metagRoot

F433772

General Info

Members	Datasets	Scaffolds	Average Seq Length
397	255	397	208

Family's Representative Sequence

Representative Sequence	3300013307\|Ga0157372_10336275\|Ga0157372_103362752
Length	234
Sequence	VTHRVGDATVFSVIGSRRTAGLGREGGEMGKRDHWERIYSSKDASEVSWYQAEATMSLELIRRVAPDPSSPIIDVGGGASTLVDGLLDAGYRDVTVLDLSAAALDVARQRLGDRASQVKWVAADVLRTPFVSGGFAVWHDRAVFHFLTEQADRDRYVAQARAAVRPGGHIIVASFAPEGPERCSGLEVVRYSPDTMQAQFGADFHLLDSRREEHHTPSGATQAFVYCLCRVEGT

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
3	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
4	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
5	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
6	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
9	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
10	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
11	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
12	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
13	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
14	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
15	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
16	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
17	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
18	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
19	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
20	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
21	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
22	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
23	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
24	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
25	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
26	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
27	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
28	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
29	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
30	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
31	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
32	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
33	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
34	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
35	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
36	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
37	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
38	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
39	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
40	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
41	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
42	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
43	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
44	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
45	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
46	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
47	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
48	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
49	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
50	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
51	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
52	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
53	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
54	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
55	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
56	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
57	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
58	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
59	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
60	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
61	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
62	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
63	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
64	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
65	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
66	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
68	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
69	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
70	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
71	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
72	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
73	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
75	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
76	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
77	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
79	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
81	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
82	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
83	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
84	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
85	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
86	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
87	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
88	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
89	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
90	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
91	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
92	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
93	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
94	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
95	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
96	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
97	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
98	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
99	3300022732	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1	Metagenome	Rhizosphere
100	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
101	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
148	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
152	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
153	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
154	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
155	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
156	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
157	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
158	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
159	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
160	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
161	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
162	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
163	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
164	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
165	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
166	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
167	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
168	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
169	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
170	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
171	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
172	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
173	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
174	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
175	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
176	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
177	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
178	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
179	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
180	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
181	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
182	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
183	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
184	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
185	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
186	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
187	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
188	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
189	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
190	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
191	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
192	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
193	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
194	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
195	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
196	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
197	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
198	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
199	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
200	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
201	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
202	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
203	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
204	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
205	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
206	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
207	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
208	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
209	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
210	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
211	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
212	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
213	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
214	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
215	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
216	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
217	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
218	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
219	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
220	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
221	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
222	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
223	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
224	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
225	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
226	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
227	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
228	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
229	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
230	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
231	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
232	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
233	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
234	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
235	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
236	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
237	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
238	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
239	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
240	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
241	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
242	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
243	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
244	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
245	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
246	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
247	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
248	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
249	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
250	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
251	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
252	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
253	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
254	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
255	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.79
Nodule	0
Rhizoplane	2.52
Rhizosphere	91.94
Stem	0
Stem Tuber	0
Unclassified	0.76

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_9459043	2162886012	Bacteria	1017
2	Ga0065704_10004939	3300005289	Bacteria	4076
3	Ga0065715_10105905	3300005293	Unclassified	2864
4	Ga0065707_10132833	3300005295	Unclassified	1891
5	Ga0070658_10248575	3300005327	Bacteria	1508
6	Ga0070676_10419836	3300005328	Bacteria	934
7	Ga0070683_100027290	3300005329	Bacteria	5148
8	Ga0070670_100032087	3300005331	Bacteria	4523
9	Ga0070670_100276474	3300005331	Bacteria	1466
10	Ga0070670_100306244	3300005331	Bacteria	1390
11	Ga0070677_10027791	3300005333	Bacteria	2132
12	Ga0068869_100581439	3300005334	Unclassified	944
13	Ga0070680_100409501	3300005336	Bacteria	1156
14	Ga0070682_100139356	3300005337	Bacteria	1652
15	Ga0070660_100053441	3300005339	Bacteria	3115
16	Ga0070660_100218301	3300005339	Bacteria	1549
17	Ga0070689_100021187	3300005340	Bacteria	4833
18	Ga0070687_100456597	3300005343	Bacteria	851
19	Ga0070661_100027101	3300005344	Bacteria	4125
20	Ga0070661_100205640	3300005344	Bacteria	1505
21	Ga0070668_100013512	3300005347	Bacteria	6094
22	Ga0070668_100039156	3300005347	Bacteria	3626
23	Ga0070669_100003543	3300005353	Bacteria	11256
24	Ga0070669_100005592	3300005353	Bacteria	9080
25	Ga0070669_100025915	3300005353	Bacteria	4216
26	Ga0070675_100549448	3300005354	Unclassified	1044
27	Ga0070671_100157175	3300005355	Bacteria	1921
28	Ga0070673_100568473	3300005364	Bacteria	1031
29	Ga0070659_100210213	3300005366	Bacteria	1603
30	Ga0070659_100268650	3300005366	Bacteria	1416
31	Ga0070667_100027687	3300005367	Bacteria	4716
32	Ga0070667_100402676	3300005367	Bacteria	1246
33	Ga0070667_100509156	3300005367	Bacteria	1104
34	Ga0070703_10000474	3300005406	Bacteria	15950
35	Ga0070710_10615692	3300005437	Archaea	757
36	Ga0070701_10084718	3300005438	Bacteria	1724
37	Ga0070701_10485428	3300005438	Unclassified	799
38	Ga0070711_100108555	3300005439	Unclassified	2033
39	Ga0070705_100458143	3300005440	Bacteria	958
40	Ga0070705_100460448	3300005440	Unclassified	956
41	Ga0070700_100016801	3300005441	Bacteria	4173
42	Ga0070694_100067573	3300005444	Unclassified	2454
43	Ga0070708_100011201	3300005445	Bacteria	7293
44	Ga0070662_100054729	3300005457	Bacteria	2892
45	Ga0070662_100171651	3300005457	Bacteria	1703
46	Ga0070681_10652620	3300005458	Bacteria	967
47	Ga0068867_100049332	3300005459	Bacteria	3099
48	Ga0068867_100318664	3300005459	Unclassified	1287
49	Ga0070685_10152876	3300005466	Bacteria	1464
50	Ga0070706_100007978	3300005467	Bacteria	9877
51	Ga0070706_100142749	3300005467	Bacteria	2235
52	Ga0070707_100016673	3300005468	Bacteria	6896
53	Ga0070698_100043517	3300005471	Bacteria	4603
54	Ga0070698_100059262	3300005471	Bacteria	3867
55	Ga0070698_100061563	3300005471	Bacteria	3788
56	Ga0070698_100062875	3300005471	Bacteria	3744
57	Ga0070699_100537813	3300005518	Bacteria	1063
58	Ga0070684_100009877	3300005535	Bacteria	7540
59	Ga0070684_100483356	3300005535	Bacteria	1146
60	Ga0068853_100098778	3300005539	Bacteria	2578
61	Ga0070672_100064859	3300005543	Bacteria	2887
62	Ga0070672_100075530	3300005543	Unclassified	2690
63	Ga0070672_100094576	3300005543	Bacteria	2416
64	Ga0070686_100222716	3300005544	Bacteria	1364
65	Ga0070665_100056620	3300005548	Bacteria	3931
66	Ga0070704_100213477	3300005549	Bacteria	1565
67	Ga0070664_100034249	3300005564	Bacteria	4259
68	Ga0070664_100038619	3300005564	Bacteria	4020
69	Ga0070664_100170985	3300005564	Bacteria	1928
70	Ga0068857_100017311	3300005577	Bacteria	6314
71	Ga0068857_100042892	3300005577	Bacteria	4013
72	Ga0068857_100050595	3300005577	Bacteria	3685
73	Ga0068857_100057442	3300005577	Bacteria	3454
74	Ga0068854_100177019	3300005578	Unclassified	1664
75	Ga0068856_100123519	3300005614	Bacteria	2591
76	Ga0068859_100156483	3300005617	Unclassified	2356
77	Ga0068859_100609984	3300005617	Bacteria	1184
78	Ga0068864_100011116	3300005618	Bacteria	7440
79	Ga0068864_100058585	3300005618	Bacteria	3329
80	Ga0068864_100119039	3300005618	Unclassified	2359
81	Ga0068864_100343966	3300005618	Bacteria	1406
82	Ga0068864_100782300	3300005618	Bacteria	937
83	Ga0068861_100014639	3300005719	Bacteria	5508
84	Ga0068861_100324782	3300005719	Bacteria	1341
85	Ga0068870_10016790	3300005840	Unclassified	3506
86	Ga0068870_10025673	3300005840	Bacteria	2927
87	Ga0068870_10242653	3300005840	Bacteria	1113
88	Ga0068863_100078959	3300005841	Bacteria	3117
89	Ga0068863_100084633	3300005841	Bacteria	3005
90	Ga0068863_100179805	3300005841	Unclassified	2030
91	Ga0068858_100034548	3300005842	Plasmid	4690
92	Ga0068858_100186209	3300005842	Bacteria	1961
93	Ga0068860_100176823	3300005843	Bacteria	2063
94	Ga0068860_100205810	3300005843	Bacteria	1908
95	Ga0068860_100484723	3300005843	Bacteria	1233
96	Ga0068862_100004111	3300005844	Bacteria	12337
97	Ga0068862_100011633	3300005844	Bacteria	7261
98	Ga0068862_100134697	3300005844	Unclassified	2188
99	Ga0075368_10004568	3300006042	Bacteria	4702
100	Ga0075363_100142871	3300006048	Unclassified	1348
101	Ga0075364_10020619	3300006051	Bacteria	4147
102	Ga0070716_100320236	3300006173	Bacteria	1086
103	Ga0075362_10047265	3300006177	Bacteria	1916
104	Ga0075367_10020858	3300006178	Bacteria	3655
105	Ga0075369_10298083	3300006186	Unclassified	752
106	Ga0075366_10072867	3300006195	Bacteria	2047
107	Ga0097621_100041223	3300006237	Bacteria	3716
108	Ga0075370_10025142	3300006353	Bacteria	3292
109	Ga0075428_100249356	3300006844	Bacteria	1914
110	Ga0075428_100328391	3300006844	Bacteria	1643
111	Ga0075428_100718527	3300006844	Unclassified	1064
112	Ga0075431_100047061	3300006847	Bacteria	4447
113	Ga0075431_100266333	3300006847	Bacteria	1738
114	Ga0075433_10011442	3300006852	Bacteria	7146
115	Ga0075434_100016288	3300006871	Bacteria	7145
116	Ga0075429_100194129	3300006880	Bacteria	1778
117	Ga0075429_100529202	3300006880	Unclassified	1033
118	Ga0075429_100796862	3300006880	Unclassified	827
119	Ga0097620_100156477	3300006931	Unclassified	2356
120	Ga0097620_100609989	3300006931	Bacteria	1184
121	Ga0075435_100368877	3300007076	Bacteria	1232
122	Ga0099794_10065558	3300007265	Unclassified	1771
123	Ga0105240_10033189	3300009093	Bacteria	6672
124	Ga0111539_10205817	3300009094	Bacteria	2294
125	Ga0105245_10135665	3300009098	Bacteria	2313
126	Ga0114129_10015942	3300009147	Bacteria	10687
127	Ga0114129_10237616	3300009147	Bacteria	2451
128	Ga0114129_10730625	3300009147	Unclassified	1269
129	Ga0114129_10736559	3300009147	Bacteria	1263
130	Ga0105243_10087333	3300009148	Bacteria	2560
131	Ga0105243_10804468	3300009148	Unclassified	927
132	Ga0105242_10259732	3300009176	Bacteria	1568
133	Ga0105248_10133726	3300009177	Bacteria	2798
134	Ga0105248_10407796	3300009177	Bacteria	1530
135	Ga0105249_10000466	3300009553	Bacteria	37670
136	Ga0105249_10080055	3300009553	Bacteria	3035
137	Ga0105246_10001932	3300011119	Bacteria	12504
138	Ga0157373_10120920	3300013100	Bacteria	1841
139	Ga0157373_10586403	3300013100	Unclassified	811
140	Ga0157371_10085665	3300013102	Unclassified	2232
141	Ga0157370_10058509	3300013104	Bacteria	3663
142	Ga0157369_10151565	3300013105	Bacteria	2450
143	Ga0157369_10308413	3300013105	Bacteria	1646
144	Ga0157374_10343044	3300013296	Unclassified	1483
145	Ga0163162_10177467	3300013306	Bacteria	2256
146	Ga0157372_10336275	3300013307	Bacteria	1759
147	Ga0157372_10361961	3300013307	Bacteria	1690
148	Ga0157372_10385371	3300013307	Bacteria	1633
149	Ga0157375_10074375	3300013308	Unclassified	3419
150	Ga0157375_10081244	3300013308	Unclassified	3281
151	Ga0163163_10080936	3300014325	Bacteria	3249
152	Ga0157380_10009481	3300014326	Bacteria	6977
153	Ga0157377_10030384	3300014745	Unclassified	2927
154	Ga0157379_10025884	3300014968	Bacteria	5217
155	Ga0157379_10502059	3300014968	Unclassified	1124
156	Ga0157376_10007759	3300014969	Bacteria	7692
157	Ga0157376_10036280	3300014969	Bacteria	3994
158	Ga0163161_10023677	3300017792	Bacteria	4334
159	Ga0163161_10121226	3300017792	Bacteria	1965
160	Ga0224569_100714	3300022732	Bacteria	2837
161	Ga0228598_1019255	3300024227	Bacteria	1345
162	Ga0207697_10008630	3300025315	Bacteria	4445
163	Ga0207656_10009228	3300025321	Bacteria	3659
164	Ga0207653_10000002	3300025885	Bacteria	270513
165	Ga0207682_10005533	3300025893	Bacteria	5143
166	Ga0207692_10311609	3300025898	Unclassified	961
167	Ga0207688_10030329	3300025901	Bacteria	2981
168	Ga0207680_10085153	3300025903	Bacteria	1996
169	Ga0207647_10200573	3300025904	Bacteria	1154
170	Ga0207645_10062866	3300025907	Bacteria	2372
171	Ga0207643_10008259	3300025908	Bacteria	5589
172	Ga0207643_10010918	3300025908	Bacteria	4899
173	Ga0207643_10011287	3300025908	Bacteria	4825
174	Ga0207705_10190060	3300025909	Bacteria	1552
175	Ga0207705_10193303	3300025909	Bacteria	1540
176	Ga0207684_10004572	3300025910	Bacteria	13003
177	Ga0207684_10201047	3300025910	Unclassified	1719
178	Ga0207707_10911238	3300025912	Bacteria	726
179	Ga0207663_10152023	3300025916	Unclassified	1625
180	Ga0207660_10396705	3300025917	Bacteria	1111
181	Ga0207657_10005496	3300025919	Bacteria	13232
182	Ga0207657_10465327	3300025919	Bacteria	992
183	Ga0207649_10018994	3300025920	Bacteria	3923
184	Ga0207649_10137895	3300025920	Bacteria	1665
185	Ga0207649_10242067	3300025920	Bacteria	1295
186	Ga0207646_10016517	3300025922	Bacteria	6926
187	Ga0207646_10159653	3300025922	Bacteria	2034
188	Ga0207646_10683566	3300025922	Unclassified	918
189	Ga0207681_10020336	3300025923	Bacteria	4204
190	Ga0207681_10045350	3300025923	Bacteria	2951
191	Ga0207681_10068549	3300025923	Bacteria	2464
192	Ga0207650_10017406	3300025925	Bacteria	5032
193	Ga0207650_10067508	3300025925	Bacteria	2684
194	Ga0207659_10189824	3300025926	Bacteria	1634
195	Ga0207687_10783266	3300025927	Bacteria	813
196	Ga0207644_10283804	3300025931	Bacteria	1330
197	Ga0207644_10450675	3300025931	Unclassified	1057
198	Ga0207690_10080474	3300025932	Bacteria	2273
199	Ga0207690_10185902	3300025932	Unclassified	1568
200	Ga0207706_10004779	3300025933	Bacteria	12685
201	Ga0207706_10036267	3300025933	Unclassified	4381
202	Ga0207686_10069599	3300025934	Bacteria	2258
203	Ga0207691_10013811	3300025940	Bacteria	7713
204	Ga0207691_10019008	3300025940	Bacteria	6507
205	Ga0207691_10084159	3300025940	Bacteria	2856
206	Ga0207711_10108243	3300025941	Bacteria	2469
207	Ga0207661_10087818	3300025944	Bacteria	2583
208	Ga0207679_10118686	3300025945	Bacteria	2101
209	Ga0207679_10407952	3300025945	Bacteria	1196
210	Ga0207651_10059224	3300025960	Bacteria	2651
211	Ga0207712_10000904	3300025961	Bacteria	21477
212	Ga0207668_10036080	3300025972	Bacteria	3298
213	Ga0207668_10060096	3300025972	Bacteria	2666
214	Ga0207677_10127450	3300026023	Bacteria	1926
215	Ga0207703_10043505	3300026035	Bacteria	3605
216	Ga0207703_10257656	3300026035	Bacteria	1575
217	Ga0207639_10186327	3300026041	Bacteria	1769
218	Ga0207639_10430085	3300026041	Bacteria	1195
219	Ga0207678_10317753	3300026067	Bacteria	1339
220	Ga0207702_10004539	3300026078	Bacteria	12304
221	Ga0207641_10175097	3300026088	Unclassified	1961
222	Ga0207641_10521694	3300026088	Bacteria	1156
223	Ga0207641_10642956	3300026088	Bacteria	1041
224	Ga0207641_10835891	3300026088	Bacteria	912
225	Ga0207648_10026450	3300026089	Bacteria	5155
226	Ga0207648_10314631	3300026089	Bacteria	1406
227	Ga0207676_10373856	3300026095	Unclassified	1325
228	Ga0207674_10004248	3300026116	Bacteria	17277
229	Ga0207674_10006644	3300026116	Bacteria	13587
230	Ga0207674_10016442	3300026116	Bacteria	8099
231	Ga0207674_10047100	3300026116	Bacteria	4423
232	Ga0207674_10064100	3300026116	Unclassified	3707
233	Ga0207675_100015476	3300026118	Bacteria	7115
234	Ga0207675_100293232	3300026118	Bacteria	1583
235	Ga0207683_10032805	3300026121	Unclassified	4511
236	Ga0207683_10077424	3300026121	Bacteria	2945
237	Ga0207698_10416022	3300026142	Bacteria	1289
238	Ga0209588_1001287	3300027671	Bacteria	6511
239	Ga0209813_10006070	3300027866	Bacteria	2966
240	Ga0268266_10061832	3300028379	Bacteria	3230
241	Ga0268265_10001860	3300028380	Bacteria	16832
242	Ga0268265_11040137	3300028380	Bacteria	810
243	Ga0268264_10496737	3300028381	Bacteria	1189
244	Ga0307408_100001303	3300031548	Bacteria	18682
245	Ga0307508_10030006	3300031616	Bacteria	4914
246	Ga0307413_10659231	3300031824	Unclassified	864
247	Ga0307406_10003012	3300031901	Bacteria	9165
248	Ga0307416_100234586	3300032002	Bacteria	1772
249	Ga0307411_11139123	3300032005	Bacteria	705
250	Ga0307415_100033274	3300032126	Bacteria	3346
251	Ga0373950_0000011	3300034818	Bacteria	365678
252	Ga0373944_0070416	3300035089	Unclassified	1138
253	Ga0373949_0092722	3300035090	Bacteria	819
254	Ga0373954_0109904	3300035118	Bacteria	1333
255	Ga0373956_0020400	3300035119	Bacteria	2820
256	Ga0373957_0033485	3300035120	Bacteria	1898
257	Ga0373943_0012983	3300035170	Unclassified	3757
258	Ga0373943_0038401	3300035170	Bacteria	2302
259	Ga0373946_0051608	3300035171	Bacteria	1722
260	Ga0373955_0061244	3300035172	Bacteria	2078
261	Ga0373955_0096250	3300035172	Unclassified	1694
262	Ga0373924_0082063	3300035410	Bacteria	1372
263	Ga0373931_0004827	3300035691	Bacteria	6191
264	Ga0373935_0107628	3300035692	Unclassified	1846
265	Ga0373935_0376192	3300035692	Bacteria	1016
266	Ga0373927_0092869	3300035695	Unclassified	1960
267	Ga0373927_0125793	3300035695	Bacteria	1673
268	Ga0373933_0019825	3300035724	Bacteria	3806
269	Ga0373947_0066518	3300035725	Bacteria	2200
270	Ga0373937_0006892	3300036401	Bacteria	9805
271	Ga0373937_0047716	3300036401	Bacteria	3919
272	Ga0373937_0395029	3300036401	Bacteria	1312
273	Ga0373937_0772777	3300036401	Unclassified	908
274	Ga0373925_0054259	3300037068	Bacteria	2997
275	Ga0373925_0217252	3300037068	Bacteria	1525
276	Ga0373925_0351550	3300037068	Bacteria	1197
277	Ga0395905_1045576	3300037471	Bacteria	720
278	Ga0436363_0592779	3300039450	Bacteria	6175
279	Ga0451577_0004301	3300042876	Bacteria	15123
280	Ga0451577_0062101	3300042876	Bacteria	3332
281	Ga0453683_0109736	3300044673	Bacteria	1735
282	Ga0453684_0011863	3300044712	Bacteria	14515
283	Ga0451576_0108945	3300045051	Bacteria	2882
284	Ga0451576_0598901	3300045051	Bacteria	1158
285	Ga0495603_0001135	3300046455	Bacteria	15544
286	Ga0495629_0000122	3300046459	Bacteria	69528
287	Ga0495629_0011698	3300046459	Bacteria	6368
288	Ga0495629_0034698	3300046459	Bacteria	3566
289	Ga0495641_0053658	3300046461	Bacteria	1833
290	Ga0495651_0058693	3300046462	Bacteria	2952
291	Ga0495653_0003319	3300046463	Bacteria	12924
292	Ga0495653_0006340	3300046463	Bacteria	9707
293	Ga0495580_0000715	3300046472	Bacteria	28331
294	Ga0495580_0089143	3300046472	Bacteria	2147
295	Ga0495580_0109134	3300046472	Unclassified	1921
296	Ga0495582_0011392	3300046473	Bacteria	4899
297	Ga0495582_0118301	3300046473	Bacteria	1491
298	Ga0495662_0182856	3300046476	Unclassified	1033
299	Ga0495664_0297835	3300046477	Bacteria	974
300	Ga0495594_0281771	3300046499	Unclassified	947
301	Ga0495618_0175195	3300046514	Bacteria	1364
302	Ga0495628_0010274	3300046516	Bacteria	7959
303	Ga0495628_0059802	3300046516	Bacteria	2990
304	Ga0495628_0724972	3300046516	Unclassified	700
305	Ga0495630_0054501	3300046517	Bacteria	2996
306	Ga0495648_0001675	3300046524	Bacteria	21443
307	Ga0495648_0025083	3300046524	Bacteria	4044
308	Ga0495666_0013753	3300046526	Bacteria	4034
309	Ga0495652_0010241	3300046529	Bacteria	8500
310	Ga0495652_0024809	3300046529	Bacteria	5306
311	Ga0495665_0001166	3300046531	Bacteria	13986
312	Ga0495586_0007536	3300046535	Bacteria	5807
313	Ga0495587_0001128	3300046536	Bacteria	17458
314	Ga0495587_0020908	3300046536	Bacteria	4037
315	Ga0495645_0005108	3300046543	Bacteria	8994
316	Ga0495645_0038991	3300046543	Bacteria	3465
317	Ga0495645_0101703	3300046543	Unclassified	2043
318	Ga0495667_0012894	3300046559	Bacteria	5665
319	Ga0495634_0001741	3300046642	Bacteria	18849
320	Ga0495635_0015231	3300046663	Bacteria	5381
321	Ga0495661_0009542	3300046665	Bacteria	6656
322	Ga0495657_0094458	3300046675	Bacteria	1913
323	Ga0495599_0026001	3300046678	Bacteria	3667
324	Ga0495599_0058783	3300046678	Bacteria	2405
325	Ga0495623_0005259	3300046679	Bacteria	8489
326	Ga0495623_0153484	3300046679	Bacteria	1359
327	Ga0495646_0025730	3300046680	Bacteria	3700
328	Ga0495646_0046483	3300046680	Bacteria	2646
329	Ga0495647_0031740	3300046681	Bacteria	1965
330	Ga0495658_0005238	3300046683	Bacteria	6381
331	Ga0495658_0007864	3300046683	Bacteria	5279
332	Ga0495658_0109708	3300046683	Bacteria	1658
333	Ga0495613_0004062	3300046689	Bacteria	10947
334	Ga0495613_0058495	3300046689	Bacteria	2828
335	Ga0495624_0000382	3300046690	Bacteria	35223
336	Ga0495624_0036701	3300046690	Bacteria	3157
337	Ga0495624_0294066	3300046690	Unclassified	980
338	Ga0495600_0099414	3300046809	Unclassified	1896
339	Ga0495581_0005321	3300047315	Bacteria	7442
340	Ga0495581_0019229	3300047315	Bacteria	3964
341	Ga0495604_0010616	3300047317	Bacteria	7304
342	Ga0495674_0017220	3300047319	Bacteria	6725
343	Ga0495674_0021441	3300047319	Bacteria	5977
344	Ga0495676_0048784	3300047321	Bacteria	3410
345	Ga0495680_0004181	3300047322	Bacteria	13872
346	Ga0495680_0513693	3300047322	Unclassified	812
347	Ga0495675_0015913	3300047444	Bacteria	4756
348	Ga0495675_0087346	3300047444	Bacteria	1959
349	Ga0495679_000678	3300047446	Bacteria	22351
350	Ga0495684_0074342	3300047471	Bacteria	2582
351	Ga0495593_0012668	3300047673	Bacteria	4816
352	Ga0495593_0033937	3300047673	Bacteria	2777
353	Ga0495602_0013128	3300048088	Bacteria	8474
354	Ga0495614_0001682	3300048089	Bacteria	9652
355	Ga0495614_0117350	3300048089	Unclassified	1172
356	Ga0496100_0194097	3300048903	Bacteria	1476
357	Ga0496101_0259933	3300048904	Bacteria	1354
358	Ga0496102_1160023	3300048905	Bacteria	692
359	Ga0496104_0534470	3300048907	Unclassified	1083
360	Ga0496108_0279866	3300048911	Bacteria	1452
361	Ga0496109_1137855	3300048912	Unclassified	717
362	Ga0496110_0282345	3300048913	Bacteria	1512
363	Ga0496110_0385980	3300048913	Unclassified	1276
364	Ga0496112_0091911	3300048915	Bacteria	3004
365	Ga0496114_0796538	3300048917	Unclassified	824
366	Ga0496122_0138535	3300048925	Bacteria	1528
367	Ga0501067_0000009	3300049583	Bacteria	123458
368	Ga0501067_0000846	3300049583	Bacteria	16500
369	Ga0501073_0000114	3300049589	Bacteria	51521
370	Ga0501073_0001731	3300049589	Bacteria	16220
371	nmdc:mga03683_7482_c1	3300050489	Bacteria	3792
372	nmdc:mga03n38_32170_c1	3300050490	Bacteria	2220
373	nmdc:mga00v17_21057_c1	3300050491	Bacteria	3745
374	nmdc:mga0yw44_34111_c1	3300050492	Bacteria	2980
375	nmdc:mga0k408_105514_c1	3300050493	Bacteria	1664
376	nmdc:mga0k408_86321_c1	3300050493	Bacteria	1842
377	nmdc:mga06z11_12032_c1	3300050494	Bacteria	3752
378	nmdc:mga04h51_3298_c1	3300050495	Bacteria	3910
379	nmdc:mga07m45_18708_c1	3300050496	Bacteria	3435
380	nmdc:mga05p37_25892_c1	3300050507	Bacteria	7131
381	nmdc:mga05p37_381349_c1	3300050507	Bacteria	1652
382	nmdc:mga05p37_453064_c1	3300050507	Bacteria	1484
383	nmdc:mga09592_283415_c1	3300050508	Bacteria	1437
384	nmdc:mga06r32_435898_c1	3300050510	Bacteria	1291
385	nmdc:mga06r32_439212_c1	3300050510	Unclassified	1285
386	nmdc:mga06r32_5084_c1	3300050510	Bacteria	11837
387	nmdc:mga08y16_173538_c1	3300050511	Bacteria	2239
388	nmdc:mga08y16_350300_c1	3300050511	Bacteria	1517
389	nmdc:mga0n895_670080_c1	3300050512	Unclassified	1035
390	nmdc:mga0n895_8411_c1	3300050512	Bacteria	8931
391	nmdc:mga0a205_5325_c1	3300050515	Bacteria	11591
392	nmdc:mga0a205_654461_c1	3300050515	Bacteria	902
393	nmdc:mga0sz30_94670_c1	3300050516	Unclassified	1302
394	Ga0495601_0082200	3300053077	Bacteria	2068
395	Ga0495595_0016674	3300053084	Unclassified	3149
396	Ga0590071_003370	3300059421	Bacteria	3933
397	Ga0590074_003101	3300059423	Bacteria	2742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048912	Ga0496109_1137855	Ga0496109_1137855_13_570	176
2	3300048913	Ga0496110_0385980	Ga0496110_0385980_26_583	176
3	3300005331	Ga0070670_100032087	Ga0070670_1000320875	177
4	3300005367	Ga0070667_100027687	Ga0070667_1000276874	177
5	3300013296	Ga0157374_10343044	Ga0157374_103430443	177
6	3300014968	Ga0157379_10025884	Ga0157379_100258843	177
7	3300025321	Ga0207656_10009228	Ga0207656_100092286	177
8	3300025903	Ga0207680_10085153	Ga0207680_100851532	177
9	3300025908	Ga0207643_10011287	Ga0207643_100112872	177
10	3300026023	Ga0207677_10127450	Ga0207677_101274502	177
11	3300028379	Ga0268266_10061832	Ga0268266_100618324	177
12	3300048905	Ga0496102_1160023	Ga0496102_1160023_44_604	177
13	3300035089	Ga0373944_0070416	Ga0373944_0070416_569_1120	179
14	3300035119	Ga0373956_0020400	Ga0373956_0020400_24_575	179
15	3300035171	Ga0373946_0051608	Ga0373946_0051608_47_598	179
16	3300046690	Ga0495624_0294066	Ga0495624_0294066_402_953	179
17	3300013102	Ga0157371_10085665	Ga0157371_100856653	181
18	3300007265	Ga0099794_10065558	Ga0099794_100655583	182
19	3300005327	Ga0070658_10248575	Ga0070658_102485752	186
20	3300005329	Ga0070683_100027290	Ga0070683_1000272905	186
21	3300005331	Ga0070670_100276474	Ga0070670_1002764741	186
22	3300005337	Ga0070682_100139356	Ga0070682_1001393562	186
23	3300005339	Ga0070660_100053441	Ga0070660_1000534414	186
24	3300005344	Ga0070661_100205640	Ga0070661_1002056402	186
25	3300005366	Ga0070659_100210213	Ga0070659_1002102132	186
26	3300005458	Ga0070681_10652620	Ga0070681_106526201	186
27	3300005535	Ga0070684_100009877	Ga0070684_1000098775	186
28	3300005564	Ga0070664_100034249	Ga0070664_1000342491	186
29	3300005577	Ga0068857_100057442	Ga0068857_1000574423	186
30	3300005618	Ga0068864_100782300	Ga0068864_1007823001	186
31	3300013100	Ga0157373_10120920	Ga0157373_101209202	186
32	3300013105	Ga0157369_10308413	Ga0157369_103084132	186
33	3300014325	Ga0163163_10080936	Ga0163163_100809364	186
34	3300025909	Ga0207705_10190060	Ga0207705_101900602	186
35	3300025912	Ga0207707_10911238	Ga0207707_109112381	186
36	3300025919	Ga0207657_10465327	Ga0207657_104653271	186
37	3300025920	Ga0207649_10242067	Ga0207649_102420671	186
38	3300025925	Ga0207650_10067508	Ga0207650_100675082	186
39	3300025932	Ga0207690_10080474	Ga0207690_100804742	186
40	3300025944	Ga0207661_10087818	Ga0207661_100878182	186
41	3300026088	Ga0207641_10835891	Ga0207641_108358912	186
42	3300026116	Ga0207674_10047100	Ga0207674_100471004	186
43	3300053077	Ga0495601_0082200	Ga0495601_0082200_24_584	186
44	3300005440	Ga0070705_100458143	Ga0070705_1004581431	190
45	3300005719	Ga0068861_100324782	Ga0068861_1003247822	190
46	3300005844	Ga0068862_100134697	Ga0068862_1001346973	190
47	3300009148	Ga0105243_10804468	Ga0105243_108044682	190
48	3300009553	Ga0105249_10080055	Ga0105249_100800555	190
49	3300025917	Ga0207660_10396705	Ga0207660_103967053	190
50	3300026118	Ga0207675_100293232	Ga0207675_1002932322	190
51	3300006173	Ga0070716_100320236	Ga0070716_1003202362	198
52	3300005614	Ga0068856_100123519	Ga0068856_1001235191	200
53	3300005841	Ga0068863_100078959	Ga0068863_1000789592	200
54	3300009147	Ga0114129_10730625	Ga0114129_107306252	200
55	3300026078	Ga0207702_10004539	Ga0207702_1000453915	200
56	3300026088	Ga0207641_10642956	Ga0207641_106429562	200
57	3300039450	Ga0436363_0592779	Ga0436363_0592779_1307_1939	201
58	3300005343	Ga0070687_100456597	Ga0070687_1004565971	202
59	3300005366	Ga0070659_100268650	Ga0070659_1002686502	202
60	3300005841	Ga0068863_100084633	Ga0068863_1000846332	202
61	3300025904	Ga0207647_10200573	Ga0207647_102005732	202
62	3300025926	Ga0207659_10189824	Ga0207659_101898241	202
63	3300025932	Ga0207690_10185902	Ga0207690_101859023	202
64	3300028380	Ga0268265_11040137	Ga0268265_110401372	202
65	3300048925	Ga0496122_0138535	Ga0496122_0138535_239_853	202
66	3300005406	Ga0070703_10000474	Ga0070703_100004743	203
67	3300005440	Ga0070705_100460448	Ga0070705_1004604481	203
68	3300005445	Ga0070708_100011201	Ga0070708_1000112019	203
69	3300005467	Ga0070706_100007978	Ga0070706_1000079787	203
70	3300005467	Ga0070706_100142749	Ga0070706_1001427492	203
71	3300005468	Ga0070707_100016673	Ga0070707_1000166737	203
72	3300005471	Ga0070698_100062875	Ga0070698_1000628753	203
73	3300025885	Ga0207653_10000002	Ga0207653_1000000241	203
74	3300025910	Ga0207684_10004572	Ga0207684_1000457213	203
75	3300025922	Ga0207646_10016517	Ga0207646_100165173	203
76	3300059421	Ga0590071_003370	Ga0590071_003370_380_994	203
77	3300059423	Ga0590074_003101	Ga0590074_003101_338_952	203
78	2162886012	MBSR1b_contig_9459043	MBSR1b_0833.00004490	204
79	3300005289	Ga0065704_10004939	Ga0065704_100049394	204
80	3300005293	Ga0065715_10105905	Ga0065715_101059053	204
81	3300005295	Ga0065707_10132833	Ga0065707_101328331	204
82	3300005328	Ga0070676_10419836	Ga0070676_104198361	204
83	3300005331	Ga0070670_100306244	Ga0070670_1003062442	204
84	3300005333	Ga0070677_10027791	Ga0070677_100277912	204
85	3300005334	Ga0068869_100581439	Ga0068869_1005814392	204
86	3300005336	Ga0070680_100409501	Ga0070680_1004095012	204
87	3300005339	Ga0070660_100218301	Ga0070660_1002183012	204
88	3300005340	Ga0070689_100021187	Ga0070689_1000211873	204
89	3300005344	Ga0070661_100027101	Ga0070661_1000271014	204
90	3300005347	Ga0070668_100013512	Ga0070668_1000135121	204
91	3300005347	Ga0070668_100039156	Ga0070668_1000391563	204
92	3300005353	Ga0070669_100003543	Ga0070669_10000354310	204
93	3300005353	Ga0070669_100005592	Ga0070669_1000055923	204
94	3300005353	Ga0070669_100025915	Ga0070669_1000259153	204
95	3300005354	Ga0070675_100549448	Ga0070675_1005494482	204
96	3300005355	Ga0070671_100157175	Ga0070671_1001571752	204
97	3300005364	Ga0070673_100568473	Ga0070673_1005684731	204
98	3300005367	Ga0070667_100402676	Ga0070667_1004026762	204
99	3300005367	Ga0070667_100509156	Ga0070667_1005091561	204
100	3300005437	Ga0070710_10615692	Ga0070710_106156921	204
101	3300005438	Ga0070701_10084718	Ga0070701_100847183	204
102	3300005438	Ga0070701_10485428	Ga0070701_104854282	204
103	3300005439	Ga0070711_100108555	Ga0070711_1001085552	204
104	3300005441	Ga0070700_100016801	Ga0070700_1000168013	204
105	3300005444	Ga0070694_100067573	Ga0070694_1000675733	204
106	3300005457	Ga0070662_100054729	Ga0070662_1000547295	204
107	3300005457	Ga0070662_100171651	Ga0070662_1001716513	204
108	3300005459	Ga0068867_100049332	Ga0068867_1000493323	204
109	3300005459	Ga0068867_100318664	Ga0068867_1003186642	204
110	3300005466	Ga0070685_10152876	Ga0070685_101528762	204
111	3300005471	Ga0070698_100043517	Ga0070698_1000435172	204
112	3300005471	Ga0070698_100059262	Ga0070698_1000592624	204
113	3300005471	Ga0070698_100061563	Ga0070698_1000615632	204
114	3300005518	Ga0070699_100537813	Ga0070699_1005378132	204
115	3300005535	Ga0070684_100483356	Ga0070684_1004833561	204
116	3300005539	Ga0068853_100098778	Ga0068853_1000987783	204
117	3300005543	Ga0070672_100064859	Ga0070672_1000648592	204
118	3300005543	Ga0070672_100075530	Ga0070672_1000755302	204
119	3300005543	Ga0070672_100094576	Ga0070672_1000945763	204
120	3300005544	Ga0070686_100222716	Ga0070686_1002227162	204
121	3300005548	Ga0070665_100056620	Ga0070665_1000566204	204
122	3300005549	Ga0070704_100213477	Ga0070704_1002134772	204
123	3300005564	Ga0070664_100038619	Ga0070664_1000386192	204
124	3300005564	Ga0070664_100170985	Ga0070664_1001709852	204
125	3300005577	Ga0068857_100017311	Ga0068857_1000173114	204
126	3300005577	Ga0068857_100042892	Ga0068857_1000428924	204
127	3300005577	Ga0068857_100050595	Ga0068857_1000505952	204
128	3300005578	Ga0068854_100177019	Ga0068854_1001770191	204
129	3300005617	Ga0068859_100156483	Ga0068859_1001564834	204
130	3300005617	Ga0068859_100609984	Ga0068859_1006099842	204
131	3300005618	Ga0068864_100011116	Ga0068864_1000111166	204
132	3300005618	Ga0068864_100058585	Ga0068864_1000585852	204
133	3300005618	Ga0068864_100119039	Ga0068864_1001190393	204
134	3300005618	Ga0068864_100343966	Ga0068864_1003439662	204
135	3300005719	Ga0068861_100014639	Ga0068861_1000146397	204
136	3300005840	Ga0068870_10016790	Ga0068870_100167903	204
137	3300005840	Ga0068870_10025673	Ga0068870_100256733	204
138	3300005840	Ga0068870_10242653	Ga0068870_102426532	204
139	3300005841	Ga0068863_100179805	Ga0068863_1001798053	204
140	3300005842	Ga0068858_100034548	Ga0068858_1000345483	204
141	3300005842	Ga0068858_100186209	Ga0068858_1001862092	204
142	3300005843	Ga0068860_100176823	Ga0068860_1001768233	204
143	3300005843	Ga0068860_100205810	Ga0068860_1002058103	204
144	3300005843	Ga0068860_100484723	Ga0068860_1004847232	204
145	3300005844	Ga0068862_100004111	Ga0068862_1000041114	204
146	3300005844	Ga0068862_100011633	Ga0068862_1000116332	204
147	3300006042	Ga0075368_10004568	Ga0075368_100045684	204
148	3300006048	Ga0075363_100142871	Ga0075363_1001428712	204
149	3300006051	Ga0075364_10020619	Ga0075364_100206192	204
150	3300006177	Ga0075362_10047265	Ga0075362_100472652	204
151	3300006178	Ga0075367_10020858	Ga0075367_100208586	204
152	3300006186	Ga0075369_10298083	Ga0075369_102980831	204
153	3300006195	Ga0075366_10072867	Ga0075366_100728673	204
154	3300006237	Ga0097621_100041223	Ga0097621_1000412235	204
155	3300006353	Ga0075370_10025142	Ga0075370_100251421	204
156	3300006844	Ga0075428_100249356	Ga0075428_1002493562	204
157	3300006844	Ga0075428_100328391	Ga0075428_1003283912	204
158	3300006844	Ga0075428_100718527	Ga0075428_1007185272	204
159	3300006847	Ga0075431_100047061	Ga0075431_1000470613	204
160	3300006847	Ga0075431_100266333	Ga0075431_1002663332	204
161	3300006852	Ga0075433_10011442	Ga0075433_100114423	204
162	3300006871	Ga0075434_100016288	Ga0075434_1000162883	204
163	3300006880	Ga0075429_100194129	Ga0075429_1001941292	204
164	3300006880	Ga0075429_100529202	Ga0075429_1005292022	204
165	3300006880	Ga0075429_100796862	Ga0075429_1007968621	204
166	3300006931	Ga0097620_100156477	Ga0097620_1001564772	204
167	3300006931	Ga0097620_100609989	Ga0097620_1006099892	204
168	3300007076	Ga0075435_100368877	Ga0075435_1003688772	204
169	3300009093	Ga0105240_10033189	Ga0105240_100331897	204
170	3300009094	Ga0111539_10205817	Ga0111539_102058172	204
171	3300009098	Ga0105245_10135665	Ga0105245_101356651	204
172	3300009147	Ga0114129_10015942	Ga0114129_100159424	204
173	3300009147	Ga0114129_10237616	Ga0114129_102376161	204
174	3300009147	Ga0114129_10736559	Ga0114129_107365592	204
175	3300009148	Ga0105243_10087333	Ga0105243_100873332	204
176	3300009176	Ga0105242_10259732	Ga0105242_102597322	204
177	3300009177	Ga0105248_10133726	Ga0105248_101337262	204
178	3300009177	Ga0105248_10407796	Ga0105248_104077962	204
179	3300009553	Ga0105249_10000466	Ga0105249_1000046624	204
180	3300011119	Ga0105246_10001932	Ga0105246_1000193211	204
181	3300013100	Ga0157373_10586403	Ga0157373_105864031	204
182	3300013104	Ga0157370_10058509	Ga0157370_100585093	204
183	3300013105	Ga0157369_10151565	Ga0157369_101515653	204
184	3300013306	Ga0163162_10177467	Ga0163162_101774672	204
185	3300013307	Ga0157372_10336275	Ga0157372_103362752	204
186	3300013307	Ga0157372_10361961	Ga0157372_103619612	204
187	3300013307	Ga0157372_10385371	Ga0157372_103853712	204
188	3300013308	Ga0157375_10074375	Ga0157375_100743754	204
189	3300013308	Ga0157375_10081244	Ga0157375_100812444	204
190	3300014326	Ga0157380_10009481	Ga0157380_100094813	204
191	3300014745	Ga0157377_10030384	Ga0157377_100303843	204
192	3300014968	Ga0157379_10502059	Ga0157379_105020592	204
193	3300014969	Ga0157376_10007759	Ga0157376_100077599	204
194	3300014969	Ga0157376_10036280	Ga0157376_100362804	204
195	3300017792	Ga0163161_10023677	Ga0163161_100236774	204
196	3300017792	Ga0163161_10121226	Ga0163161_101212261	204
197	3300022732	Ga0224569_100714	Ga0224569_1007143	204
198	3300024227	Ga0228598_1019255	Ga0228598_10192552	204
199	3300025315	Ga0207697_10008630	Ga0207697_100086304	204
200	3300025893	Ga0207682_10005533	Ga0207682_100055335	204
201	3300025898	Ga0207692_10311609	Ga0207692_103116092	204
202	3300025901	Ga0207688_10030329	Ga0207688_100303294	204
203	3300025907	Ga0207645_10062866	Ga0207645_100628663	204
204	3300025908	Ga0207643_10008259	Ga0207643_100082599	204
205	3300025908	Ga0207643_10010918	Ga0207643_100109184	204
206	3300025909	Ga0207705_10193303	Ga0207705_101933031	204
207	3300025910	Ga0207684_10201047	Ga0207684_102010471	204
208	3300025916	Ga0207663_10152023	Ga0207663_101520232	204
209	3300025919	Ga0207657_10005496	Ga0207657_100054962	204
210	3300025920	Ga0207649_10018994	Ga0207649_100189944	204
211	3300025920	Ga0207649_10137895	Ga0207649_101378952	204
212	3300025922	Ga0207646_10159653	Ga0207646_101596532	204
213	3300025922	Ga0207646_10683566	Ga0207646_106835662	204
214	3300025923	Ga0207681_10020336	Ga0207681_100203364	204
215	3300025923	Ga0207681_10045350	Ga0207681_100453502	204
216	3300025923	Ga0207681_10068549	Ga0207681_100685492	204
217	3300025925	Ga0207650_10017406	Ga0207650_100174065	204
218	3300025927	Ga0207687_10783266	Ga0207687_107832661	204
219	3300025931	Ga0207644_10283804	Ga0207644_102838042	204
220	3300025931	Ga0207644_10450675	Ga0207644_104506752	204
221	3300025933	Ga0207706_10004779	Ga0207706_100047795	204
222	3300025933	Ga0207706_10036267	Ga0207706_100362672	204
223	3300025934	Ga0207686_10069599	Ga0207686_100695992	204
224	3300025940	Ga0207691_10013811	Ga0207691_100138119	204
225	3300025940	Ga0207691_10019008	Ga0207691_100190083	204
226	3300025940	Ga0207691_10084159	Ga0207691_100841592	204
227	3300025941	Ga0207711_10108243	Ga0207711_101082433	204
228	3300025945	Ga0207679_10118686	Ga0207679_101186862	204
229	3300025945	Ga0207679_10407952	Ga0207679_104079522	204
230	3300025960	Ga0207651_10059224	Ga0207651_100592244	204
231	3300025961	Ga0207712_10000904	Ga0207712_100009046	204
232	3300025972	Ga0207668_10036080	Ga0207668_100360803	204
233	3300025972	Ga0207668_10060096	Ga0207668_100600963	204
234	3300026035	Ga0207703_10043505	Ga0207703_100435053	204
235	3300026035	Ga0207703_10257656	Ga0207703_102576561	204
236	3300026041	Ga0207639_10186327	Ga0207639_101863272	204
237	3300026041	Ga0207639_10430085	Ga0207639_104300852	204
238	3300026067	Ga0207678_10317753	Ga0207678_103177531	204
239	3300026088	Ga0207641_10175097	Ga0207641_101750972	204
240	3300026088	Ga0207641_10521694	Ga0207641_105216942	204
241	3300026089	Ga0207648_10026450	Ga0207648_100264506	204
242	3300026089	Ga0207648_10314631	Ga0207648_103146312	204
243	3300026095	Ga0207676_10373856	Ga0207676_103738563	204
244	3300026116	Ga0207674_10004248	Ga0207674_100042484	204
245	3300026116	Ga0207674_10006644	Ga0207674_100066446	204
246	3300026116	Ga0207674_10016442	Ga0207674_100164425	204
247	3300026116	Ga0207674_10064100	Ga0207674_100641003	204
248	3300026118	Ga0207675_100015476	Ga0207675_1000154763	204
249	3300026121	Ga0207683_10032805	Ga0207683_100328054	204
250	3300026121	Ga0207683_10077424	Ga0207683_100774244	204
251	3300026142	Ga0207698_10416022	Ga0207698_104160222	204
252	3300027671	Ga0209588_1001287	Ga0209588_10012877	204
253	3300027866	Ga0209813_10006070	Ga0209813_100060701	204
254	3300028380	Ga0268265_10001860	Ga0268265_1000186012	204
255	3300028381	Ga0268264_10496737	Ga0268264_104967372	204
256	3300031548	Ga0307408_100001303	Ga0307408_1000013033	204
257	3300031616	Ga0307508_10030006	Ga0307508_100300069	204
258	3300031824	Ga0307413_10659231	Ga0307413_106592311	204
259	3300031901	Ga0307406_10003012	Ga0307406_100030123	204
260	3300032002	Ga0307416_100234586	Ga0307416_1002345862	204
261	3300032005	Ga0307411_11139123	Ga0307411_111391231	204
262	3300032126	Ga0307415_100033274	Ga0307415_1000332744	204
263	3300034818	Ga0373950_0000011	Ga0373950_0000011_284690_285379	204
264	3300035090	Ga0373949_0092722	Ga0373949_0092722_16_636	204
265	3300035118	Ga0373954_0109904	Ga0373954_0109904_698_1315	204
266	3300035120	Ga0373957_0033485	Ga0373957_0033485_846_1499	204
267	3300035170	Ga0373943_0012983	Ga0373943_0012983_569_1204	204
268	3300035170	Ga0373943_0038401	Ga0373943_0038401_842_1456	204
269	3300035172	Ga0373955_0061244	Ga0373955_0061244_993_1646	204
270	3300035172	Ga0373955_0096250	Ga0373955_0096250_175_810	204
271	3300035410	Ga0373924_0082063	Ga0373924_0082063_249_902	204
272	3300035691	Ga0373931_0004827	Ga0373931_0004827_4729_5349	204
273	3300035692	Ga0373935_0107628	Ga0373935_0107628_1193_1828	204
274	3300035692	Ga0373935_0376192	Ga0373935_0376192_385_999	204
275	3300035695	Ga0373927_0092869	Ga0373927_0092869_1090_1707	204
276	3300035695	Ga0373927_0125793	Ga0373927_0125793_554_1189	204
277	3300035724	Ga0373933_0019825	Ga0373933_0019825_2295_2948	204
278	3300035725	Ga0373947_0066518	Ga0373947_0066518_836_1453	204
279	3300036401	Ga0373937_0006892	Ga0373937_0006892_4528_5181	204
280	3300036401	Ga0373937_0047716	Ga0373937_0047716_2334_2969	204
281	3300036401	Ga0373937_0395029	Ga0373937_0395029_389_1015	204
282	3300036401	Ga0373937_0772777	Ga0373937_0772777_170_787	204
283	3300037068	Ga0373925_0054259	Ga0373925_0054259_1537_2163	204
284	3300037068	Ga0373925_0217252	Ga0373925_0217252_177_797	204
285	3300037068	Ga0373925_0351550	Ga0373925_0351550_215_841	204
286	3300037471	Ga0395905_1045576	Ga0395905_1045576_84_698	204
287	3300042876	Ga0451577_0004301	Ga0451577_0004301_4835_5476	204
288	3300042876	Ga0451577_0062101	Ga0451577_0062101_1279_1905	204
289	3300044673	Ga0453683_0109736	Ga0453683_0109736_507_1148	204
290	3300044712	Ga0453684_0011863	Ga0453684_0011863_10415_11056	204
291	3300045051	Ga0451576_0108945	Ga0451576_0108945_176_817	204
292	3300045051	Ga0451576_0598901	Ga0451576_0598901_498_1139	204
293	3300046455	Ga0495603_0001135	Ga0495603_0001135_12528_13154	204
294	3300046459	Ga0495629_0000122	Ga0495629_0000122_21955_22581	204
295	3300046459	Ga0495629_0011698	Ga0495629_0011698_726_1352	204
296	3300046459	Ga0495629_0034698	Ga0495629_0034698_974_1609	204
297	3300046461	Ga0495641_0053658	Ga0495641_0053658_805_1431	204
298	3300046462	Ga0495651_0058693	Ga0495651_0058693_2040_2693	204
299	3300046463	Ga0495653_0003319	Ga0495653_0003319_5625_6251	204
300	3300046463	Ga0495653_0006340	Ga0495653_0006340_1320_1946	204
301	3300046472	Ga0495580_0000715	Ga0495580_0000715_6776_7402	204
302	3300046472	Ga0495580_0089143	Ga0495580_0089143_234_860	204
303	3300046472	Ga0495580_0109134	Ga0495580_0109134_30_644	204
304	3300046473	Ga0495582_0011392	Ga0495582_0011392_1221_1856	204
305	3300046473	Ga0495582_0118301	Ga0495582_0118301_746_1372	204
306	3300046476	Ga0495662_0182856	Ga0495662_0182856_353_988	204
307	3300046477	Ga0495664_0297835	Ga0495664_0297835_116_769	204
308	3300046499	Ga0495594_0281771	Ga0495594_0281771_243_878	204
309	3300046514	Ga0495618_0175195	Ga0495618_0175195_616_1242	204
310	3300046516	Ga0495628_0010274	Ga0495628_0010274_1220_1846	204
311	3300046516	Ga0495628_0059802	Ga0495628_0059802_1978_2604	204
312	3300046516	Ga0495628_0724972	Ga0495628_0724972_12_626	204
313	3300046517	Ga0495630_0054501	Ga0495630_0054501_1609_2223	204
314	3300046524	Ga0495648_0001675	Ga0495648_0001675_6910_7536	204
315	3300046524	Ga0495648_0025083	Ga0495648_0025083_1299_1925	204
316	3300046526	Ga0495666_0013753	Ga0495666_0013753_1701_2327	204
317	3300046529	Ga0495652_0010241	Ga0495652_0010241_4257_4883	204
318	3300046529	Ga0495652_0024809	Ga0495652_0024809_3195_3848	204
319	3300046531	Ga0495665_0001166	Ga0495665_0001166_7820_8446	204
320	3300046535	Ga0495586_0007536	Ga0495586_0007536_4584_5210	204
321	3300046536	Ga0495587_0001128	Ga0495587_0001128_2848_3501	204
322	3300046536	Ga0495587_0020908	Ga0495587_0020908_1705_2331	204
323	3300046543	Ga0495645_0005108	Ga0495645_0005108_6508_7161	204
324	3300046543	Ga0495645_0038991	Ga0495645_0038991_619_1245	204
325	3300046543	Ga0495645_0101703	Ga0495645_0101703_518_1132	204
326	3300046559	Ga0495667_0012894	Ga0495667_0012894_2723_3376	204
327	3300046642	Ga0495634_0001741	Ga0495634_0001741_16415_17041	204
328	3300046663	Ga0495635_0015231	Ga0495635_0015231_2524_3159	204
329	3300046665	Ga0495661_0009542	Ga0495661_0009542_5678_6304	204
330	3300046675	Ga0495657_0094458	Ga0495657_0094458_919_1572	204
331	3300046678	Ga0495599_0026001	Ga0495599_0026001_2835_3488	204
332	3300046678	Ga0495599_0058783	Ga0495599_0058783_759_1385	204
333	3300046679	Ga0495623_0005259	Ga0495623_0005259_3657_4310	204
334	3300046679	Ga0495623_0153484	Ga0495623_0153484_246_872	204
335	3300046680	Ga0495646_0025730	Ga0495646_0025730_1495_2121	204
336	3300046680	Ga0495646_0046483	Ga0495646_0046483_744_1370	204
337	3300046681	Ga0495647_0031740	Ga0495647_0031740_928_1554	204
338	3300046683	Ga0495658_0005238	Ga0495658_0005238_63_689	204
339	3300046683	Ga0495658_0007864	Ga0495658_0007864_2784_3419	204
340	3300046683	Ga0495658_0109708	Ga0495658_0109708_593_1255	204
341	3300046689	Ga0495613_0004062	Ga0495613_0004062_6755_7381	204
342	3300046689	Ga0495613_0058495	Ga0495613_0058495_460_1095	204
343	3300046690	Ga0495624_0000382	Ga0495624_0000382_10654_11280	204
344	3300046690	Ga0495624_0036701	Ga0495624_0036701_1897_2523	204
345	3300046809	Ga0495600_0099414	Ga0495600_0099414_759_1394	204
346	3300047315	Ga0495581_0005321	Ga0495581_0005321_41_667	204
347	3300047315	Ga0495581_0019229	Ga0495581_0019229_861_1496	204
348	3300047317	Ga0495604_0010616	Ga0495604_0010616_3922_4548	204
349	3300047319	Ga0495674_0017220	Ga0495674_0017220_5277_5903	204
350	3300047319	Ga0495674_0021441	Ga0495674_0021441_3445_4071	204
351	3300047321	Ga0495676_0048784	Ga0495676_0048784_1906_2532	204
352	3300047322	Ga0495680_0004181	Ga0495680_0004181_6776_7402	204
353	3300047322	Ga0495680_0513693	Ga0495680_0513693_88_705	204
354	3300047444	Ga0495675_0015913	Ga0495675_0015913_1142_1795	204
355	3300047444	Ga0495675_0087346	Ga0495675_0087346_978_1604	204
356	3300047446	Ga0495679_000678	Ga0495679_000678_14821_15447	204
357	3300047471	Ga0495684_0074342	Ga0495684_0074342_1387_2040	204
358	3300047673	Ga0495593_0012668	Ga0495593_0012668_3759_4385	204
359	3300047673	Ga0495593_0033937	Ga0495593_0033937_1275_1901	204
360	3300048088	Ga0495602_0013128	Ga0495602_0013128_1073_1699	204
361	3300048089	Ga0495614_0001682	Ga0495614_0001682_8392_9018	204
362	3300048089	Ga0495614_0117350	Ga0495614_0117350_500_1135	204
363	3300048903	Ga0496100_0194097	Ga0496100_0194097_638_1258	204
364	3300048904	Ga0496101_0259933	Ga0496101_0259933_621_1241	204
365	3300048907	Ga0496104_0534470	Ga0496104_0534470_355_975	204
366	3300048911	Ga0496108_0279866	Ga0496108_0279866_382_1002	204
367	3300048913	Ga0496110_0282345	Ga0496110_0282345_824_1444	204
368	3300048915	Ga0496112_0091911	Ga0496112_0091911_567_1187	204
369	3300048917	Ga0496114_0796538	Ga0496114_0796538_66_722	204
370	3300049583	Ga0501067_0000009	Ga0501067_0000009_35996_36643	204
371	3300049583	Ga0501067_0000846	Ga0501067_0000846_13659_14348	204
372	3300049589	Ga0501073_0000114	Ga0501073_0000114_22460_23107	204
373	3300049589	Ga0501073_0001731	Ga0501073_0001731_6542_7231	204
374	3300050489	nmdc:mga03683_7482_c1	nmdc:mga03683_7482_c1_2267_2887	204
375	3300050490	nmdc:mga03n38_32170_c1	nmdc:mga03n38_32170_c1_174_794	204
376	3300050491	nmdc:mga00v17_21057_c1	nmdc:mga00v17_21057_c1_2703_3323	204
377	3300050492	nmdc:mga0yw44_34111_c1	nmdc:mga0yw44_34111_c1_2309_2929	204
378	3300050493	nmdc:mga0k408_105514_c1	nmdc:mga0k408_105514_c1_625_1245	204
379	3300050493	nmdc:mga0k408_86321_c1	nmdc:mga0k408_86321_c1_718_1338	204
380	3300050494	nmdc:mga06z11_12032_c1	nmdc:mga06z11_12032_c1_389_1009	204
381	3300050495	nmdc:mga04h51_3298_c1	nmdc:mga04h51_3298_c1_2170_2790	204
382	3300050496	nmdc:mga07m45_18708_c1	nmdc:mga07m45_18708_c1_2474_3094	204
383	3300050507	nmdc:mga05p37_25892_c1	nmdc:mga05p37_25892_c1_2122_2754	204
384	3300050507	nmdc:mga05p37_381349_c1	nmdc:mga05p37_381349_c1_796_1410	204
385	3300050507	nmdc:mga05p37_453064_c1	nmdc:mga05p37_453064_c1_66_710	204
386	3300050508	nmdc:mga09592_283415_c1	nmdc:mga09592_283415_c1_363_1013	204
387	3300050510	nmdc:mga06r32_435898_c1	nmdc:mga06r32_435898_c1_285_917	204
388	3300050510	nmdc:mga06r32_439212_c1	nmdc:mga06r32_439212_c1_148_798	204
389	3300050510	nmdc:mga06r32_5084_c1	nmdc:mga06r32_5084_c1_10869_11483	204
390	3300050511	nmdc:mga08y16_173538_c1	nmdc:mga08y16_173538_c1_1114_1749	204
391	3300050511	nmdc:mga08y16_350300_c1	nmdc:mga08y16_350300_c1_126_809	204
392	3300050512	nmdc:mga0n895_670080_c1	nmdc:mga0n895_670080_c1_179_847	204
393	3300050512	nmdc:mga0n895_8411_c1	nmdc:mga0n895_8411_c1_5457_6089	204
394	3300050515	nmdc:mga0a205_5325_c1	nmdc:mga0a205_5325_c1_7833_8465	204
395	3300050515	nmdc:mga0a205_654461_c1	nmdc:mga0a205_654461_c1_197_811	204
396	3300050516	nmdc:mga0sz30_94670_c1	nmdc:mga0sz30_94670_c1_86_706	204
397	3300053084	Ga0495595_0016674	Ga0495595_0016674_378_1013	204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

73

172

0.97 PF13649

Methyltransf_25

Methyltransferase domain

72

168

0.96 PF08242

Methyltransf_12

Methyltransferase domain

73

170

0.9 PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

36

183

0.87 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3e23-assembly1.cif.gz_A	crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299	0.8379	5	203
6mro-assembly1.cif.gz_A	crystal structure of methyl transferase from methanosarcina acetivorans at 1.6 angstroms resolution, northeast structural genomics consortium (nesg) target mvr53.	0.8122	7	203
6mro-assembly1.cif.gz_A	crystal structure of methyl transferase from methanosarcina acetivorans at 1.6 angstroms resolution, northeast structural genomics consortium (nesg) target mvr53.	0.8008	7	203
3sm3-assembly1.cif.gz_A-2	crystal structure of sam-dependent methyltransferases q8puk2_metma from methanosarcina mazei. northeast structural genomics consortium target mar262.	0.8006	22	203
3ofj-assembly1.cif.gz_A	crystal structure of n-methyltransferase nods from bradyrhizobium japonicum wm9	0.7926	27	203

ID	Description	Score	Start	End	Superfamily
af_P9WK01_14_228_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8719	31	144	3.40.50.150
af_O07251_1_150_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8657	67	204	3.40.50.150
af_Q9VIK9_9_204_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8394	7	144	3.40.50.150
af_D3ZQ63_181_335_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8344	43	172	3.40.50.150
af_Q96IZ6_183_373_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8279	43	203	3.40.50.150

ID	Description	Score	Start	End	GO Terms
AF-A0A6L5DAJ4-F1-model_v4	deleted	0.9953	2	203
AF-A0A7U7AZP1-F1-model_v4	Methyltransferase type 12	0.9942	4	203	GO:0008168 GO:0032259
AF-A0A1E7YT42-F1-model_v4	Methyltransferase domain-containing protein	0.9907	1	204	GO:0016740
AF-A0A1G1Q839-F1-model_v4	Methyltransferase	0.9904	1	203	GO:0008168 GO:0032259
AF-A0A524MRQ1-F1-model_v4	Class I SAM-dependent methyltransferase	0.9898	39	203	GO:0008168 GO:0032259

Feature Viewer

pLDDT	pTM	Quality
92.44	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F433772

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF08241

Methyltransf_11

Methyltransferase domain

73

172

0.97

PF13649

Methyltransf_25

Methyltransferase domain

72

168

0.96

PF08242

Methyltransf_12

Methyltransferase domain

73

170

0.9

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

36

183

0.87

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map