metagRoot

F433793

General Info

Members	Datasets	Scaffolds	Average Seq Length
397	268	390	254

Family's Representative Sequence

Representative Sequence	3300025972\|Ga0207668_10444844\|Ga0207668_104448442
Length	279
Sequence	MKRAAPVRSTFAFARAGPRLAGPTLRLAVAAAAITLASFGLAAEIAPNARRSGYEAMSAATKAMQDDDSANPATLWVLDGEALWRTNAGAAGRACADCHLEAPQSMRGVAARYPAYDGKRQNPVDLAGRINICRVEHQQAAALRPESKELLALTAYVARQSRGLAIESNDARLAPSIEAGRQLFQRRQGQLNLACANCHDDHWGEKLAGNTVPQGHPTGYPVYRLEWQGMGSLQRRLRNCMIGMRAESYAFGSPEFLALETYLMWRARGMAMESPAVRP

Samples

	Sample ID	Description	Type	Environment
1	2508501050	Microvirga lupini Lut6	Isolate	Nodule
2	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
3	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
4	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
5	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
6	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
7	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
8	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
9	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
10	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
11	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
12	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
13	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
14	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
15	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
16	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
17	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
18	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
19	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
20	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
21	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
22	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
23	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
24	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
25	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
26	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
27	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
28	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
29	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
30	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
31	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
32	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
33	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
34	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
35	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
36	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
37	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
38	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
39	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
40	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
41	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
42	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
43	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
44	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
45	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
46	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
47	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
48	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
49	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
50	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
51	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
52	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
53	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
54	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
55	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
56	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
57	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
58	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
59	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
60	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
61	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
62	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
63	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
65	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
66	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
67	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
69	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
71	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
72	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
73	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
74	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
75	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
76	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
77	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
78	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
79	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
80	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
81	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
82	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
83	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
84	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
85	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
86	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
87	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
88	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
89	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
130	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
131	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
134	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
135	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
136	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
137	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
138	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
139	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
140	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
141	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
142	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
143	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
144	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
145	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
146	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
147	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
148	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
149	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
150	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
151	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
152	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
153	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
154	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
155	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
156	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
157	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
158	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
159	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
160	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
161	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
162	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
163	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
164	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
165	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
166	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
167	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
168	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
169	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
170	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
171	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
172	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
173	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
174	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
175	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
176	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
177	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
178	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
179	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
180	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
181	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
182	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
183	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
184	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
185	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
186	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
187	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
188	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
189	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
190	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
191	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
192	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
193	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
194	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
195	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
196	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
197	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
198	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
199	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
200	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
201	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
202	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
203	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
204	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
205	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
206	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
207	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
208	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
209	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
210	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
211	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
212	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
213	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
214	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
215	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
216	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
217	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
221	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
222	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
223	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
224	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
225	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
226	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
227	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
228	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
229	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
230	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
232	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
233	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
235	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
236	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
237	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
238	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
239	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
240	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
241	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
242	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
243	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
244	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
245	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
246	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
247	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
248	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
249	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
250	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
251	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
252	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
253	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
254	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
255	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
256	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
257	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
258	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
259	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
260	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
261	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
262	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
263	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
264	3300053725	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere	Metagenome	Endosphere
265	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
266	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
267	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
268	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.24
Metatranscriptomes	0
Isolates	1.76

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	8.06
Nodule	0.76
Rhizoplane	4.79
Rhizosphere	82.37
Stem	0
Stem Tuber	0
Unclassified	4.03

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24742J22300_10009092	3300002244	Bacteria	1639
2	Ga0055525_1000011	3300003759	Bacteria	503124
3	Ga0070658_10178017	3300005327	Bacteria	1789
4	Ga0070683_100147277	3300005329	Bacteria	2231
5	Ga0070690_100032072	3300005330	Bacteria	3278
6	Ga0070670_100061837	3300005331	Bacteria	3214
7	Ga0070677_10005426	3300005333	Bacteria	4201
8	Ga0068869_100039273	3300005334	Bacteria	3379
9	Ga0070689_100052061	3300005340	Bacteria	3166
10	Ga0070689_100060392	3300005340	Bacteria	2947
11	Ga0070689_100265896	3300005340	Bacteria	1419
12	Ga0070691_10160102	3300005341	Bacteria	1160
13	Ga0070661_100040811	3300005344	Bacteria	3386
14	Ga0070675_100089263	3300005354	Bacteria	2581
15	Ga0070671_100179117	3300005355	Bacteria	1794
16	Ga0070674_100007965	3300005356	Bacteria	6276
17	Ga0070674_100098840	3300005356	Bacteria	2122
18	Ga0070673_100138973	3300005364	Bacteria	2047
19	Ga0070688_100063109	3300005365	Bacteria	2347
20	Ga0070688_100082803	3300005365	Bacteria	2081
21	Ga0070659_100446142	3300005366	Bacteria	1097
22	Ga0070709_10272009	3300005434	Bacteria	1228
23	Ga0070713_100192907	3300005436	Bacteria	1837
24	Ga0070701_10212693	3300005438	Bacteria	1149
25	Ga0070708_100052318	3300005445	Bacteria	3621
26	Ga0070663_100154770	3300005455	Bacteria	1761
27	Ga0070678_100316184	3300005456	Bacteria	1332
28	Ga0070662_100030623	3300005457	Bacteria	3768
29	Ga0070681_10180925	3300005458	Bacteria	2030
30	Ga0070685_10090840	3300005466	Bacteria	1848
31	Ga0070685_10094968	3300005466	Bacteria	1812
32	Ga0070698_100154178	3300005471	Bacteria	2243
33	Ga0070699_100328378	3300005518	Bacteria	1375
34	Ga0070684_100016233	3300005535	Bacteria	6082
35	Ga0068853_100368441	3300005539	Bacteria	1340
36	Ga0070672_100047351	3300005543	Bacteria	3336
37	Ga0070696_100406908	3300005546	Bacteria	1066
38	Ga0068855_100196051	3300005563	Bacteria	2275
39	Ga0070664_100021220	3300005564	Bacteria	5351
40	Ga0068857_100243875	3300005577	Bacteria	1646
41	Ga0068856_100713356	3300005614	Bacteria	1023
42	Ga0068852_100038038	3300005616	Bacteria	4040
43	Ga0068859_100092757	3300005617	Bacteria	3071
44	Ga0068859_100357364	3300005617	Bacteria	1556
45	Ga0068858_100152421	3300005842	Bacteria	2173
46	Ga0068858_100219390	3300005842	Bacteria	1801
47	Ga0068858_100566709	3300005842	Bacteria	1100
48	Ga0068862_100148121	3300005844	Bacteria	2088
49	Ga0081455_10003176	3300005937	Bacteria	19071
50	Ga0081455_10012872	3300005937	Bacteria	8305
51	Ga0081538_10003425	3300005981	Bacteria	15006
52	Ga0081540_1000841	3300005983	Bacteria	28015
53	Ga0081540_1007460	3300005983	Bacteria	7787
54	Ga0081540_1023446	3300005983	Bacteria	3609
55	Ga0081539_10000785	3300005985	Bacteria	61844
56	Ga0070712_100409332	3300006175	Bacteria	1122
57	Ga0070712_100620374	3300006175	Bacteria	917
58	Ga0075367_10094457	3300006178	Bacteria	1823
59	Ga0075370_10007267	3300006353	Bacteria	5636
60	Ga0068871_100184014	3300006358	Bacteria	1797
61	Ga0075428_100006931	3300006844	Bacteria	12584
62	Ga0075428_100044369	3300006844	Bacteria	4886
63	Ga0075428_100131920	3300006844	Bacteria	2717
64	Ga0075428_100209874	3300006844	Bacteria	2104
65	Ga0075430_100011150	3300006846	Bacteria	7618
66	Ga0075430_100018522	3300006846	Bacteria	5925
67	Ga0075430_100085632	3300006846	Bacteria	2639
68	Ga0075430_100204283	3300006846	Bacteria	1640
69	Ga0075430_100493102	3300006846	Bacteria	1011
70	Ga0075431_100001010	3300006847	Bacteria	25028
71	Ga0075431_100002664	3300006847	Bacteria	17292
72	Ga0075431_100010167	3300006847	Bacteria	9460
73	Ga0075431_100052377	3300006847	Bacteria	4209
74	Ga0075431_100150292	3300006847	Bacteria	2399
75	Ga0075431_100249289	3300006847	Bacteria	1804
76	Ga0075431_100404522	3300006847	Bacteria	1366
77	Ga0075431_100769946	3300006847	Bacteria	937
78	Ga0075433_10002544	3300006852	Bacteria	13895
79	Ga0075434_100047664	3300006871	Bacteria	4252
80	Ga0075429_100044996	3300006880	Bacteria	3840
81	Ga0075429_100049105	3300006880	Bacteria	3670
82	Ga0075429_100329029	3300006880	Bacteria	1337
83	Ga0075429_100406362	3300006880	Bacteria	1193
84	Ga0075429_100565871	3300006880	Bacteria	996
85	Ga0068865_100177055	3300006881	Bacteria	1640
86	Ga0097620_100092759	3300006931	Bacteria	3071
87	Ga0097620_100357379	3300006931	Bacteria	1556
88	Ga0075435_100024358	3300007076	Bacteria	4696
89	Ga0099794_10073578	3300007265	Bacteria	1677
90	Ga0105240_10706581	3300009093	Bacteria	1100
91	Ga0111539_10002250	3300009094	Bacteria	25720
92	Ga0111539_10028886	3300009094	Bacteria	6762
93	Ga0111539_10088217	3300009094	Bacteria	3645
94	Ga0111539_10299862	3300009094	Bacteria	1870
95	Ga0111539_10556566	3300009094	Bacteria	1336
96	Ga0105247_10045941	3300009101	Bacteria	2680
97	Ga0114129_10002963	3300009147	Bacteria	23761
98	Ga0114129_10030430	3300009147	Bacteria	7639
99	Ga0114129_10106466	3300009147	Bacteria	3874
100	Ga0114129_10310102	3300009147	Bacteria	2101
101	Ga0114129_10356472	3300009147	Bacteria	1936
102	Ga0114129_10463723	3300009147	Bacteria	1660
103	Ga0105241_10180370	3300009174	Bacteria	1751
104	Ga0105248_10522637	3300009177	Bacteria	1338
105	Ga0105238_10047370	3300009551	Bacteria	4335
106	Ga0105238_10210881	3300009551	Bacteria	1918
107	Ga0105239_10065390	3300010375	Bacteria	3994
108	Ga0105239_10159171	3300010375	Bacteria	2522
109	Ga0105239_10643635	3300010375	Unclassified	1211
110	Ga0157373_10163516	3300013100	Bacteria	1566
111	Ga0157378_10222251	3300013297	Bacteria	1796
112	Ga0163162_10062895	3300013306	Bacteria	3752
113	Ga0163162_10310279	3300013306	Bacteria	1710
114	Ga0163162_10338273	3300013306	Bacteria	1638
115	Ga0157372_10077052	3300013307	Bacteria	3765
116	Ga0157372_10512331	3300013307	Bacteria	1399
117	Ga0163163_10488228	3300014325	Bacteria	1293
118	Ga0157380_10121916	3300014326	Bacteria	2210
119	Ga0157377_10005846	3300014745	Bacteria	5817
120	Ga0157379_10421120	3300014968	Bacteria	1230
121	Ga0157376_10255131	3300014969	Bacteria	1640
122	Ga0209674_108999	3300025226	Bacteria	1140
123	Ga0209563_100005	3300025230	Bacteria	1774893
124	Ga0209677_105663	3300025253	Bacteria	3196
125	Ga0209148_1004524	3300025254	Bacteria	3404
126	Ga0209233_1000570	3300025261	Bacteria	19755
127	Ga0209455_1005249	3300025272	Bacteria	4048
128	Ga0209455_1015698	3300025272	Bacteria	1654
129	Ga0207682_10000490	3300025893	Bacteria	18283
130	Ga0207692_10013820	3300025898	Bacteria	3512
131	Ga0207692_10257488	3300025898	Bacteria	1048
132	Ga0207710_10115478	3300025900	Bacteria	1278
133	Ga0207688_10097534	3300025901	Bacteria	1694
134	Ga0207647_10066429	3300025904	Bacteria	2187
135	Ga0207645_10303122	3300025907	Bacteria	1064
136	Ga0207705_10222952	3300025909	Bacteria	1433
137	Ga0207707_10113672	3300025912	Bacteria	2366
138	Ga0207707_10636731	3300025912	Bacteria	900
139	Ga0207695_10306458	3300025913	Bacteria	1479
140	Ga0207693_10029414	3300025915	Bacteria	4339
141	Ga0207693_10362414	3300025915	Bacteria	1134
142	Ga0207663_10435637	3300025916	Unclassified	1009
143	Ga0207649_10015573	3300025920	Bacteria	4271
144	Ga0207694_10107861	3300025924	Bacteria	2213
145	Ga0207650_10044049	3300025925	Bacteria	3278
146	Ga0207650_10314705	3300025925	Bacteria	1281
147	Ga0207659_10082845	3300025926	Bacteria	2376
148	Ga0207659_10101258	3300025926	Bacteria	2172
149	Ga0207659_10347786	3300025926	Bacteria	1229
150	Ga0207687_10210928	3300025927	Bacteria	1524
151	Ga0207687_10217947	3300025927	Bacteria	1501
152	Ga0207644_10054607	3300025931	Bacteria	2878
153	Ga0207644_10231610	3300025931	Bacteria	1468
154	Ga0207706_10015391	3300025933	Bacteria	6910
155	Ga0207706_10059649	3300025933	Bacteria	3360
156	Ga0207670_10073544	3300025936	Bacteria	2370
157	Ga0207670_10221244	3300025936	Bacteria	1449
158	Ga0207669_10050250	3300025937	Bacteria	2491
159	Ga0207704_10112602	3300025938	Bacteria	1843
160	Ga0207691_10008184	3300025940	Bacteria	10041
161	Ga0207691_10155494	3300025940	Bacteria	2008
162	Ga0207711_10594213	3300025941	Bacteria	1033
163	Ga0207711_10660697	3300025941	Bacteria	975
164	Ga0207689_10025175	3300025942	Bacteria	4988
165	Ga0207651_10178020	3300025960	Bacteria	1684
166	Ga0207668_10444844	3300025972	Bacteria	1105
167	Ga0207677_10142269	3300026023	Bacteria	1838
168	Ga0207703_10127440	3300026035	Bacteria	2193
169	Ga0207703_10267671	3300026035	Bacteria	1547
170	Ga0207702_10650168	3300026078	Bacteria	1037
171	Ga0207641_10140741	3300026088	Bacteria	2177
172	Ga0207648_10126247	3300026089	Bacteria	2250
173	Ga0207648_10370843	3300026089	Bacteria	1293
174	Ga0207674_10014029	3300026116	Bacteria	8856
175	Ga0207675_100108806	3300026118	Bacteria	2614
176	Ga0207675_100520945	3300026118	Bacteria	1185
177	Ga0207683_10204654	3300026121	Bacteria	1795
178	Ga0207698_10078550	3300026142	Bacteria	2650
179	Ga0209969_1009811	3300027360	Bacteria	1366
180	Ga0209996_1021255	3300027395	Bacteria	913
181	Ga0210000_1003989	3300027462	Bacteria	2138
182	Ga0209995_1014405	3300027471	Bacteria	1296
183	Ga0209999_1005537	3300027543	Bacteria	2272
184	Ga0209813_10020276	3300027866	Bacteria	1858
185	Ga0207428_10129247	3300027907	Bacteria	1934
186	Ga0207428_10171428	3300027907	Bacteria	1643
187	Ga0268265_10144907	3300028380	Bacteria	1994
188	Ga0268264_10605078	3300028381	Bacteria	1080
189	Ga0265326_10028694	3300028558	Bacteria	1585
190	Ga0265334_10010046	3300028573	Bacteria	3999
191	Ga0265323_10000434	3300028653	Bacteria	23913
192	Ga0265322_10017119	3300028654	Bacteria	2089
193	Ga0265336_10000649	3300028666	Bacteria	18964
194	Ga0265338_10000280	3300028800	Bacteria	91942
195	Ga0265331_10002520	3300031250	Bacteria	12346
196	Ga0265327_10000083	3300031251	Bacteria	204923
197	Ga0307408_100108002	3300031548	Unclassified	2132
198	Ga0307416_100179356	3300032002	Bacteria	1983
199	Ga0307411_10494179	3300032005	Bacteria	1033
200	Ga0373938_0026403	3300034957	Bacteria	1215
201	Ga0373954_0000030	3300035118	Bacteria	55716
202	Ga0373956_0105553	3300035119	Bacteria	1309
203	Ga0373960_0158426	3300035121	Bacteria	778
204	Ga0373955_0084477	3300035172	Bacteria	1800
205	Ga0373962_0008702	3300035242	Bacteria	2504
206	Ga0373931_0033364	3300035691	Bacteria	2668
207	Ga0373927_0347653	3300035695	Bacteria	977
208	Ga0373933_0018433	3300035724	Bacteria	3926
209	Ga0373933_0135426	3300035724	Bacteria	1552
210	Ga0373937_0021314	3300036401	Bacteria	5816
211	Ga0373937_0025516	3300036401	Bacteria	5335
212	Ga0373937_0032219	3300036401	Bacteria	4754
213	Ga0373937_0177094	3300036401	Bacteria	2002
214	Ga0373925_0199495	3300037068	Bacteria	1591
215	Ga0395899_0037294	3300037312	Bacteria	3644
216	Ga0395899_0199922	3300037312	Bacteria	1394
217	Ga0395900_0010626	3300037418	Bacteria	9414
218	Ga0395900_0351058	3300037418	Bacteria	1448
219	Ga0395898_0108306	3300037466	Bacteria	2664
220	Ga0395905_0395203	3300037471	Bacteria	1277
221	Ga0436364_0097822	3300037853	Bacteria	3149
222	Ga0436364_0231314	3300037853	Bacteria	2982
223	Ga0395901_0002647	3300038443	Bacteria	18098
224	Ga0436365_1186975	3300039437	Bacteria	1838
225	Ga0436365_1425854	3300039437	Bacteria	2723
226	Ga0436365_1918854	3300039437	Bacteria	6240
227	Ga0436360_1066544	3300039438	Bacteria	1213
228	Ga0436360_1130009	3300039438	Bacteria	1084
229	Ga0436361_0228609	3300039447	Bacteria	9906
230	Ga0436361_0818775	3300039447	Bacteria	2669
231	Ga0436361_1222273	3300039447	Bacteria	2495
232	Ga0436363_0190498	3300039450	Bacteria	2428
233	Ga0436363_1720138	3300039450	Bacteria	824
234	Ga0451855_0123978	3300041511	Bacteria	1255
235	Ga0439435_0010378	3300042436	Bacteria	2210
236	Ga0466957_0021249	3300044842	Bacteria	3823
237	Ga0466967_0384232	3300045976	Bacteria	1364
238	Ga0495592_0011122	3300046454	Bacteria	6797
239	Ga0495592_0203568	3300046454	Bacteria	1334
240	Ga0495651_0225841	3300046462	Bacteria	1293
241	Ga0495653_0082616	3300046463	Bacteria	2371
242	Ga0495582_0229424	3300046473	Bacteria	1063
243	Ga0495662_0151406	3300046476	Bacteria	1143
244	Ga0495664_0155826	3300046477	Bacteria	1386
245	Ga0495652_0023016	3300046529	Bacteria	5526
246	Ga0495665_0106432	3300046531	Unclassified	1472
247	Ga0495640_0161893	3300046533	Unclassified	1433
248	Ga0495640_0207945	3300046533	Bacteria	1238
249	Ga0495621_0056881	3300046539	Bacteria	1411
250	Ga0495633_0205317	3300046558	Bacteria	904
251	Ga0495667_0092147	3300046559	Bacteria	1962
252	Ga0495656_0161433	3300046615	Bacteria	1089
253	Ga0495635_0110245	3300046663	Unclassified	1880
254	Ga0495659_0059792	3300046664	Bacteria	1405
255	Ga0495661_0099451	3300046665	Bacteria	1640
256	Ga0495646_0058096	3300046680	Unclassified	2313
257	Ga0495647_0200684	3300046681	Bacteria	875
258	Ga0495604_0085411	3300047317	Bacteria	2355
259	Ga0495604_0170512	3300047317	Bacteria	1531
260	Ga0495674_0085293	3300047319	Unclassified	2706
261	Ga0495676_0216256	3300047321	Unclassified	1323
262	Ga0495680_0413765	3300047322	Bacteria	929
263	Ga0495593_0033502	3300047673	Bacteria	2797
264	Ga0495602_0145219	3300048088	Bacteria	1873
265	Ga0496102_0036351	3300048905	Bacteria	4436
266	Ga0496103_0037342	3300048906	Bacteria	2976
267	Ga0496105_0180567	3300048908	Bacteria	1728
268	Ga0496106_0056050	3300048909	Bacteria	2979
269	Ga0496106_0102248	3300048909	Bacteria	2223
270	Ga0496106_0354871	3300048909	Bacteria	1178
271	Ga0496107_0088593	3300048910	Bacteria	2259
272	Ga0496108_0002340	3300048911	Bacteria	15178
273	Ga0496108_0302104	3300048911	Bacteria	1394
274	Ga0496109_0430608	3300048912	Bacteria	1246
275	Ga0496110_0316532	3300048913	Bacteria	1421
276	Ga0496111_0039323	3300048914	Bacteria	3391
277	Ga0496111_0186527	3300048914	Bacteria	1542
278	Ga0496112_0006662	3300048915	Bacteria	10167
279	Ga0496113_0000257	3300048916	Bacteria	25061
280	Ga0496114_0046185	3300048917	Bacteria	3619
281	Ga0496115_0022771	3300048918	Bacteria	4857
282	Ga0496115_0201376	3300048918	Bacteria	1645
283	Ga0496118_0009891	3300048921	Bacteria	9537
284	Ga0496121_0014245	3300048924	Bacteria	8457
285	Ga0496121_0048593	3300048924	Bacteria	3608
286	Ga0496124_0563925	3300048927	Bacteria	749
287	Ga0496126_0271508	3300048929	Bacteria	1407
288	Ga0501031_0042679	3300049568	Bacteria	2960
289	Ga0501031_0462901	3300049568	Bacteria	819
290	Ga0501033_0006002	3300049570	Bacteria	9528
291	Ga0501036_0002811	3300049572	Bacteria	13791
292	Ga0501036_0373424	3300049572	Bacteria	1190
293	Ga0501036_0398849	3300049572	Bacteria	1148
294	Ga0501037_0016719	3300049573	Bacteria	5398
295	Ga0501038_0008069	3300049574	Bacteria	9687
296	Ga0501039_0014392	3300049575	Bacteria	6058
297	Ga0501040_0000376	3300049576	Bacteria	26256
298	Ga0501041_0000609	3300049577	Bacteria	18677
299	Ga0501042_0000217	3300049578	Bacteria	27323
300	Ga0501042_0591087	3300049578	Bacteria	807
301	Ga0501046_0003851	3300049580	Bacteria	13731
302	Ga0501048_0001002	3300049582	Bacteria	21063
303	Ga0501068_0052263	3300049584	Bacteria	2472
304	Ga0501070_0115292	3300049586	Bacteria	2219
305	Ga0501071_0011096	3300049587	Bacteria	6056
306	Ga0501071_0590691	3300049587	Bacteria	854
307	Ga0501072_0008373	3300049588	Bacteria	7852
308	Ga0501072_0018140	3300049588	Bacteria	5412
309	Ga0501072_0162643	3300049588	Bacteria	1781
310	Ga0501073_0117080	3300049589	Bacteria	1847
311	Ga0501073_0147891	3300049589	Bacteria	1628
312	Ga0501074_0054650	3300049590	Bacteria	2879
313	Ga0501075_0004474	3300049591	Bacteria	9463
314	Ga0501075_0015921	3300049591	Bacteria	5408
315	Ga0501075_0069873	3300049591	Bacteria	2654
316	Ga0501076_0000526	3300049592	Bacteria	24329
317	Ga0501076_0007558	3300049592	Bacteria	7912
318	Ga0501079_0000010	3300049741	Bacteria	73916
319	Ga0501080_0026635	3300049742	Bacteria	5372
320	Ga0501081_0013648	3300049743	Bacteria	5341
321	Ga0501081_0102819	3300049743	Bacteria	2021
322	Ga0501083_0075569	3300049744	Bacteria	2237
323	Ga0501083_0231071	3300049744	Bacteria	1204
324	Ga0501035_0041997	3300049822	Bacteria	4126
325	Ga0501035_0258863	3300049822	Bacteria	1476
326	Ga0501035_0453421	3300049822	Bacteria	1061
327	Ga0501044_0059444	3300049823	Bacteria	3916
328	Ga0501045_0000946	3300049824	Bacteria	18981
329	Ga0501045_0226535	3300049824	Bacteria	1392
330	nmdc:mga03n38_133980_c1	3300050490	Bacteria	1231
331	nmdc:mga06z11_242703_c1	3300050494	Bacteria	1058
332	nmdc:mga06z11_43321_c1	3300050494	Bacteria	2263
333	nmdc:mga06z11_5205_c1	3300050494	Bacteria	5198
334	nmdc:mga05p37_21053_c1	3300050507	Bacteria	7893
335	nmdc:mga05p37_517_c1	3300050507	Bacteria	42690
336	nmdc:mga05p37_92690_c1	3300050507	Bacteria	3722
337	nmdc:mga05p37_98208_c1	3300050507	Bacteria	3607
338	nmdc:mga09592_191354_c1	3300050508	Bacteria	1771
339	nmdc:mga09592_28339_c1	3300050508	Bacteria	4652
340	nmdc:mga09592_57527_c1	3300050508	Bacteria	3287
341	nmdc:mga0qj67_2103_c1	3300050509	Bacteria	14183
342	nmdc:mga0qj67_237083_c1	3300050509	Unclassified	1008
343	nmdc:mga0qj67_76465_c1	3300050509	Bacteria	2678
344	nmdc:mga06r32_14717_c1	3300050510	Bacteria	7100
345	nmdc:mga06r32_155847_c1	3300050510	Bacteria	2265
346	nmdc:mga06r32_172098_c1	3300050510	Bacteria	2149
347	nmdc:mga06r32_57445_c1	3300050510	Bacteria	3738
348	nmdc:mga06r32_694199_c1	3300050510	Bacteria	984
349	nmdc:mga06r32_7619_c1	3300050510	Bacteria	9735
350	nmdc:mga08y16_112369_c1	3300050511	Bacteria	2836
351	nmdc:mga08y16_21062_c1	3300050511	Bacteria	6883
352	nmdc:mga08y16_372735_c1	3300050511	Bacteria	1464
353	nmdc:mga08y16_416069_c1	3300050511	Bacteria	1374
354	nmdc:mga0n895_244277_c1	3300050512	Bacteria	1822
355	nmdc:mga0rr50_1062660_c1	3300050513	Bacteria	689
356	nmdc:mga0a205_363960_c1	3300050515	Bacteria	1312
357	nmdc:mga0a205_3699_c1	3300050515	Bacteria	13683
358	nmdc:mga0a205_855627_c1	3300050515	Bacteria	756
359	Ga0495601_0163965	3300053077	Unclassified	1452
360	Ga0495612_0004352	3300053078	Bacteria	5876
361	Ga0495595_0009899	3300053084	Bacteria	3952
362	Ga0495619_0001789	3300053085	Bacteria	14292
363	Ga0495619_0046671	3300053085	Bacteria	2849
364	Ga0495619_0179185	3300053085	Bacteria	1466
365	Ga0495619_0310776	3300053085	Bacteria	1092
366	Ga0500643_003556	3300053087	Bacteria	7421
367	Ga0500644_0001130	3300053088	Bacteria	7816
368	Ga0500651_0088309	3300053093	Bacteria	1912
369	Ga0500651_0133404	3300053093	Bacteria	1501
370	Ga0500566_0034058	3300053094	Bacteria	2965
371	Ga0500572_001006	3300053111	Bacteria	8512
372	Ga0500594_0088660	3300053118	Bacteria	936
373	Ga0500595_000003	3300053119	Bacteria	419332
374	Ga0500655_025868	3300053133	Bacteria	1115
375	Ga0500559_0001342	3300053136	Bacteria	14123
376	Ga0500568_0016275	3300053139	Bacteria	3311
377	Ga0500603_012069	3300053150	Bacteria	1977
378	Ga0500616_0000002	3300053153	Bacteria	1611257
379	Ga0500639_004522	3300053163	Bacteria	7069
380	Ga0500636_0053870	3300053177	Bacteria	2360
381	Ga0500576_001460	3300053725	Bacteria	7974
382	Ga0500645_000226	3300053730	Bacteria	42982
383	Ga0501084_0001073	3300054114	Bacteria	21259
384	Ga0501084_0509055	3300054114	Bacteria	1018
385	Ga0501082_0000809	3300060353	Bacteria	27479
386	Ga0501082_0177650	3300060353	Bacteria	1851
387	Ga0501082_0541577	3300060353	Bacteria	1018
388	Ga0530510_0003125	3300061734	Bacteria	11362
389	Ga0530510_0082526	3300061734	Bacteria	2340
390	Ga0530510_0234239	3300061734	Bacteria	1366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049578	Ga0501042_0591087	Ga0501042_0591087_214_795	193
2	3300041511	Ga0451855_0123978	Ga0451855_0123978_167_859	215
3	3300050515	nmdc:mga0a205_855627_c1	nmdc:mga0a205_855627_c1_34_681	215
4	3300031250	Ga0265331_10002520	Ga0265331_100025206	217
5	3300031251	Ga0265327_10000083	Ga0265327_10000083128	217
6	3300048927	Ga0496124_0563925	Ga0496124_0563925_10_663	217
7	3300050509	nmdc:mga0qj67_237083_c1	nmdc:mga0qj67_237083_c1_11_664	217
8	3300050513	nmdc:mga0rr50_1062660_c1	nmdc:mga0rr50_1062660_c1_13_666	217
9	3300053093	Ga0500651_0133404	Ga0500651_0133404_434_1195	219
10	3300003759	Ga0055525_1000011	Ga0055525_1000011251	221
11	3300025226	Ga0209674_108999	Ga0209674_1089992	221
12	3300025230	Ga0209563_100005	Ga0209563_100005576	221
13	3300006871	Ga0075434_100047664	Ga0075434_1000476645	224
14	3300039450	Ga0436363_1720138	Ga0436363_1720138_140_814	224
15	3300046476	Ga0495662_0151406	Ga0495662_0151406_25_699	224
16	3300046681	Ga0495647_0200684	Ga0495647_0200684_164_838	224
17	3300050494	nmdc:mga06z11_242703_c1	nmdc:mga06z11_242703_c1_355_1029	224
18	3300053730	Ga0500645_000226	Ga0500645_000226_12023_12808	224
19	3300027395	Ga0209996_1021255	Ga0209996_10212551	225
20	3300048909	Ga0496106_0354871	Ga0496106_0354871_99_875	231
21	3300048908	Ga0496105_0180567	Ga0496105_0180567_935_1714	232
22	3300048912	Ga0496109_0430608	Ga0496109_0430608_267_1046	232
23	3300048918	Ga0496115_0022771	Ga0496115_0022771_2428_3207	232
24	3300049568	Ga0501031_0042679	Ga0501031_0042679_1447_2160	233
25	3300049570	Ga0501033_0006002	Ga0501033_0006002_5060_5773	233
26	3300049572	Ga0501036_0002811	Ga0501036_0002811_8238_8951	233
27	3300049572	Ga0501036_0373424	Ga0501036_0373424_138_863	233
28	3300049573	Ga0501037_0016719	Ga0501037_0016719_3629_4342	233
29	3300049574	Ga0501038_0008069	Ga0501038_0008069_5085_5798	233
30	3300049575	Ga0501039_0014392	Ga0501039_0014392_4040_4753	233
31	3300049576	Ga0501040_0000376	Ga0501040_0000376_3912_4625	233
32	3300049577	Ga0501041_0000609	Ga0501041_0000609_13868_14581	233
33	3300049578	Ga0501042_0000217	Ga0501042_0000217_25380_26093	233
34	3300049580	Ga0501046_0003851	Ga0501046_0003851_5850_6563	233
35	3300049582	Ga0501048_0001002	Ga0501048_0001002_4331_5044	233
36	3300049584	Ga0501068_0052263	Ga0501068_0052263_322_1035	233
37	3300049586	Ga0501070_0115292	Ga0501070_0115292_630_1343	233
38	3300049587	Ga0501071_0011096	Ga0501071_0011096_4237_4950	233
39	3300049588	Ga0501072_0008373	Ga0501072_0008373_2780_3493	233
40	3300049590	Ga0501074_0054650	Ga0501074_0054650_1347_2060	233
41	3300049591	Ga0501075_0004474	Ga0501075_0004474_3001_3714	233
42	3300049591	Ga0501075_0015921	Ga0501075_0015921_1187_1888	233
43	3300049592	Ga0501076_0000526	Ga0501076_0000526_15762_16475	233
44	3300049741	Ga0501079_0000010	Ga0501079_0000010_70511_71224	233
45	3300049742	Ga0501080_0026635	Ga0501080_0026635_618_1331	233
46	3300049743	Ga0501081_0102819	Ga0501081_0102819_1065_1766	233
47	3300049822	Ga0501035_0041997	Ga0501035_0041997_2628_3341	233
48	3300049823	Ga0501044_0059444	Ga0501044_0059444_1361_2074	233
49	3300049824	Ga0501045_0000946	Ga0501045_0000946_3001_3714	233
50	3300054114	Ga0501084_0001073	Ga0501084_0001073_16089_16802	233
51	3300060353	Ga0501082_0000809	Ga0501082_0000809_6344_7057	233
52	3300060353	Ga0501082_0541577	Ga0501082_0541577_51_752	233
53	3300061734	Ga0530510_0003125	Ga0530510_0003125_3896_4609	233
54	3300006844	Ga0075428_100131920	Ga0075428_1001319203	235
55	3300006846	Ga0075430_100018522	Ga0075430_1000185225	235
56	3300006847	Ga0075431_100001010	Ga0075431_10000101028	235
57	3300049588	Ga0501072_0162643	Ga0501072_0162643_170_952	235
58	3300050509	nmdc:mga0qj67_2103_c1	nmdc:mga0qj67_2103_c1_2272_3045	235
59	3300050510	nmdc:mga06r32_7619_c1	nmdc:mga06r32_7619_c1_4761_5534	235
60	3300005356	Ga0070674_100098840	Ga0070674_1000988402	239
61	3300032005	Ga0307411_10494179	Ga0307411_104941792	239
62	3300035118	Ga0373954_0000030	Ga0373954_0000030_50908_51648	239
63	3300035172	Ga0373955_0084477	Ga0373955_0084477_815_1555	239
64	3300036401	Ga0373937_0025516	Ga0373937_0025516_495_1235	239
65	3300049568	Ga0501031_0462901	Ga0501031_0462901_69_788	239
66	3300006844	Ga0075428_100006931	Ga0075428_1000069312	240
67	3300006846	Ga0075430_100204283	Ga0075430_1002042832	240
68	3300006847	Ga0075431_100002664	Ga0075431_10000266413	240
69	3300006880	Ga0075429_100049105	Ga0075429_1000491055	240
70	3300009147	Ga0114129_10002963	Ga0114129_1000296313	240
71	3300027360	Ga0209969_1009811	Ga0209969_10098112	240
72	3300027462	Ga0210000_1003989	Ga0210000_10039892	240
73	3300027471	Ga0209995_1014405	Ga0209995_10144052	240
74	3300027543	Ga0209999_1005537	Ga0209999_10055372	240
75	3300050507	nmdc:mga05p37_517_c1	nmdc:mga05p37_517_c1_30041_30814	240
76	3300050508	nmdc:mga09592_57527_c1	nmdc:mga09592_57527_c1_2060_2833	240
77	3300050510	nmdc:mga06r32_14717_c1	nmdc:mga06r32_14717_c1_5239_6012	240
78	3300006175	Ga0070712_100620374	Ga0070712_1006203742	241
79	3300009094	Ga0111539_10088217	Ga0111539_100882173	242
80	3300009147	Ga0114129_10463723	Ga0114129_104637232	242
81	3300046477	Ga0495664_0155826	Ga0495664_0155826_567_1343	242
82	3300050511	nmdc:mga08y16_112369_c1	nmdc:mga08y16_112369_c1_649_1377	242
83	3300050512	nmdc:mga0n895_244277_c1	nmdc:mga0n895_244277_c1_925_1653	242
84	3300005365	Ga0070688_100082803	Ga0070688_1000828033	243
85	3300005937	Ga0081455_10012872	Ga0081455_100128727	243
86	3300013306	Ga0163162_10310279	Ga0163162_103102793	243
87	3300014326	Ga0157380_10121916	Ga0157380_101219164	243
88	3300014745	Ga0157377_10005846	Ga0157377_100058463	243
89	3300005577	Ga0068857_100243875	Ga0068857_1002438752	244
90	3300005617	Ga0068859_100092757	Ga0068859_1000927575	244
91	3300005842	Ga0068858_100219390	Ga0068858_1002193902	244
92	3300006931	Ga0097620_100092759	Ga0097620_1000927595	244
93	3300009177	Ga0105248_10522637	Ga0105248_105226371	244
94	3300014968	Ga0157379_10421120	Ga0157379_104211201	244
95	3300025901	Ga0207688_10097534	Ga0207688_100975342	244
96	3300025924	Ga0207694_10107861	Ga0207694_101078613	244
97	3300025925	Ga0207650_10314705	Ga0207650_103147052	244
98	3300025927	Ga0207687_10210928	Ga0207687_102109281	244
99	3300025936	Ga0207670_10221244	Ga0207670_102212443	244
100	3300025941	Ga0207711_10660697	Ga0207711_106606972	244
101	3300025942	Ga0207689_10025175	Ga0207689_100251756	244
102	3300026023	Ga0207677_10142269	Ga0207677_101422691	244
103	3300026035	Ga0207703_10267671	Ga0207703_102676711	244
104	3300026116	Ga0207674_10014029	Ga0207674_1001402910	244
105	3300026118	Ga0207675_100108806	Ga0207675_1001088061	244
106	3300039437	Ga0436365_1186975	Ga0436365_1186975_546_1301	244
107	3300046539	Ga0495621_0056881	Ga0495621_0056881_470_1246	244
108	3300046665	Ga0495661_0099451	Ga0495661_0099451_562_1338	244
109	3300035121	Ga0373960_0158426	Ga0373960_0158426_21_761	245
110	3300046558	Ga0495633_0205317	Ga0495633_0205317_132_872	245
111	3300047673	Ga0495593_0033502	Ga0495593_0033502_2035_2775	245
112	3300053133	Ga0500655_025868	Ga0500655_025868_300_1049	245
113	3300005327	Ga0070658_10178017	Ga0070658_101780172	246
114	3300005329	Ga0070683_100147277	Ga0070683_1001472773	246
115	3300005341	Ga0070691_10160102	Ga0070691_101601021	246
116	3300005344	Ga0070661_100040811	Ga0070661_1000408113	246
117	3300005355	Ga0070671_100179117	Ga0070671_1001791172	246
118	3300005365	Ga0070688_100063109	Ga0070688_1000631093	246
119	3300005434	Ga0070709_10272009	Ga0070709_102720091	246
120	3300005458	Ga0070681_10180925	Ga0070681_101809251	246
121	3300005535	Ga0070684_100016233	Ga0070684_1000162336	246
122	3300005539	Ga0068853_100368441	Ga0068853_1003684411	246
123	3300005563	Ga0068855_100196051	Ga0068855_1001960513	246
124	3300005564	Ga0070664_100021220	Ga0070664_1000212205	246
125	3300005616	Ga0068852_100038038	Ga0068852_1000380381	246
126	3300006844	Ga0075428_100209874	Ga0075428_1002098742	246
127	3300006846	Ga0075430_100011150	Ga0075430_10001115010	246
128	3300006847	Ga0075431_100010167	Ga0075431_10001016710	246
129	3300006880	Ga0075429_100044996	Ga0075429_1000449963	246
130	3300009147	Ga0114129_10030430	Ga0114129_100304309	246
131	3300009174	Ga0105241_10180370	Ga0105241_101803701	246
132	3300009551	Ga0105238_10047370	Ga0105238_100473703	246
133	3300010375	Ga0105239_10065390	Ga0105239_100653902	246
134	3300013100	Ga0157373_10163516	Ga0157373_101635162	246
135	3300013307	Ga0157372_10077052	Ga0157372_100770524	246
136	3300013307	Ga0157372_10512331	Ga0157372_105123312	246
137	3300025904	Ga0207647_10066429	Ga0207647_100664294	246
138	3300025909	Ga0207705_10222952	Ga0207705_102229522	246
139	3300025912	Ga0207707_10113672	Ga0207707_101136725	246
140	3300025913	Ga0207695_10306458	Ga0207695_103064581	246
141	3300025920	Ga0207649_10015573	Ga0207649_100155736	246
142	3300025931	Ga0207644_10231610	Ga0207644_102316103	246
143	3300026142	Ga0207698_10078550	Ga0207698_100785505	246
144	3300037068	Ga0373925_0199495	Ga0373925_0199495_779_1549	246
145	3300037312	Ga0395899_0037294	Ga0395899_0037294_2752_3522	246
146	3300037312	Ga0395899_0199922	Ga0395899_0199922_345_1115	246
147	3300037418	Ga0395900_0010626	Ga0395900_0010626_123_893	246
148	3300037418	Ga0395900_0351058	Ga0395900_0351058_68_838	246
149	3300037466	Ga0395898_0108306	Ga0395898_0108306_587_1357	246
150	3300038443	Ga0395901_0002647	Ga0395901_0002647_14498_15268	246
151	3300039437	Ga0436365_1918854	Ga0436365_1918854_420_1196	246
152	3300046664	Ga0495659_0059792	Ga0495659_0059792_562_1326	246
153	3300050507	nmdc:mga05p37_98208_c1	nmdc:mga05p37_98208_c1_1779_2543	246
154	3300050508	nmdc:mga09592_28339_c1	nmdc:mga09592_28339_c1_2690_3454	246
155	3300050509	nmdc:mga0qj67_76465_c1	nmdc:mga0qj67_76465_c1_1854_2618	246
156	3300050510	nmdc:mga06r32_57445_c1	nmdc:mga06r32_57445_c1_2066_2830	246
157	3300053139	Ga0500568_0016275	Ga0500568_0016275_559_1323	246
158	3300005983	Ga0081540_1000841	Ga0081540_10008417	247
159	3300049589	Ga0501073_0147891	Ga0501073_0147891_267_1010	247
160	3300049822	Ga0501035_0258863	Ga0501035_0258863_276_1067	248
161	3300053088	Ga0500644_0001130	Ga0500644_0001130_134_895	248
162	3300053118	Ga0500594_0088660	Ga0500594_0088660_17_778	248
163	3300053153	Ga0500616_0000002	Ga0500616_0000002_1599641_1600402	248
164	iso_pu_bacteria	2508501050	2508731871	248
165	3300005356	Ga0070674_100007965	Ga0070674_1000079653	249
166	3300005364	Ga0070673_100138973	Ga0070673_1001389732	249
167	3300005456	Ga0070678_100316184	Ga0070678_1003161842	249
168	3300005937	Ga0081455_10003176	Ga0081455_100031769	249
169	3300005983	Ga0081540_1023446	Ga0081540_10234462	249
170	3300006175	Ga0070712_100409332	Ga0070712_1004093321	249
171	3300006178	Ga0075367_10094457	Ga0075367_100944573	249
172	3300006353	Ga0075370_10007267	Ga0075370_100072674	249
173	3300006847	Ga0075431_100249289	Ga0075431_1002492893	249
174	3300006880	Ga0075429_100406362	Ga0075429_1004063622	249
175	3300009093	Ga0105240_10706581	Ga0105240_107065811	249
176	3300025912	Ga0207707_10636731	Ga0207707_106367311	249
177	3300025926	Ga0207659_10347786	Ga0207659_103477862	249
178	3300025937	Ga0207669_10050250	Ga0207669_100502502	249
179	3300025940	Ga0207691_10155494	Ga0207691_101554942	249
180	3300025960	Ga0207651_10178020	Ga0207651_101780202	249
181	3300026121	Ga0207683_10204654	Ga0207683_102046542	249
182	3300027866	Ga0209813_10020276	Ga0209813_100202762	249
183	3300032002	Ga0307416_100179356	Ga0307416_1001793562	249
184	3300035724	Ga0373933_0018433	Ga0373933_0018433_2091_2840	249
185	3300036401	Ga0373937_0021314	Ga0373937_0021314_2138_2887	249
186	3300039447	Ga0436361_0818775	Ga0436361_0818775_1745_2527	249
187	3300046533	Ga0495640_0207945	Ga0495640_0207945_326_1111	249
188	3300048911	Ga0496108_0302104	Ga0496108_0302104_372_1157	249
189	3300048917	Ga0496114_0046185	Ga0496114_0046185_1450_2235	249
190	3300050490	nmdc:mga03n38_133980_c1	nmdc:mga03n38_133980_c1_67_849	249
191	3300050494	nmdc:mga06z11_43321_c1	nmdc:mga06z11_43321_c1_593_1369	249
192	3300050494	nmdc:mga06z11_5205_c1	nmdc:mga06z11_5205_c1_1924_2706	249
193	3300050510	nmdc:mga06r32_155847_c1	nmdc:mga06r32_155847_c1_317_1099	249
194	3300053085	Ga0495619_0179185	Ga0495619_0179185_432_1181	249
195	iso_pu_bacteria	2513237096	2513657143	249
196	iso_pu_bacteria	2513237145	2513919151	249
197	iso_pu_bacteria	2667528175	2671123243	249
198	iso_pu_bacteria	2885374607	2885378217	249
199	iso_pu_bacteria	2906635258	2906641540	249
200	iso_pu_bacteria	2906660503	2906662882	249
201	3300005471	Ga0070698_100154178	Ga0070698_1001541784	250
202	3300009147	Ga0114129_10106466	Ga0114129_101064666	250
203	3300025254	Ga0209148_1004524	Ga0209148_10045243	250
204	3300025261	Ga0209233_1000570	Ga0209233_10005705	250
205	3300025272	Ga0209455_1005249	Ga0209455_10052496	250
206	3300025272	Ga0209455_1015698	Ga0209455_10156982	250
207	3300039450	Ga0436363_0190498	Ga0436363_0190498_416_1183	250
208	3300049572	Ga0501036_0398849	Ga0501036_0398849_164_916	250
209	3300049589	Ga0501073_0117080	Ga0501073_0117080_1063_1824	250
210	3300049591	Ga0501075_0069873	Ga0501075_0069873_730_1482	250
211	3300049592	Ga0501076_0007558	Ga0501076_0007558_4079_4831	250
212	3300049743	Ga0501081_0013648	Ga0501081_0013648_3608_4360	250
213	3300049822	Ga0501035_0453421	Ga0501035_0453421_247_999	250
214	3300049824	Ga0501045_0226535	Ga0501045_0226535_628_1380	250
215	3300061734	Ga0530510_0082526	Ga0530510_0082526_1513_2265	250
216	3300005354	Ga0070675_100089263	Ga0070675_1000892632	251
217	3300005614	Ga0068856_100713356	Ga0068856_1007133561	251
218	3300005844	Ga0068862_100148121	Ga0068862_1001481212	251
219	3300005985	Ga0081539_10000785	Ga0081539_1000078516	251
220	3300010375	Ga0105239_10159171	Ga0105239_101591716	251
221	3300025253	Ga0209677_105663	Ga0209677_1056633	251
222	3300025898	Ga0207692_10257488	Ga0207692_102574881	251
223	3300025926	Ga0207659_10082845	Ga0207659_100828454	251
224	3300026078	Ga0207702_10650168	Ga0207702_106501682	251
225	3300028380	Ga0268265_10144907	Ga0268265_101449072	251
226	3300039438	Ga0436360_1130009	Ga0436360_1130009_176_946	251
227	3300039447	Ga0436361_1222273	Ga0436361_1222273_1315_2085	251
228	3300048914	Ga0496111_0039323	Ga0496111_0039323_1712_2488	251
229	3300048921	Ga0496118_0009891	Ga0496118_0009891_3707_4486	251
230	3300048924	Ga0496121_0014245	Ga0496121_0014245_3356_4135	251
231	3300048924	Ga0496121_0048593	Ga0496121_0048593_2711_3487	251
232	3300048929	Ga0496126_0271508	Ga0496126_0271508_181_957	251
233	3300049587	Ga0501071_0590691	Ga0501071_0590691_59_823	251
234	3300053087	Ga0500643_003556	Ga0500643_003556_6620_7399	251
235	3300053093	Ga0500651_0088309	Ga0500651_0088309_544_1323	251
236	3300053094	Ga0500566_0034058	Ga0500566_0034058_869_1648	251
237	3300053111	Ga0500572_001006	Ga0500572_001006_2954_3733	251
238	3300053119	Ga0500595_000003	Ga0500595_000003_413010_413789	251
239	3300053136	Ga0500559_0001342	Ga0500559_0001342_10785_11564	251
240	3300053163	Ga0500639_004522	Ga0500639_004522_3312_4091	251
241	3300053725	Ga0500576_001460	Ga0500576_001460_4768_5547	251
242	3300054114	Ga0501084_0509055	Ga0501084_0509055_16_807	251
243	3300005331	Ga0070670_100061837	Ga0070670_1000618374	252
244	3300005334	Ga0068869_100039273	Ga0068869_1000392732	252
245	3300005340	Ga0070689_100265896	Ga0070689_1002658961	252
246	3300005366	Ga0070659_100446142	Ga0070659_1004461421	252
247	3300005436	Ga0070713_100192907	Ga0070713_1001929073	252
248	3300005445	Ga0070708_100052318	Ga0070708_1000523182	252
249	3300005455	Ga0070663_100154770	Ga0070663_1001547701	252
250	3300005457	Ga0070662_100030623	Ga0070662_1000306232	252
251	3300005466	Ga0070685_10090840	Ga0070685_100908403	252
252	3300005518	Ga0070699_100328378	Ga0070699_1003283781	252
253	3300005546	Ga0070696_100406908	Ga0070696_1004069082	252
254	3300005617	Ga0068859_100357364	Ga0068859_1003573641	252
255	3300005842	Ga0068858_100152421	Ga0068858_1001524212	252
256	3300005983	Ga0081540_1007460	Ga0081540_10074603	252
257	3300006844	Ga0075428_100044369	Ga0075428_1000443695	252
258	3300006846	Ga0075430_100493102	Ga0075430_1004931021	252
259	3300006847	Ga0075431_100404522	Ga0075431_1004045222	252
260	3300006847	Ga0075431_100769946	Ga0075431_1007699462	252
261	3300006880	Ga0075429_100565871	Ga0075429_1005658712	252
262	3300006931	Ga0097620_100357379	Ga0097620_1003573793	252
263	3300007265	Ga0099794_10073578	Ga0099794_100735781	252
264	3300009094	Ga0111539_10002250	Ga0111539_1000225021	252
265	3300009094	Ga0111539_10299862	Ga0111539_102998622	252
266	3300009101	Ga0105247_10045941	Ga0105247_100459413	252
267	3300009551	Ga0105238_10210881	Ga0105238_102108813	252
268	3300010375	Ga0105239_10643635	Ga0105239_106436352	252
269	3300013297	Ga0157378_10222251	Ga0157378_102222511	252
270	3300013306	Ga0163162_10062895	Ga0163162_100628955	252
271	3300013306	Ga0163162_10338273	Ga0163162_103382732	252
272	3300014325	Ga0163163_10488228	Ga0163163_104882281	252
273	3300025898	Ga0207692_10013820	Ga0207692_100138204	252
274	3300025900	Ga0207710_10115478	Ga0207710_101154782	252
275	3300025907	Ga0207645_10303122	Ga0207645_103031222	252
276	3300025915	Ga0207693_10029414	Ga0207693_100294145	252
277	3300025915	Ga0207693_10362414	Ga0207693_103624142	252
278	3300025916	Ga0207663_10435637	Ga0207663_104356372	252
279	3300025925	Ga0207650_10044049	Ga0207650_100440493	252
280	3300025933	Ga0207706_10015391	Ga0207706_100153917	252
281	3300025933	Ga0207706_10059649	Ga0207706_100596495	252
282	3300026035	Ga0207703_10127440	Ga0207703_101274402	252
283	3300026088	Ga0207641_10140741	Ga0207641_101407411	252
284	3300027907	Ga0207428_10171428	Ga0207428_101714282	252
285	3300028558	Ga0265326_10028694	Ga0265326_100286941	252
286	3300028573	Ga0265334_10010046	Ga0265334_100100462	252
287	3300028653	Ga0265323_10000434	Ga0265323_1000043421	252
288	3300028654	Ga0265322_10017119	Ga0265322_100171194	252
289	3300028666	Ga0265336_10000649	Ga0265336_1000064914	252
290	3300028800	Ga0265338_10000280	Ga0265338_1000028047	252
291	3300031548	Ga0307408_100108002	Ga0307408_1001080022	252
292	3300035119	Ga0373956_0105553	Ga0373956_0105553_508_1296	252
293	3300035695	Ga0373927_0347653	Ga0373927_0347653_76_876	252
294	3300035724	Ga0373933_0135426	Ga0373933_0135426_326_1138	252
295	3300036401	Ga0373937_0032219	Ga0373937_0032219_1542_2354	252
296	3300036401	Ga0373937_0177094	Ga0373937_0177094_293_1093	252
297	3300037853	Ga0436364_0231314	Ga0436364_0231314_625_1416	252
298	3300039437	Ga0436365_1425854	Ga0436365_1425854_1053_1844	252
299	3300039438	Ga0436360_1066544	Ga0436360_1066544_275_1054	252
300	3300039447	Ga0436361_0228609	Ga0436361_0228609_7018_7794	252
301	3300044842	Ga0466957_0021249	Ga0466957_0021249_2810_3595	252
302	3300045976	Ga0466967_0384232	Ga0466967_0384232_231_1013	252
303	3300046454	Ga0495592_0011122	Ga0495592_0011122_5867_6667	252
304	3300046454	Ga0495592_0203568	Ga0495592_0203568_200_1000	252
305	3300046462	Ga0495651_0225841	Ga0495651_0225841_433_1245	252
306	3300046463	Ga0495653_0082616	Ga0495653_0082616_354_1154	252
307	3300046473	Ga0495582_0229424	Ga0495582_0229424_141_941	252
308	3300046529	Ga0495652_0023016	Ga0495652_0023016_2920_3720	252
309	3300046531	Ga0495665_0106432	Ga0495665_0106432_274_1074	252
310	3300046533	Ga0495640_0161893	Ga0495640_0161893_583_1383	252
311	3300046559	Ga0495667_0092147	Ga0495667_0092147_889_1701	252
312	3300046663	Ga0495635_0110245	Ga0495635_0110245_30_830	252
313	3300046680	Ga0495646_0058096	Ga0495646_0058096_903_1703	252
314	3300047317	Ga0495604_0085411	Ga0495604_0085411_293_1093	252
315	3300047317	Ga0495604_0170512	Ga0495604_0170512_471_1271	252
316	3300047319	Ga0495674_0085293	Ga0495674_0085293_911_1711	252
317	3300047321	Ga0495676_0216256	Ga0495676_0216256_245_1045	252
318	3300047322	Ga0495680_0413765	Ga0495680_0413765_73_849	252
319	3300048088	Ga0495602_0145219	Ga0495602_0145219_810_1610	252
320	3300048905	Ga0496102_0036351	Ga0496102_0036351_2916_3692	252
321	3300048906	Ga0496103_0037342	Ga0496103_0037342_1966_2742	252
322	3300048909	Ga0496106_0056050	Ga0496106_0056050_511_1287	252
323	3300048909	Ga0496106_0102248	Ga0496106_0102248_1106_1885	252
324	3300048910	Ga0496107_0088593	Ga0496107_0088593_279_1055	252
325	3300048911	Ga0496108_0002340	Ga0496108_0002340_10135_10911	252
326	3300048913	Ga0496110_0316532	Ga0496110_0316532_150_926	252
327	3300048914	Ga0496111_0186527	Ga0496111_0186527_19_795	252
328	3300048915	Ga0496112_0006662	Ga0496112_0006662_8041_8817	252
329	3300048916	Ga0496113_0000257	Ga0496113_0000257_1974_2750	252
330	3300048918	Ga0496115_0201376	Ga0496115_0201376_838_1614	252
331	3300050508	nmdc:mga09592_191354_c1	nmdc:mga09592_191354_c1_100_876	252
332	3300050510	nmdc:mga06r32_694199_c1	nmdc:mga06r32_694199_c1_90_869	252
333	3300050511	nmdc:mga08y16_21062_c1	nmdc:mga08y16_21062_c1_4943_5725	252
334	3300050511	nmdc:mga08y16_372735_c1	nmdc:mga08y16_372735_c1_269_1045	252
335	3300050511	nmdc:mga08y16_416069_c1	nmdc:mga08y16_416069_c1_376_1152	252
336	3300050515	nmdc:mga0a205_363960_c1	nmdc:mga0a205_363960_c1_479_1255	252
337	3300053077	Ga0495601_0163965	Ga0495601_0163965_521_1321	252
338	3300053078	Ga0495612_0004352	Ga0495612_0004352_2473_3273	252
339	3300053084	Ga0495595_0009899	Ga0495595_0009899_2504_3304	252
340	3300053085	Ga0495619_0001789	Ga0495619_0001789_865_1665	252
341	3300053085	Ga0495619_0046671	Ga0495619_0046671_1133_1933	252
342	3300053085	Ga0495619_0310776	Ga0495619_0310776_45_857	252
343	3300053150	Ga0500603_012069	Ga0500603_012069_158_937	252
344	3300053177	Ga0500636_0053870	Ga0500636_0053870_669_1448	252
345	3300061734	Ga0530510_0234239	Ga0530510_0234239_440_1210	252
346	3300005981	Ga0081538_10003425	Ga0081538_100034255	253
347	3300006847	Ga0075431_100150292	Ga0075431_1001502924	253
348	3300007076	Ga0075435_100024358	Ga0075435_1000243583	253
349	3300009094	Ga0111539_10028886	Ga0111539_100288868	253
350	3300009147	Ga0114129_10356472	Ga0114129_103564723	253
351	3300025972	Ga0207668_10444844	Ga0207668_104448442	253
352	3300027907	Ga0207428_10129247	Ga0207428_101292474	253
353	3300034957	Ga0373938_0026403	Ga0373938_0026403_63_893	253
354	3300035242	Ga0373962_0008702	Ga0373962_0008702_627_1457	253
355	3300035691	Ga0373931_0033364	Ga0373931_0033364_1057_1887	253
356	3300050507	nmdc:mga05p37_92690_c1	nmdc:mga05p37_92690_c1_2029_2814	253
357	3300050510	nmdc:mga06r32_172098_c1	nmdc:mga06r32_172098_c1_419_1204	253
358	3300050515	nmdc:mga0a205_3699_c1	nmdc:mga0a205_3699_c1_1280_2110	253
359	3300060353	Ga0501082_0177650	Ga0501082_0177650_242_1021	253
360	3300005340	Ga0070689_100052061	Ga0070689_1000520611	254
361	3300005438	Ga0070701_10212693	Ga0070701_102126931	254
362	3300005842	Ga0068858_100566709	Ga0068858_1005667091	254
363	3300006852	Ga0075433_10002544	Ga0075433_100025448	254
364	3300009147	Ga0114129_10310102	Ga0114129_103101022	254
365	3300025927	Ga0207687_10217947	Ga0207687_102179471	254
366	3300025941	Ga0207711_10594213	Ga0207711_105942132	254
367	3300026089	Ga0207648_10370843	Ga0207648_103708432	254
368	3300028381	Ga0268264_10605078	Ga0268264_106050782	254
369	3300037853	Ga0436364_0097822	Ga0436364_0097822_386_1237	254
370	3300042436	Ga0439435_0010378	Ga0439435_0010378_801_1589	254
371	3300049588	Ga0501072_0018140	Ga0501072_0018140_1955_2719	254
372	3300049744	Ga0501083_0075569	Ga0501083_0075569_1238_2002	254
373	3300049744	Ga0501083_0231071	Ga0501083_0231071_374_1138	254
374	3300006846	Ga0075430_100085632	Ga0075430_1000856325	256
375	3300006847	Ga0075431_100052377	Ga0075431_1000523774	256
376	3300006880	Ga0075429_100329029	Ga0075429_1003290292	256
377	3300009094	Ga0111539_10556566	Ga0111539_105565662	256
378	3300050507	nmdc:mga05p37_21053_c1	nmdc:mga05p37_21053_c1_5618_6409	256
379	3300037471	Ga0395905_0395203	Ga0395905_0395203_376_1182	257
380	3300002244	JGI24742J22300_10009092	JGI24742J22300_100090921	260
381	3300005330	Ga0070690_100032072	Ga0070690_1000320722	260
382	3300005333	Ga0070677_10005426	Ga0070677_100054264	260
383	3300005340	Ga0070689_100060392	Ga0070689_1000603921	260
384	3300005466	Ga0070685_10094968	Ga0070685_100949682	260
385	3300005543	Ga0070672_100047351	Ga0070672_1000473512	260
386	3300006358	Ga0068871_100184014	Ga0068871_1001840141	260
387	3300006881	Ga0068865_100177055	Ga0068865_1001770553	260
388	3300014969	Ga0157376_10255131	Ga0157376_102551313	260
389	3300025893	Ga0207682_10000490	Ga0207682_100004903	260
390	3300025926	Ga0207659_10101258	Ga0207659_101012582	260
391	3300025931	Ga0207644_10054607	Ga0207644_100546072	260
392	3300025936	Ga0207670_10073544	Ga0207670_100735443	260
393	3300025938	Ga0207704_10112602	Ga0207704_101126023	260
394	3300025940	Ga0207691_10008184	Ga0207691_100081848	260
395	3300026089	Ga0207648_10126247	Ga0207648_101262471	260
396	3300026118	Ga0207675_100520945	Ga0207675_1005209452	260
397	3300046615	Ga0495656_0161433	Ga0495656_0161433_34_816	260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21342

SoxA-TsdA_cyt-c

SoxA/TsdA, cytochrome c domain

79

166

0.98 PF21342

SoxA-TsdA_cyt-c

SoxA/TsdA, cytochrome c domain

179

272

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1h31-assembly3.cif.gz_E	oxidised soxax complex from rhodovulum sulfidophilum	0.9609	30	259
2c1d-assembly4.cif.gz_G	crystal structure of soxxa from p. pantotrophus	0.9457	42	259
3ocd-assembly2.cif.gz_C	diheme soxax - c236m mutant	0.8629	49	258
1h31-assembly3.cif.gz_E	oxidised soxax complex from rhodovulum sulfidophilum	0.8526	30	259
3oa8-assembly1.cif.gz_E	diheme soxax	0.8367	49	258

ID	Description	Score	Start	End	Superfamily
1h31A02	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.9659	54	140	1.10.760.10
1h31A02	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.9448	54	140	1.10.760.10
2oz1C01	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.9377	146	258	1.10.760.10
2c1dG02	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.9236	54	142	1.10.760.10
2c1dG02	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.9042	54	142	1.10.760.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7W4VQ28-F1-model_v4	L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA)	0.9773	54	259	GO:0009055 GO:0016669 GO:0016740 GO:0019417 GO:0020037 GO:0042597 GO:0046872 GO:0070069
AF-A0A327KBR5-F1-model_v4	deleted	0.9736	44	259
AF-A0A7Y4U3F2-F1-model_v4	L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2)	0.9707	30	259	GO:0009055 GO:0016669 GO:0016740 GO:0019417 GO:0020037 GO:0042597 GO:0046872 GO:0070069
AF-A0A527A169-F1-model_v4	L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA)	0.9701	80	259	GO:0009055 GO:0016669 GO:0016740 GO:0019417 GO:0020037 GO:0042597 GO:0046872 GO:0070069
AF-A0A7C3JP97-F1-model_v4	L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA)	0.9684	31	259	GO:0009055 GO:0016669 GO:0016740 GO:0019417 GO:0020037 GO:0042597 GO:0046872 GO:0070069

Feature Viewer

pLDDT	pTM	Quality
87.79	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F433793

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF21342

SoxA-TsdA_cyt-c

SoxA/TsdA, cytochrome c domain

79

166

0.98

PF21342

SoxA-TsdA_cyt-c

SoxA/TsdA, cytochrome c domain

179

272

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map