 13095
320 Ga0501042_0017731 3300049578 Bacteria 4915
321 Ga0501042_0024994 3300049578 Bacteria 4193
322 Ga0501043_0016321 3300049579 Bacteria 5824
323 Ga0501043_0020123 3300049579 Bacteria 5237
324 Ga0501043_0024650 3300049579 Bacteria 4717
325 Ga0501046_0018947 3300049580 Bacteria 5714
326 Ga0501046_0023722 3300049580 Bacteria 5041
327 Ga0501047_0031683 3300049581 Bacteria 5101
328 Ga0501047_0091995 3300049581 Bacteria 2911
329 Ga0501068_0022251 3300049584 Bacteria 3705
330 Ga0501069_0007469 3300049585 Bacteria 5739
331 Ga0501070_0003987 3300049586 Bacteria 12699
332 Ga0501070_0027900 3300049586 Bacteria 4736
333 Ga0501071_0002060 3300049587 Bacteria 12032
334 Ga0501071_0048874 3300049587 Bacteria 3043
335 Ga0501072_0001788 3300049588 Bacteria 16003
336 Ga0501072_0009780 3300049588 Bacteria 7290
337 Ga0501072_0010208 3300049588 Bacteria 7156
338 Ga0501072_0106532 3300049588 Bacteria 2230
339 Ga0501074_0001669 3300049590 Bacteria 15112
340 Ga0501074_0032716 3300049590 Bacteria 3767
341 Ga0501075_0015085 3300049591 Bacteria 5544
342 Ga0501075_0116798 3300049591 Bacteria 2028
343 Ga0501079_0006498 3300049741 Bacteria 8781
344 Ga0501080_0004253 3300049742 Bacteria 12706
345 Ga0501080_0019617 3300049742 Bacteria 6263
346 Ga0501080_0041935 3300049742 Bacteria 4263
347 Ga0501081_0000666 3300049743 Bacteria 19677
348 Ga0501081_0004893 3300049743 Bacteria 8611
349 Ga0501081_0062128 3300049743 Bacteria 2590
350 Ga0501280_001077 3300049776 Bacteria 5525
351 Ga0501035_0003619 3300049822 Bacteria 14744
352 Ga0501035_0028163 3300049822 Bacteria 5129
353 Ga0501035_0066237 3300049822 Bacteria 3206
354 Ga0501044_0001550 3300049823 Bacteria 26951
355 Ga0501044_0008143 3300049823 Bacteria 11502
356 Ga0501044_0024653 3300049823 Bacteria 6383
357 Ga0501044_0037554 3300049823 Bacteria 5062
358 Ga0501044_0100919 3300049823 Bacteria 2904
359 Ga0501045_0001496 3300049824 Bacteria 15566
360 Ga0501045_0013620 3300049824 Bacteria 5748
361 nmdc:mga03683_29503_c1 3300050489 Bacteria 2188
362 nmdc:mga03n38_36228_c1 3300050490 Bacteria 2120
363 nmdc:mga0k408_494_c2 3300050493 Bacteria 19802
364 nmdc:mga0k408_7440_c1 3300050493 Bacteria 5849
365 nmdc:mga07m45_34681_c1 3300050496 Bacteria 2805
366 nmdc:mga09592_22501_c1 3300050508 Bacteria 4135
367 nmdc:mga09592_2766_c1 3300050508 Bacteria 14192
368 nmdc:mga0qj67_16335_c1 3300050509 Bacteria 5627
369 nmdc:mga06r32_41221_c1 3300050510 Bacteria 4385
370 nmdc:mga08y16_147136_c1 3300050511 Bacteria 2449
371 nmdc:mga08y16_203590_c1 3300050511 Bacteria 2051
372 nmdc:mga08y16_23197_c1 3300050511 Bacteria 6550
373 nmdc:mga08y16_266142_c1 3300050511 Bacteria 1770
374 nmdc:mga08y16_30892_c1 3300050511 Bacteria 5633
375 nmdc:mga0sz30_19554_c1 3300050516 Bacteria 2724
376 Ga0495601_0002935 3300053077 Bacteria 9702
377 Ga0495595_0015750 3300053084 Bacteria 3227
378 Ga0500588_0001389 3300053146 Bacteria 4601
379 Ga0500616_0058094 3300053153 Bacteria 2014
380 Ga0500622_0000001 3300053156 Bacteria 657715
381 Ga0500636_0003593 3300053177 Bacteria 8741
382 Ga0500637_0006058 3300053178 Bacteria 5915
383 Ga0500625_003478 3300053729 Bacteria 6232
384 Ga0501084_0043637 3300054114 Bacteria 3751
385 Ga0501082_0027784 3300060353 Bacteria 4872
386 Ga0530510_0002440 3300061734 Bacteria 12814
387 2526213113 2526164512 Bacteria 4025691
388 2548846100 2547132512 Bacteria 3416496
389 2574431022 2574179768 Bacteria 4907129
390 2644221446 2643221639 Bacteria 6649903
391 2644257800 2643221646 Bacteria 6433402
392 2738740443 2738541280 Bacteria 6630198
393 2881103771 2881101125 Bacteria 4590519
394 2891634697 2891633521 Bacteria 4602265
395 2932426232 2932422444 Bacteria 4678430
396 2939632305 2939631187 Bacteria 6118131
397 639786182 639633007 Bacteria 4376040
398 Ga0157374_10076804
399 Ga0065715_10098988
400 Ga0070690_100003356
401 Ga0070670_100000454
402 Ga0070670_100205818
403 Ga0070677_10004921
404 Ga0068869_100001041
405 Ga0068869_100022533
406 Ga0068869_100054203
407 Ga0070666_10009480
408 Ga0070680_100030971
409 Ga0070689_100007317
410 Ga0070691_10011400
411 Ga0070675_100056300
412 Ga0070675_100076316
413 Ga0070671_100038546
414 Ga0070674_100014970
415 Ga0070674_100017673
416 Ga0070674_100025218
417 Ga0070659_100031072
418 Ga0070714_100001046
419 Ga0070701_10015697
420 Ga0070701_10031736
421 Ga0070700_100036780
422 Ga0070694_100012828
423 Ga0070694_100040607
424 Ga0070694_100076628
425 Ga0070663_100136396
426 Ga0070681_10009557
427 Ga0068867_100040204
428 Ga0068867_100057968
429 Ga0068867_100084788
430 Ga0070698_100003286
431 Ga0070686_100005665
432 Ga0070696_100020922
433 Ga0070693_100009957
434 Ga0070665_100114767
435 Ga0070704_100009231
436 Ga0070704_100018600
437 Ga0070704_100096453
438 Ga0070704_100110870
439 Ga0070664_100037290
440 Ga0068857_100014080
441 Ga0070702_100002350
442 Ga0068859_100001598
443 Ga0068859_100118842
444 Ga0068859_100142407
445 Ga0068859_100154768
446 Ga0068864_100040098
447 Ga0068866_10042200
448 Ga0068861_100002607
449 Ga0068870_10019778
450 Ga0068863_100143101
451 Ga0068858_100009875
452 Ga0068858_100012890
453 Ga0068858_100096608
454 Ga0068862_100023465
455 Ga0068862_100142414
456 Ga0075369_10018337
457 Ga0075366_10000424
458 Ga0075366_10020805
459 Ga0097621_100003765
460 Ga0097621_100004603
461 Ga0068871_100045478
462 Ga0068871_100109166
463 Ga0075428_100024788
464 Ga0075430_100042385
465 Ga0075431_100001349
466 Ga0075431_100046921
467 Ga0075429_100000003
468 Ga0075429_100038881
469 Ga0068865_100000713
470 Ga0068865_100074551
471 Ga0097620_100001598
472 Ga0097620_100118835
473 Ga0097620_100142407
474 Ga0097620_100154767
475 Ga0099794_10015086
476 Ga0105240_10023620
477 Ga0105240_10105655
478 Ga0105240_10143485
479 Ga0111539_10001653
480 Ga0111539_10025117
481 Ga0111539_10101075
482 Ga0111539_10302214
483 Ga0105243_10071714
484 Ga0105243_10130357
485 Ga0105242_10004877
486 Ga0105242_10114665
487 Ga0105248_10044870
488 Ga0105248_10046625
489 Ga0105237_10010128
490 Ga0105238_10039800
491 Ga0105239_10010647
492 Ga0157370_10004076
493 Ga0163162_10122948
494 Ga0163162_10218962
495 Ga0163163_10070713
496 Ga0182008_10040648
497 Ga0157376_10063095
498 Ga0213872_10000090
499 Ga0207697_10012728
500 Ga0207682_10002577
501 Ga0207645_10007639
502 Ga0207643_10010954
503 Ga0207707_10005396
504 Ga0207695_10024092
505 Ga0207671_10007481
506 Ga0207671_10030957
507 Ga0207660_10035358
508 Ga0207646_10216812
509 Ga0207659_10007546
510 Ga0207687_10033025
511 Ga0207664_10028347
512 Ga0207644_10030920
513 Ga0207690_10044682
514 Ga0207706_10087800
515 Ga0207686_10014539
516 Ga0207709_10043783
517 Ga0207670_10138310
518 Ga0207669_10014364
519 Ga0207704_10007580
520 Ga0207665_10051912
521 Ga0207691_10011509
522 Ga0207711_10031799
523 Ga0207689_10000483
524 Ga0207689_10002666
525 Ga0207689_10021931
526 Ga0207679_10048561
527 Ga0207667_10204622
528 Ga0207651_10050338
529 Ga0207708_10001176
530 Ga0207708_10001678
531 Ga0207648_10000988
532 Ga0207648_10011529
533 Ga0207648_10148881
534 Ga0207674_10020112
535 Ga0207675_100008910
536 Ga0207675_100011127
537 Ga0207683_10011719
538 Ga0207683_10015166
539 Ga0209968_1000181
540 Ga0209588_1005875
541 Ga0209966_1000013
542 Ga0209813_10007476
543 Ga0207428_10033295
544 Ga0207428_10085056
545 Ga0268266_10055630
546 Ga0268264_10007889
547 Ga0265336_10001323
548 Ga0265324_10000002
549 Ga0265324_10000212
550 Ga0265324_10030819
551 Ga0265332_10000020
552 Ga0265332_10008101
553 Ga0265328_10000002
554 Ga0265328_10001596
555 Ga0265328_10020298
556 Ga0265320_10017571
557 Ga0265325_10000071
558 Ga0265331_10000012
559 Ga0265331_10002569
560 Ga0265331_10026054
561 Ga0265331_10029881
562 Ga0265327_10000173
563 Ga0265327_10000295
564 Ga0265327_10008616
565 Ga0265327_10016587
566 Ga0265327_10019218
567 Ga0265316_10024174
568 Ga0265316_10049073
569 Ga0307509_10000006
570 Ga0307509_10001421
571 Ga0307408_100115124
572 Ga0316575_10000031
573 Ga0316575_10000803
574 Ga0316575_10029115
575 Ga0265314_10000452
576 Ga0265314_10001647
577 Ga0307411_10015878
578 Ga0307415_100038742
579 Ga0316583_10008115
580 Ga0373934_0002797
581 Ga0373953_0000820
582 Ga0373954_0000777
583 Ga0373956_0000035
584 Ga0373957_0002849
585 Ga0373960_0010708
586 Ga0373960_0014543
587 Ga0373955_0024789
588 Ga0373935_0013106
589 Ga0373927_0010143
590 Ga0373933_0002883
591 Ga0373933_0116598
592 Ga0373947_0115753
593 Ga0373937_0000233
594 Ga0373937_0157744
595 Ga0373937_0212102
596 Ga0316582_0048335
597 Ga0373925_0018124
598 Ga0373925_0083017
599 Ga0395899_0123736
600 Ga0395900_0088383
601 Ga0395900_0095032
602 Ga0395905_0001278
603 Ga0316581_0002978
604 Ga0400490_53660
605 Ga0400483_113154
606 Ga0400483_195378
607 Ga0400483_250036
608 Ga0436361_0059180
609 Ga0436361_0337832
610 Ga0436361_0692684
611 Ga0450911_000854
612 Ga0451577_0000002
613 Ga0451577_0000635
614 Ga0451577_0021915
615 Ga0451577_0034802
616 Ga0451577_0040328
617 Ga0451577_0054154
618 Ga0451577_0073638
619 Ga0453683_0000003
620 Ga0453683_0076007
621 Ga0453684_0000002
622 Ga0453684_0000005
623 Ga0453684_0000029
624 Ga0453684_0000069
625 Ga0453684_0000102
626 Ga0453684_0002009
627 Ga0453684_0005277
628 Ga0453684_0050141
629 Ga0453684_0058162
630 Ga0451576_0000004
631 Ga0451576_0000034
632 Ga0451576_0000386
633 Ga0451576_0000418
634 Ga0451576_0001188
635 Ga0451576_0007978
636 Ga0451576_0023729
637 Ga0451576_0160601
638 Ga0451576_0200501
639 Ga0495592_0004975
640 Ga0495592_0014819
641 Ga0495629_0077846
642 Ga0495651_0000178
643 Ga0495651_0041919
644 Ga0495653_0065917
645 Ga0495639_0016227
646 Ga0495664_0017065
647 Ga0495607_0018542
648 Ga0495618_0016534
649 Ga0495628_0001910
650 Ga0495628_0003831
651 Ga0495630_0006027
652 Ga0495666_0074619
653 Ga0495652_0001931
654 Ga0495665_0007327
655 Ga0495640_0053978
656 Ga0495586_0012285
657 Ga0495587_0014186
658 Ga0495598_0008418
659 Ga0495609_0032897
660 Ga0495597_0047068
661 Ga0495645_0000492
662 Ga0495667_0005180
663 Ga0495635_0024036
664 Ga0495659_0000033
665 Ga0495657_0039421
666 Ga0495657_0089192
667 Ga0495599_0000384
668 Ga0495599_0003891
669 Ga0495599_0035329
670 Ga0495658_0018238
671 Ga0495613_0111712
672 Ga0495671_0000651
673 Ga0495660_0002258
674 Ga0495604_0113402
675 Ga0495636_0007479
676 Ga0495674_0006517
677 Ga0495672_0000191
678 Ga0495675_0045806
679 Ga0495675_0092907
680 Ga0495684_0086599
681 Ga0495686_0004325
682 Ga0496100_0049052
683 Ga0496102_0159431
684 Ga0496108_0070193
685 Ga0496114_0003464
686 Ga0496114_0038386
687 Ga0496121_0002132
688 Ga0496125_0004737
689 Ga0496125_0033201
690 Ga0501300_000671
691 Ga0501031_0001459
692 Ga0501031_0010586
693 Ga0501031_0121360
694 Ga0501032_0001298
695 Ga0501032_0003220
696 Ga0501032_0040131
697 Ga0501033_0000449
698 Ga0501033_0005135
699 Ga0501033_0054486
700 Ga0501034_0000468
701 Ga0501034_0120793
702 Ga0501034_0245575
703 Ga0501036_0005463
704 Ga0501036_0011502
705 Ga0501036_0016514
706 Ga0501036_0143567
707 Ga0501038_0001163
708 Ga0501038_0005649
709 Ga0501038_0006960
710 Ga0501038_0011367
711 Ga0501039_0004546
712 Ga0501039_0017095
713 Ga0501040_0001956
714 Ga0501040_0045339
715 Ga0501041_0001264
716 Ga0501041_0001454
717 Ga0501042_0017731
718 Ga0501042_0024994
719 Ga0501043_0016321
720 Ga0501043_0020123
721 Ga0501043_0024650
722 Ga0501046_0018947
723 Ga0501046_0023722
724 Ga0501047_0031683
725 Ga0501047_0091995
726 Ga0501068_0022251
727 Ga0501069_0007469
728 Ga0501070_0003987
729 Ga0501070_0027900
730 Ga0501071_0002060
731 Ga0501071_0048874
732 Ga0501072_0001788
733 Ga0501072_0009780
734 Ga0501072_0010208
735 Ga0501072_0106532
736 Ga0501074_0001669
737 Ga0501074_0032716
738 Ga0501075_0015085
739 Ga0501075_0116798
740 Ga0501079_0006498
741 Ga0501080_0004253
742 Ga0501080_0019617
743 Ga0501080_0041935
744 Ga0501081_0000666
745 Ga0501081_0004893
746 Ga0501081_0062128
747 Ga0501280_001077
748 Ga0501035_0003619
749 Ga0501035_0028163
750 Ga0501035_0066237
751 Ga0501044_0001550
752 Ga0501044_0008143
753 Ga0501044_0024653
754 Ga0501044_0037554
755 Ga0501044_0100919
756 Ga0501045_0001496
757 Ga0501045_0013620
758 nmdc:mga03683_29503_c1
759 nmdc:mga03n38_36228_c1
760 nmdc:mga0k408_494_c2
761 nmdc:mga0k408_7440_c1
762 nmdc:mga07m45_34681_c1
763 nmdc:mga09592_22501_c1
764 nmdc:mga09592_2766_c1
765 nmdc:mga0qj67_16335_c1
766 nmdc:mga06r32_41221_c1
767 nmdc:mga08y16_147136_c1
768 nmdc:mga08y16_203590_c1
769 nmdc:mga08y16_23197_c1
770 nmdc:mga08y16_266142_c1
771 nmdc:mga08y16_30892_c1
772 nmdc:mga0sz30_19554_c1
773 Ga0495601_0002935
774 Ga0495595_0015750
775 Ga0500588_0001389
776 Ga0500616_0058094
777 Ga0500622_0000001
778 Ga0500636_0003593
779 Ga0500637_0006058
780 Ga0500625_003478
781 Ga0501084_0043637
782 Ga0501082_0027784
783 Ga0530510_0002440
784 2526213113
785 2548846100
786 2574431022
787 2644221446
788 2644257800
789 2738740443
790 2881103771
791 2891634697
792 2932426232
793 2939632305
794 639786182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13537

GATase_7

Glutamine amidotransferase domain

90

230

0.91

PF00156

Pribosyltran

Phosphoribosyl transferase domain

285

411

0.87

PF13522

GATase_6

Glutamine amidotransferase domain

68

224

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8w7d-assembly1.cif.gz_B crystal structure of ecppat-fr901483 complex 0.9559 2 477
8w7d-assembly1.cif.gz_D crystal structure of ecppat-fr901483 complex 0.9556 2 478
1ecb-assembly2.cif.gz_D escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 gmp, 1 mg per subunit 0.9528 2 479
8w7d-assembly1.cif.gz_D crystal structure of ecppat-fr901483 complex 0.9516 2 478
8w7d-assembly1.cif.gz_B crystal structure of ecppat-fr901483 complex 0.95 2 477
ID Description Score Start End Superfamily
1ecfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9859 276 443 3.40.50.2020
af_A0A1D8PE37_2_277_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9748 2 270 3.60.20.10
af_P87171_221_328_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9692 357 393 3.40.50.2020
1ecfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9647 276 443 3.40.50.2020
af_P0A717_198_307_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9576 357 393 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A539DZ92-F1-model_v4 Amidophosphoribosyltransferase 0.9891 1 236 GO:0016757
AF-A0A3D4TTE0-F1-model_v4 Amidophosphoribosyltransferase 0.9886 108 236 GO:0016757
AF-A0A1B8P3J0-F1-model_v4 Amidophosphoribosyltransferase (EC 2.4.2.14) 0.9854 1 225 GO:0004044
AF-A0A539DZ92-F1-model_v4 Amidophosphoribosyltransferase 0.9849 1 236 GO:0016757
AF-A0A356PKH4-F1-model_v4 deleted 0.9834 1 221

Map