F433803

General Info

Members Datasets Scaffolds Average Seq Length
397 281 794 182

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10052274|Ga0307513_100522742
Length 190
Sequence MRYFLTLASLVSALLITGCEDEKNSPPPAPFALTAEAIGRYCGMNVLEHAGPKGQVILDAKVGEPIWFSSARDTLAFTMLPEEPKDYAAVYVSDMGKAPSWEKPGATNWIDAKKAFYVIGSAVRGGMGADEAVPFSTRDAADKFAVENGGKVMSFEEVPRDYVLGGGETEKAKDLTPVSKQEDVKGNDHG

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
43 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
83 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
84 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
85 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
96 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
97 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
98 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
99 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
139 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
140 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
141 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
144 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
148 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
149 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
150 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
151 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
152 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
153 2516143018 Ensifer sp. BR816 Isolate Nodule
154 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
155 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
156 2534681786 Brucella suis 92/29 Isolate Unclassified
157 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
158 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
159 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
160 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
161 2643221582 Rhizobium sp. Root651 Isolate Unclassified
162 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
163 2643221618 Ensifer sp. Root231 Isolate Unclassified
164 2643221626 Ensifer sp. Root31 Isolate Unclassified
165 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
166 2643221655 Ensifer sp. Root1252 Isolate Unclassified
167 2643221659 Ensifer sp. Root127 Isolate Unclassified
168 2643221688 Rhizobium sp. Root482 Isolate Unclassified
169 2643221698 Ensifer sp. Root142 Isolate Unclassified
170 2643221712 Ensifer sp. Root258 Isolate Unclassified
171 2773857925 Microvirga vignae BR3299 Isolate Unclassified
172 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
173 2802429634 Rhizobium anhuiense S10 Isolate Nodule
174 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
175 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
176 2844163670 Ensifer sp. 1H6 Isolate Unclassified
177 2854911287 Brucella lupini LUP21 Isolate Unclassified
178 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
179 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
180 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
181 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
182 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
183 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
184 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
185 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
186 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
187 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
188 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
189 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
190 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
191 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
192 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
193 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
194 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
195 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
196 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
197 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
198 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
199 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
200 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
201 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
202 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
203 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
204 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
205 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
206 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
207 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
208 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
209 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
210 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
211 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
212 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
213 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
214 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
215 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
216 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
217 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
218 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
219 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
220 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
221 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
222 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
223 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
224 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
225 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
226 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
227 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
228 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
229 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
230 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
231 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
232 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
233 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
234 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
235 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
236 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
237 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
238 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
239 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
240 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
241 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
242 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
243 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
244 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
245 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
246 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
247 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
248 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
249 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
250 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
251 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
252 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
253 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
254 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
255 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
256 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
257 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
258 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
259 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
260 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
261 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
262 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
263 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
264 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
265 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
266 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
267 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
268 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
269 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
270 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
271 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
272 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
273 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
274 641522639 Methylobacterium sp. 4-46 Isolate Nodule
275 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
276 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
277 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
278 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
279 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
280 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
281 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.99
Metatranscriptomes 0.25
Isolates 33.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.08
Nodule 28.21
Rhizoplane 3.27
Rhizosphere 45.34
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10052274 3300031456 Bacteria 4400
2 Ga0006562J51391_1002919 3300003578 Bacteria 10390
3 Ga0055524_1053670 3300003775 Bacteria 890
4 Ga0055531_10048687 3300003794 Bacteria 1140
5 Ga0055543_1003312 3300004625 Bacteria 4829
6 Ga0065165_1000309 3300005262 Bacteria 80166
7 Ga0065165_1004535 3300005262 Bacteria 8493
8 Ga0070683_100202175 3300005329 Bacteria 1887
9 Ga0070680_100040100 3300005336 Bacteria 3790
10 Ga0070682_100109858 3300005337 Bacteria 1836
11 Ga0070668_100409909 3300005347 Bacteria 1159
12 Ga0070681_10019544 3300005458 Bacteria 6783
13 Ga0070681_10155638 3300005458 Bacteria 2211
14 Ga0068867_100794678 3300005459 Unclassified 843
15 Ga0070679_100006235 3300005530 Bacteria 11106
16 Ga0070679_100039892 3300005530 Bacteria 4668
17 Ga0070684_100009000 3300005535 Bacteria 7844
18 Ga0070686_101089817 3300005544 Bacteria 659
19 Ga0070665_100119572 3300005548 Bacteria 2636
20 Ga0068857_100080782 3300005577 Bacteria 2903
21 Ga0068856_100754632 3300005614 Bacteria 993
22 Ga0068858_101175031 3300005842 Bacteria 754
23 Ga0075365_10184070 3300006038 Bacteria 1461
24 Ga0075368_10048196 3300006042 Bacteria 1688
25 Ga0075364_10000039 3300006051 Bacteria 45751
26 Ga0070715_10314527 3300006163 Bacteria 843
27 Ga0075367_10149673 3300006178 Bacteria 1448
28 Ga0075367_10228203 3300006178 Bacteria 1166
29 Ga0075369_10282511 3300006186 Bacteria 773
30 Ga0079104_1000216 3300006946 Bacteria 80738
31 Ga0079104_1045317 3300006946 Bacteria 1004
32 Ga0105240_10658280 3300009093 Bacteria 1147
33 Ga0111539_11585968 3300009094 Bacteria 759
34 Ga0114129_10635201 3300009147 Bacteria 1379
35 Ga0105237_10225038 3300009545 Bacteria 1876
36 Ga0105237_11363020 3300009545 Bacteria 716
37 Ga0105238_10255772 3300009551 Bacteria 1730
38 Ga0105249_10613648 3300009553 Bacteria 1143
39 Ga0105249_11388072 3300009553 Unclassified 774
40 Ga0105239_11025146 3300010375 Bacteria 949
41 Ga0105239_11264533 3300010375 Bacteria 851
42 Ga0105246_10784965 3300011119 Bacteria 844
43 Ga0157369_10403302 3300013105 Bacteria 1418
44 Ga0171462_1043 3300013250 Bacteria 56604
45 Ga0163162_10519307 3300013306 Bacteria 1320
46 Ga0157375_11013560 3300013308 Bacteria 969
47 Ga0163163_10461905 3300014325 Bacteria 1330
48 Ga0163163_11276782 3300014325 Unclassified 796
49 Ga0182008_10175225 3300014497 Bacteria 1084
50 Ga0157379_10270990 3300014968 Bacteria 1544
51 Ga0207425_1039987 3300025245 Bacteria 897
52 Ga0209677_101017 3300025253 Bacteria 13404
53 Ga0209455_1001272 3300025272 Bacteria 11813
54 Ga0209455_1024619 3300025272 Bacteria 1109
55 Ga0209673_1011211 3300025273 Bacteria 3709
56 Ga0209676_1016303 3300025292 Bacteria 2688
57 Ga0209564_1000189 3300025295 Bacteria 144041
58 Ga0209050_1007751 3300025298 Bacteria 5921
59 Ga0209256_1001306 3300025299 Bacteria 26768
60 Ga0209256_1007725 3300025299 Bacteria 5208
61 Ga0207426_1001105 3300025302 Bacteria 24832
62 Ga0207426_1026351 3300025302 Bacteria 1948
63 Ga0207426_1073327 3300025302 Bacteria 948
64 Ga0209051_1042882 3300025303 Bacteria 1594
65 Ga0209257_1009098 3300025304 Bacteria 5429
66 Ga0209257_1025476 3300025304 Bacteria 2020
67 Ga0207654_10111631 3300025911 Bacteria 1702
68 Ga0207707_10026734 3300025912 Bacteria 5043
69 Ga0207695_10058399 3300025913 Bacteria 4004
70 Ga0207660_10053424 3300025917 Bacteria 2879
71 Ga0207652_10016779 3300025921 Bacteria 5984
72 Ga0207652_10039831 3300025921 Bacteria 3989
73 Ga0207694_10461825 3300025924 Bacteria 1061
74 Ga0207689_10874363 3300025942 Unclassified 758
75 Ga0207661_10002979 3300025944 Bacteria 11707
76 Ga0207661_10217138 3300025944 Bacteria 1688
77 Ga0207639_10261869 3300026041 Bacteria 1513
78 Ga0207708_10597555 3300026075 Bacteria 934
79 Ga0207702_10581800 3300026078 Bacteria 1097
80 Ga0207674_10174364 3300026116 Bacteria 2103
81 Ga0207675_100278545 3300026118 Bacteria 1625
82 Ga0207683_10124738 3300026121 Bacteria 2314
83 Ga0209281_1000472 3300027111 Bacteria 56483
84 Ga0209281_1001540 3300027111 Bacteria 12810
85 Ga0307515_10143744 3300028794 Bacteria 2541
86 Ga0265340_10111539 3300031247 Bacteria 1264
87 Ga0265339_10039880 3300031249 Bacteria 2612
88 Ga0307408_100534324 3300031548 Bacteria 1032
89 Ga0307408_100795271 3300031548 Bacteria 858
90 Ga0307408_100959470 3300031548 Bacteria 786
91 Ga0307516_10258919 3300031730 Bacteria 1431
92 Ga0307410_10116077 3300031852 Bacteria 1945
93 Ga0307412_10098568 3300031911 Bacteria 2062
94 Ga0307412_10953446 3300031911 Bacteria 755
95 Ga0307414_10065784 3300032004 Bacteria 2588
96 Ga0307414_10285861 3300032004 Bacteria 1388
97 Ga0307414_11246884 3300032004 Bacteria 689
98 Ga0373933_0925815 3300035724 Unclassified 574
99 Ga0395899_0091428 3300037312 Bacteria 2205
100 Ga0395900_0035890 3300037418 Bacteria 5108
101 Ga0395898_0035333 3300037466 Bacteria 4971
102 Ga0395905_0000547 3300037471 Bacteria 51364
103 Ga0395905_0006875 3300037471 Bacteria 11372
104 Ga0395905_0082236 3300037471 Bacteria 3018
105 Ga0395905_0917870 3300037471 Bacteria 779
106 Ga0395901_0015214 3300038443 Bacteria 7828
107 Ga0439465_0173871 3300041413 Bacteria 777
108 Ga0451833_0672446 3300041491 Bacteria 5746
109 Ga0451837_1626977 3300041494 Bacteria 1161
110 Ga0451855_0003628 3300041511 Bacteria 12250
111 Ga0451853_0910860 3300041512 Bacteria 25581
112 Ga0496101_0844430 3300048904 Unclassified 722
113 Ga0496106_0000833 3300048909 Bacteria 22331
114 Ga0496106_0156080 3300048909 Bacteria 1802
115 Ga0496107_0576906 3300048910 Bacteria 832
116 Ga0496110_0128438 3300048913 Bacteria 2288
117 Ga0496110_0442092 3300048913 Unclassified 1185
118 Ga0496111_0042771 3300048914 Bacteria 3254
119 Ga0496111_0616161 3300048914 Unclassified 794
120 Ga0496112_0297738 3300048915 Bacteria 1559
121 Ga0496113_0303248 3300048916 Unclassified 1279
122 Ga0496113_0452498 3300048916 Bacteria 1032
123 Ga0496115_0590233 3300048918 Bacteria 884
124 Ga0496115_0717531 3300048918 Unclassified 785
125 Ga0496116_0004881 3300048919 Bacteria 12650
126 Ga0496117_0001278 3300048920 Bacteria 37300
127 Ga0496117_0084830 3300048920 Bacteria 2065
128 Ga0496118_0020534 3300048921 Bacteria 5853
129 Ga0496118_0038740 3300048921 Bacteria 3815
130 Ga0496119_0012017 3300048922 Bacteria 7083
131 Ga0496120_0002198 3300048923 Bacteria 20614
132 Ga0496121_0002652 3300048924 Bacteria 26846
133 Ga0496121_0007809 3300048924 Bacteria 12810
134 Ga0496121_0051483 3300048924 Bacteria 3467
135 Ga0496122_0032613 3300048925 Bacteria 4303
136 Ga0496123_0005009 3300048926 Bacteria 13561
137 Ga0496124_0004071 3300048927 Bacteria 17315
138 Ga0496124_0057088 3300048927 Bacteria 3290
139 Ga0496125_0000034 3300048928 Bacteria 348231
140 Ga0496125_0073223 3300048928 Bacteria 2665
141 Ga0496125_0199052 3300048928 Bacteria 1314
142 Ga0496126_0023821 3300048929 Bacteria 5926
143 Ga0496126_0030571 3300048929 Bacteria 5099
144 Ga0496126_0050411 3300048929 Bacteria 3794
145 Ga0501031_0000381 3300049568 Bacteria 26060
146 Ga0501032_0001260 3300049569 Bacteria 20312
147 Ga0501032_0002511 3300049569 Bacteria 14334
148 Ga0501032_0149026 3300049569 Bacteria 1539
149 Ga0501033_0007576 3300049570 Bacteria 8445
150 Ga0501033_0012584 3300049570 Bacteria 6456
151 Ga0501033_0132563 3300049570 Bacteria 1804
152 Ga0501033_0135970 3300049570 Bacteria 1778
153 Ga0501033_0219967 3300049570 Bacteria 1352
154 Ga0501033_0232125 3300049570 Bacteria 1310
155 Ga0501033_0361721 3300049570 Bacteria 1015
156 Ga0501034_0000561 3300049571 Bacteria 58872
157 Ga0501034_0002233 3300049571 Bacteria 23848
158 Ga0501034_0004522 3300049571 Bacteria 15461
159 Ga0501034_0668146 3300049571 Bacteria 939
160 Ga0501034_0913356 3300049571 Bacteria 765
161 Ga0501036_0000138 3300049572 Bacteria 47432
162 Ga0501036_0015507 3300049572 Bacteria 6367
163 Ga0501036_0175873 3300049572 Bacteria 1802
164 Ga0501036_0721960 3300049572 Bacteria 823
165 Ga0501037_0001072 3300049573 Bacteria 20302
166 Ga0501037_0001995 3300049573 Bacteria 14807
167 Ga0501037_0002132 3300049573 Bacteria 14325
168 Ga0501038_0000204 3300049574 Bacteria 50812
169 Ga0501038_0010917 3300049574 Bacteria 8296
170 Ga0501038_0061312 3300049574 Bacteria 3217
171 Ga0501038_0079722 3300049574 Bacteria 2760
172 Ga0501038_0081547 3300049574 Plasmid 2725
173 Ga0501038_0467791 3300049574 Bacteria 968
174 Ga0501038_0482180 3300049574 Bacteria 950
175 Ga0501039_0000596 3300049575 Bacteria 26141
176 Ga0501039_0005796 3300049575 Bacteria 9354
177 Ga0501039_0034313 3300049575 Bacteria 3916
178 Ga0501039_0186973 3300049575 Unclassified 1629
179 Ga0501039_0370452 3300049575 Bacteria 1125
180 Ga0501040_0009682 3300049576 Bacteria 6291
181 Ga0501040_0114191 3300049576 Unclassified 1890
182 Ga0501040_0189897 3300049576 Bacteria 1457
183 Ga0501041_0056350 3300049577 Bacteria 2401
184 Ga0501041_0057356 3300049577 Bacteria 2381
185 Ga0501042_0010819 3300049578 Bacteria 6134
186 Ga0501042_0046396 3300049578 Bacteria 3097
187 Ga0501042_0369288 3300049578 Bacteria 1038
188 Ga0501043_0007600 3300049579 Bacteria 8595
189 Ga0501043_0029585 3300049579 Bacteria 4304
190 Ga0501043_0088491 3300049579 Bacteria 2434
191 Ga0501043_0193882 3300049579 Bacteria 1579
192 Ga0501046_0002348 3300049580 Bacteria 17844
193 Ga0501046_0060059 3300049580 Bacteria 2976
194 Ga0501046_0127850 3300049580 Bacteria 1929
195 Ga0501046_0129756 3300049580 Bacteria 1912
196 Ga0501046_0206889 3300049580 Bacteria 1458
197 Ga0501047_0002857 3300049581 Bacteria 16379
198 Ga0501047_0003702 3300049581 Bacteria 14394
199 Ga0501047_0028397 3300049581 Bacteria 5393
200 Ga0501047_0165620 3300049581 Bacteria 2081
201 Ga0501047_0179372 3300049581 Bacteria 1984
202 Ga0501048_0494066 3300049582 Bacteria 877
203 Ga0501048_0729943 3300049582 Unclassified 711
204 Ga0501067_0001279 3300049583 Bacteria 13638
205 Ga0501067_0123412 3300049583 Bacteria 1441
206 Ga0501067_0129851 3300049583 Bacteria 1402
207 Ga0501067_0146474 3300049583 Bacteria 1316
208 Ga0501070_0008260 3300049586 Bacteria 8802
209 Ga0501070_0010319 3300049586 Bacteria 7896
210 Ga0501070_0010869 3300049586 Bacteria 7690
211 Ga0501070_0070413 3300049586 Bacteria 2896
212 Ga0501070_0196306 3300049586 Bacteria 1658
213 Ga0501070_0869569 3300049586 Bacteria 704
214 Ga0501071_0021247 3300049587 Unclassified 4518
215 Ga0501071_0347319 3300049587 Unclassified 1129
216 Ga0501073_0163839 3300049589 Bacteria 1540
217 Ga0501074_0034082 3300049590 Bacteria 3691
218 Ga0501074_0459138 3300049590 Unclassified 903
219 Ga0501075_0227739 3300049591 Bacteria 1421
220 Ga0501077_0410976 3300049593 Bacteria 865
221 Ga0501079_0024794 3300049741 Bacteria 4601
222 Ga0501079_0068544 3300049741 Unclassified 2738
223 Ga0501079_0267580 3300049741 Bacteria 1336
224 Ga0501080_0000159 3300049742 Bacteria 48535
225 Ga0501080_0017987 3300049742 Bacteria 6543
226 Ga0501080_0540968 3300049742 Bacteria 1038
227 Ga0501081_0026019 3300049743 Unclassified 3942
228 Ga0501081_0310360 3300049743 Bacteria 1158
229 Ga0501035_0000473 3300049822 Bacteria 45096
230 Ga0501035_0000623 3300049822 Bacteria 39011
231 Ga0501035_0012567 3300049822 Bacteria 7823
232 Ga0501035_0012679 3300049822 Bacteria 7789
233 Ga0501035_0037754 3300049822 Bacteria 4372
234 Ga0501035_0178362 3300049822 Bacteria 1831
235 Ga0501044_0000115 3300049823 Bacteria 96999
236 Ga0501044_0000441 3300049823 Bacteria 50812
237 Ga0501044_0000505 3300049823 Bacteria 47475
238 Ga0501044_0035159 3300049823 Bacteria 5248
239 Ga0501044_0052901 3300049823 Bacteria 4180
240 Ga0501044_0063189 3300049823 Bacteria 3783
241 Ga0501044_0109953 3300049823 Bacteria 2765
242 Ga0501044_1018636 3300049823 Bacteria 699
243 Ga0501045_0017086 3300049824 Bacteria 5152
244 Ga0501045_0405301 3300049824 Bacteria 1015
245 nmdc:mga00v17_122_c1 3300050491 Bacteria 45788
246 nmdc:mga0yw44_393435_c1 3300050492 Bacteria 936
247 nmdc:mga06z11_21083_c1 3300050494 Bacteria 1209
248 nmdc:mga07m45_331569_c1 3300050496 Bacteria 884
249 nmdc:mga07m45_335604_c1 3300050496 Bacteria 878
250 nmdc:mga0sz30_73231_c1 3300050516 Bacteria 1476
251 Ga0500651_0248203 3300053093 Bacteria 1036
252 Ga0500608_094352 3300053122 Bacteria 1394
253 Ga0500658_0000940 3300053134 Bacteria 11882
254 Ga0500568_0000819 3300053139 Bacteria 21859
255 Ga0500622_0000101 3300053156 Bacteria 86856
256 Ga0500627_0056146 3300053158 Bacteria 1726
257 Ga0500627_0284929 3300053158 Unclassified 724
258 Ga0501084_0167681 3300054114 Bacteria 1853
259 Ga0501082_0040819 3300060353 Bacteria 4001
260 Ga0501082_0085399 3300060353 Bacteria 2722
261 Ga0501082_0130080 3300060353 Bacteria 2184
262 Ga0501082_0262301 3300060353 Bacteria 1503
263 Ga0530510_0000705 3300061734 Bacteria 21694
264 2509390284 2509276021 Bacteria 7634384
265 2510307890 2510065057 Bacteria 6649661
266 2513620047 2513237091 Bacteria 6900273
267 2513910089 2513237144 Bacteria 7530820
268 2514002028 2513237159 Bacteria 6810126
269 2516207322 2516143018 Bacteria 6951533
270 2516897272 2516653046 Bacteria 6989037
271 2524463751 2524023210 Bacteria 9029266
272 2535486261 2534681786 Bacteria 3308809
273 2545678593 2545555834 Bacteria 8130841
274 2551713462 2551306089 Bacteria 7162724
275 2585169315 2582581283 Bacteria 6030556
276 2643837120 2643221564 Bacteria 4193379
277 2643917912 2643221582 Bacteria 5804683
278 2643989822 2643221595 Bacteria 6565519
279 2644106128 2643221618 Bacteria 7717186
280 2644146910 2643221626 Bacteria 8069654
281 2644153475 2643221627 Bacteria 6761570
282 2644310739 2643221655 Bacteria 7722067
283 2644334474 2643221659 Bacteria 7890716
284 2644492938 2643221688 Bacteria 5260751
285 2644545327 2643221698 Bacteria 7756764
286 2644616573 2643221712 Bacteria 7729434
287 2774870806 2773857925 Bacteria 6472445
288 2792580267 2791355082 Bacteria 5973319
289 2806056547 2802429634 Bacteria 7083200
290 2806063697 2802429635 Bacteria 7650140
291 2842527431 2842521101 Bacteria 6569494
292 2844165837 2844163670 Bacteria 7266046
293 2854916841 2854911287 Bacteria 5582813
294 2854922478 2854916844 Bacteria 5725939
295 2855830861 2855825444 Bacteria 6785811
296 2874128075 2874123672 Bacteria 7238285
297 2884298191 2884298095 Bacteria 3823049
298 2899808727 2899803654 Bacteria 5577784
299 2903769390 2903768456 Bacteria 9749579
300 2915999978 2915993759 Bacteria 7016183
301 2916007111 2916000859 Bacteria 6865702
302 2916010684 2916007675 Bacteria 6898660
303 2916017502 2916014648 Bacteria 6946486
304 2916046712 2916041962 Bacteria 6820487
305 2916053274 2916048683 Bacteria 6543552
306 2916082087 2916076590 Bacteria 6596108
307 2920764787 2920760137 Bacteria 7427611
308 2920826442 2920822456 Bacteria 6897201
309 2921241940 2921237296 Bacteria 6876710
310 2921246657 2921244191 Bacteria 6568419
311 2921261631 2921257292 Bacteria 6808382
312 2921284505 2921282425 Bacteria 6826397
313 2924149450 2924144063 Bacteria 6883928
314 2924158078 2924150972 Bacteria 7169444
315 2924161029 2924158325 Bacteria 7188855
316 2924185407 2924179722 Bacteria 6843264
317 2924206228 2924200457 Bacteria 6757188
318 2924208708 2924207177 Bacteria 6917007
319 2933017063 2933016740 Bacteria 6355406
320 2937000533 2936996657 Bacteria 6298727
321 2937005194 2937002841 Bacteria 6934057
322 2937011370 2937009748 Bacteria 6746052
323 2937017160 2937016420 Bacteria 6782579
324 2937027576 2937023124 Bacteria 6815156
325 2937050577 2937049772 Bacteria 6757901
326 2937062933 2937056579 Bacteria 7107896
327 2937093367 2937091812 Bacteria 6979387
328 2937100581 2937098957 Bacteria 7249374
329 2937120736 2937119839 Bacteria 6597547
330 2937879640 2937877337 Bacteria 7246526
331 2957386982 2957382221 Bacteria 6737050
332 2957399802 2957395598 Bacteria 6822399
333 2957407334 2957402308 Bacteria 6741770
334 2957413129 2957408893 Bacteria 6558585
335 2957436633 2957430029 Bacteria 7022557
336 2957452942 2957450854 Bacteria 6765715
337 2957470541 2957464669 Bacteria 6568877
338 2957476370 2957471148 Bacteria 6797643
339 2957501255 2957498199 Bacteria 7126688
340 2958086816 2958084443 Bacteria 7312792
341 2960586690 2960584000 Bacteria 6864594
342 2960607616 2960603979 Bacteria 6898737
343 2960612860 2960610863 Bacteria 6691244
344 2960630171 2960624210 Bacteria 6875384
345 2960644476 2960637947 Bacteria 7296468
346 2960691765 2960687367 Bacteria 6535474
347 2964613200 2964607997 Bacteria 7101408
348 2964620038 2964615318 Bacteria 6809089
349 2964626812 2964621998 Bacteria 6834995
350 2964629409 2964628898 Bacteria 7083044
351 2964657588 2964656573 Bacteria 7100150
352 2964664760 2964663802 Bacteria 7019362
353 2964679897 2964678106 Bacteria 6792020
354 2964687921 2964685014 Bacteria 6839111
355 2964696746 2964691889 Bacteria 6802758
356 2964725567 2964719344 Bacteria 7286602
357 2967676872 2967671571 Bacteria 7021409
358 2967680203 2967678726 Bacteria 7264382
359 2967698738 2967693043 Bacteria 6804451
360 2967704497 2967699805 Bacteria 6854538
361 2967751674 2967748971 Bacteria 6733771
362 2967760089 2967755722 Bacteria 6814706
363 2967767911 2967762386 Bacteria 6923502
364 2967773999 2967769361 Bacteria 6587838
365 2970022095 2970019648 Bacteria 7072033
366 2970046351 2970040964 Bacteria 6731123
367 2970049137 2970047711 Bacteria 7088379
368 2970057535 2970054988 Bacteria 6611507
369 2970066413 2970061556 Bacteria 7099761
370 2970089888 2970088815 Bacteria 6933825
371 2970101630 2970095765 Bacteria 6936963
372 2970106603 2970102677 Bacteria 6812532
373 2970113468 2970109326 Bacteria 6863976
374 2970121840 2970116247 Bacteria 6501857
375 2970134962 2970129317 Bacteria 6806560
376 2970155779 2970149975 Bacteria 6779706
377 2970162297 2970156795 Bacteria 7168044
378 2970165075 2970164137 Bacteria 6861252
379 2970177160 2970170962 Bacteria 6876229
380 2970180475 2970177841 Bacteria 6768001
381 2970185838 2970184632 Bacteria 7054431
382 2977521973 2977516862 Bacteria 6940108
383 2977554267 2977551784 Bacteria 7125765
384 2977562360 2977558990 Bacteria 6863948
385 2977569384 2977565890 Bacteria 6901543
386 2977582056 2977579622 Bacteria 6772100
387 2996336673 2996336353 Bacteria 5511628
388 3000138683 3000135777 Bacteria 6891109
389 3005457036 3005452660 Bacteria 5889319
390 641643057 641522639 Bacteria 7737025
391 648738030 648276728 Bacteria 6968865
392 8003573558 8003570095 Bacteria 5747666
393 8003998066 8003992118 Bacteria 7266902
394 8005294100 8005289223 Bacteria 6634003
395 8005693171 8005688590 Bacteria 6610080
396 8018129450 8018127388 Bacteria 7351159
397 8056685656 8056681323 Bacteria 8472857
398 Ga0307513_10052274
399 Ga0006562J51391_1002919
400 Ga0055524_1053670
401 Ga0055531_10048687
402 Ga0055543_1003312
403 Ga0065165_1000309
404 Ga0065165_1004535
405 Ga0070683_100202175
406 Ga0070680_100040100
407 Ga0070682_100109858
408 Ga0070668_100409909
409 Ga0070681_10019544
410 Ga0070681_10155638
411 Ga0068867_100794678
412 Ga0070679_100006235
413 Ga0070679_100039892
414 Ga0070684_100009000
415 Ga0070686_101089817
416 Ga0070665_100119572
417 Ga0068857_100080782
418 Ga0068856_100754632
419 Ga0068858_101175031
420 Ga0075365_10184070
421 Ga0075368_10048196
422 Ga0075364_10000039
423 Ga0070715_10314527
424 Ga0075367_10149673
425 Ga0075367_10228203
426 Ga0075369_10282511
427 Ga0079104_1000216
428 Ga0079104_1045317
429 Ga0105240_10658280
430 Ga0111539_11585968
431 Ga0114129_10635201
432 Ga0105237_10225038
433 Ga0105237_11363020
434 Ga0105238_10255772
435 Ga0105249_10613648
436 Ga0105249_11388072
437 Ga0105239_11025146
438 Ga0105239_11264533
439 Ga0105246_10784965
440 Ga0157369_10403302
441 Ga0171462_1043
442 Ga0163162_10519307
443 Ga0157375_11013560
444 Ga0163163_10461905
445 Ga0163163_11276782
446 Ga0182008_10175225
447 Ga0157379_10270990
448 Ga0207425_1039987
449 Ga0209677_101017
450 Ga0209455_1001272
451 Ga0209455_1024619
452 Ga0209673_1011211
453 Ga0209676_1016303
454 Ga0209564_1000189
455 Ga0209050_1007751
456 Ga0209256_1001306
457 Ga0209256_1007725
458 Ga0207426_1001105
459 Ga0207426_1026351
460 Ga0207426_1073327
461 Ga0209051_1042882
462 Ga0209257_1009098
463 Ga0209257_1025476
464 Ga0207654_10111631
465 Ga0207707_10026734
466 Ga0207695_10058399
467 Ga0207660_10053424
468 Ga0207652_10016779
469 Ga0207652_10039831
470 Ga0207694_10461825
471 Ga0207689_10874363
472 Ga0207661_10002979
473 Ga0207661_10217138
474 Ga0207639_10261869
475 Ga0207708_10597555
476 Ga0207702_10581800
477 Ga0207674_10174364
478 Ga0207675_100278545
479 Ga0207683_10124738
480 Ga0209281_1000472
481 Ga0209281_1001540
482 Ga0307515_10143744
483 Ga0265340_10111539
484 Ga0265339_10039880
485 Ga0307408_100534324
486 Ga0307408_100795271
487 Ga0307408_100959470
488 Ga0307516_10258919
489 Ga0307410_10116077
490 Ga0307412_10098568
491 Ga0307412_10953446
492 Ga0307414_10065784
493 Ga0307414_10285861
494 Ga0307414_11246884
495 Ga0373933_0925815
496 Ga0395899_0091428
497 Ga0395900_0035890
498 Ga0395898_0035333
499 Ga0395905_0000547
500 Ga0395905_0006875
501 Ga0395905_0082236
502 Ga0395905_0917870
503 Ga0395901_0015214
504 Ga0439465_0173871
505 Ga0451833_0672446
506 Ga0451837_1626977
507 Ga0451855_0003628
508 Ga0451853_0910860
509 Ga0496101_0844430
510 Ga0496106_0000833
511 Ga0496106_0156080
512 Ga0496107_0576906
513 Ga0496110_0128438
514 Ga0496110_0442092
515 Ga0496111_0042771
516 Ga0496111_0616161
517 Ga0496112_0297738
518 Ga0496113_0303248
519 Ga0496113_0452498
520 Ga0496115_0590233
521 Ga0496115_0717531
522 Ga0496116_0004881
523 Ga0496117_0001278
524 Ga0496117_0084830
525 Ga0496118_0020534
526 Ga0496118_0038740
527 Ga0496119_0012017
528 Ga0496120_0002198
529 Ga0496121_0002652
530 Ga0496121_0007809
531 Ga0496121_0051483
532 Ga0496122_0032613
533 Ga0496123_0005009
534 Ga0496124_0004071
535 Ga0496124_0057088
536 Ga0496125_0000034
537 Ga0496125_0073223
538 Ga0496125_0199052
539 Ga0496126_0023821
540 Ga0496126_0030571
541 Ga0496126_0050411
542 Ga0501031_0000381
543 Ga0501032_0001260
544 Ga0501032_0002511
545 Ga0501032_0149026
546 Ga0501033_0007576
547 Ga0501033_0012584
548 Ga0501033_0132563
549 Ga0501033_0135970
550 Ga0501033_0219967
551 Ga0501033_0232125
552 Ga0501033_0361721
553 Ga0501034_0000561
554 Ga0501034_0002233
555 Ga0501034_0004522
556 Ga0501034_0668146
557 Ga0501034_0913356
558 Ga0501036_0000138
559 Ga0501036_0015507
560 Ga0501036_0175873
561 Ga0501036_0721960
562 Ga0501037_0001072
563 Ga0501037_0001995
564 Ga0501037_0002132
565 Ga0501038_0000204
566 Ga0501038_0010917
567 Ga0501038_0061312
568 Ga0501038_0079722
569 Ga0501038_0081547
570 Ga0501038_0467791
571 Ga0501038_0482180
572 Ga0501039_0000596
573 Ga0501039_0005796
574 Ga0501039_0034313
575 Ga0501039_0186973
576 Ga0501039_0370452
577 Ga0501040_0009682
578 Ga0501040_0114191
579 Ga0501040_0189897
580 Ga0501041_0056350
581 Ga0501041_0057356
582 Ga0501042_0010819
583 Ga0501042_0046396
584 Ga0501042_0369288
585 Ga0501043_0007600
586 Ga0501043_0029585
587 Ga0501043_0088491
588 Ga0501043_0193882
589 Ga0501046_0002348
590 Ga0501046_0060059
591 Ga0501046_0127850
592 Ga0501046_0129756
593 Ga0501046_0206889
594 Ga0501047_0002857
595 Ga0501047_0003702
596 Ga0501047_0028397
597 Ga0501047_0165620
598 Ga0501047_0179372
599 Ga0501048_0494066
600 Ga0501048_0729943
601 Ga0501067_0001279
602 Ga0501067_0123412
603 Ga0501067_0129851
604 Ga0501067_0146474
605 Ga0501070_0008260
606 Ga0501070_0010319
607 Ga0501070_0010869
608 Ga0501070_0070413
609 Ga0501070_0196306
610 Ga0501070_0869569
611 Ga0501071_0021247
612 Ga0501071_0347319
613 Ga0501073_0163839
614 Ga0501074_0034082
615 Ga0501074_0459138
616 Ga0501075_0227739
617 Ga0501077_0410976
618 Ga0501079_0024794
619 Ga0501079_0068544
620 Ga0501079_0267580
621 Ga0501080_0000159
622 Ga0501080_0017987
623 Ga0501080_0540968
624 Ga0501081_0026019
625 Ga0501081_0310360
626 Ga0501035_0000473
627 Ga0501035_0000623
628 Ga0501035_0012567
629 Ga0501035_0012679
630 Ga0501035_0037754
631 Ga0501035_0178362
632 Ga0501044_0000115
633 Ga0501044_0000441
634 Ga0501044_0000505
635 Ga0501044_0035159
636 Ga0501044_0052901
637 Ga0501044_0063189
638 Ga0501044_0109953
639 Ga0501044_1018636
640 Ga0501045_0017086
641 Ga0501045_0405301
642 nmdc:mga00v17_122_c1
643 nmdc:mga0yw44_393435_c1
644 nmdc:mga06z11_21083_c1
645 nmdc:mga07m45_331569_c1
646 nmdc:mga07m45_335604_c1
647 nmdc:mga0sz30_73231_c1
648 Ga0500651_0248203
649 Ga0500608_094352
650 Ga0500658_0000940
651 Ga0500568_0000819
652 Ga0500622_0000101
653 Ga0500627_0056146
654 Ga0500627_0284929
655 Ga0501084_0167681
656 Ga0501082_0040819
657 Ga0501082_0085399
658 Ga0501082_0130080
659 Ga0501082_0262301
660 Ga0530510_0000705
661 2509390284
662 2510307890
663 2513620047
664 2513910089
665 2514002028
666 2516207322
667 2516897272
668 2524463751
669 2535486261
670 2545678593
671 2551713462
672 2585169315
673 2643837120
674 2643917912
675 2643989822
676 2644106128
677 2644146910
678 2644153475
679 2644310739
680 2644334474
681 2644492938
682 2644545327
683 2644616573
684 2774870806
685 2792580267
686 2806056547
687 2806063697
688 2842527431
689 2844165837
690 2854916841
691 2854922478
692 2855830861
693 2874128075
694 2884298191
695 2899808727
696 2903769390
697 2915999978
698 2916007111
699 2916010684
700 2916017502
701 2916046712
702 2916053274
703 2916082087
704 2920764787
705 2920826442
706 2921241940
707 2921246657
708 2921261631
709 2921284505
710 2924149450
711 2924158078
712 2924161029
713 2924185407
714 2924206228
715 2924208708
716 2933017063
717 2937000533
718 2937005194
719 2937011370
720 2937017160
721 2937027576
722 2937050577
723 2937062933
724 2937093367
725 2937100581
726 2937120736
727 2937879640
728 2957386982
729 2957399802
730 2957407334
731 2957413129
732 2957436633
733 2957452942
734 2957470541
735 2957476370
736 2957501255
737 2958086816
738 2960586690
739 2960607616
740 2960612860
741 2960630171
742 2960644476
743 2960691765
744 2964613200
745 2964620038
746 2964626812
747 2964629409
748 2964657588
749 2964664760
750 2964679897
751 2964687921
752 2964696746
753 2964725567
754 2967676872
755 2967680203
756 2967698738
757 2967704497
758 2967751674
759 2967760089
760 2967767911
761 2967773999
762 2970022095
763 2970046351
764 2970049137
765 2970057535
766 2970066413
767 2970089888
768 2970101630
769 2970106603
770 2970113468
771 2970121840
772 2970134962
773 2970155779
774 2970162297
775 2970165075
776 2970177160
777 2970180475
778 2970185838
779 2977521973
780 2977554267
781 2977562360
782 2977569384
783 2977582056
784 2996336673
785 3000138683
786 3005457036
787 641643057
788 648738030
789 8003573558
790 8003998066
791 8005294100
792 8005693171
793 8018129450
794 8056685656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05573

NosL

NosL

30

163

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7og7-assembly1.cif.gz_A crystal structure of the copper chaperone nosl from shewanella denitrificans 0.9155 27 159
7osg-assembly1.cif.gz_H abc transporter complex nosdfyl, consensus refinement 0.914 27 163
7og7-assembly1.cif.gz_A crystal structure of the copper chaperone nosl from shewanella denitrificans 0.8835 27 159
7osg-assembly1.cif.gz_H abc transporter complex nosdfyl, consensus refinement 0.8428 27 163
2hq3-assembly1.cif.gz_A solution nmr structure of the apo-nosl protein from achromobacter cycloclastes 0.6926 54 169
ID Description Score Start End Superfamily
2hq3A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6452 115 169 3.30.70.2050
af_D4AEI6_288_587_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.6151 49 66 3.90.70.10
2hq3A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5642 115 169 3.30.70.2050
af_O96177_23_269_3.30.230.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.5369 49 91 3.30.230.70
af_Q2FWZ5_229_340_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.514 47 91 3.30.1490.100
ID Description Score Start End GO Terms
AF-A0A3B0XIQ1-F1-model_v4 Nitrous oxide reductase maturation protein, outer-membrane lipoprotein NosL 0.9708 44 162
AF-A0A349KXV2-F1-model_v4 Nitrous oxide reductase accessory protein NosL 0.9481 28 156
AF-A0A3T0MZ82-F1-model_v4 Copper resistance protein CopZ 0.9437 17 164
AF-A0A3B0XIQ1-F1-model_v4 Nitrous oxide reductase maturation protein, outer-membrane lipoprotein NosL 0.9319 44 162
AF-A0A2I8DPZ5-F1-model_v4 Copper resistance protein CopZ 0.9283 18 164

Map