F433805

General Info

Members Datasets Scaffolds Average Seq Length
397 264 794 112

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10005122|Ga0265314_1000512212
Length 129
Sequence MASKSGTSQRGHDDLSGASMNKMRTAKYTIGQVVKHRLFSFRGVIFDIDPEFDNTDEWYEAIPAEVRPRKDQPFYHLFAENADTEYVAYVSEQNLLPDTSDKPVRHPQVAEVFVRDRKGGYKPRNNQLN

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
153 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
170 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
171 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
172 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
244 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
245 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
246 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
247 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
248 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
249 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
250 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
256 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
257 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
258 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
259 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
260 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
261 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
262 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
263 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
264 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.05
Nodule 0.25
Rhizoplane 4.53
Rhizosphere 87.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10005122 3300031711 Bacteria 11925
2 JGI25405J52794_10009376 3300003911 Bacteria 1848
3 Ga0070690_100448413 3300005330 Bacteria 956
4 Ga0068869_100037141 3300005334 Bacteria 3463
5 Ga0068869_100499810 3300005334 Bacteria 1015
6 Ga0070680_100190149 3300005336 Bacteria 1730
7 Ga0070682_100006521 3300005337 Bacteria 6549
8 Ga0070660_100019880 3300005339 Bacteria 4926
9 Ga0070689_101843435 3300005340 Bacteria 552
10 Ga0070691_10007196 3300005341 Bacteria 5096
11 Ga0070691_10077528 3300005341 Bacteria 1622
12 Ga0070691_10694782 3300005341 Bacteria 610
13 Ga0070687_100960188 3300005343 Bacteria 617
14 Ga0070692_10173030 3300005345 Bacteria 1246
15 Ga0070668_100517475 3300005347 Bacteria 1035
16 Ga0070668_101661818 3300005347 Bacteria 586
17 Ga0070673_100052909 3300005364 Bacteria 3187
18 Ga0070673_100724050 3300005364 Bacteria 915
19 Ga0070659_100035177 3300005366 Bacteria 3900
20 Ga0070703_10019196 3300005406 Bacteria 1982
21 Ga0070709_10681802 3300005434 Bacteria 798
22 Ga0070714_100633025 3300005435 Bacteria 1029
23 Ga0070710_11093856 3300005437 Bacteria 585
24 Ga0070701_10706261 3300005438 Bacteria 679
25 Ga0070711_100317869 3300005439 Bacteria 1243
26 Ga0070705_100002824 3300005440 Bacteria 8659
27 Ga0070705_100036473 3300005440 Bacteria 2765
28 Ga0070705_100251292 3300005440 Bacteria 1241
29 Ga0070700_100005113 3300005441 Bacteria 6922
30 Ga0070700_100087643 3300005441 Bacteria 2024
31 Ga0070694_100001395 3300005444 Bacteria 14118
32 Ga0070694_100034848 3300005444 Bacteria 3323
33 Ga0070708_100030598 3300005445 Bacteria 4654
34 Ga0070663_100135054 3300005455 Bacteria 1877
35 Ga0070663_100407678 3300005455 Bacteria 1112
36 Ga0070678_100841897 3300005456 Bacteria 835
37 Ga0070662_100714910 3300005457 Bacteria 848
38 Ga0070662_101682807 3300005457 Bacteria 548
39 Ga0070681_10050829 3300005458 Bacteria 4135
40 Ga0070681_10084993 3300005458 Bacteria 3117
41 Ga0068867_101131369 3300005459 Bacteria 716
42 Ga0070707_100669273 3300005468 Bacteria 1001
43 Ga0070698_100937241 3300005471 Bacteria 812
44 Ga0070699_100000903 3300005518 Bacteria 27717
45 Ga0070699_100001464 3300005518 Bacteria 21616
46 Ga0070679_100068033 3300005530 Bacteria 3553
47 Ga0068853_101174949 3300005539 Bacteria 741
48 Ga0068853_101631435 3300005539 Bacteria 625
49 Ga0070672_100098801 3300005543 Bacteria 2364
50 Ga0070686_100406900 3300005544 Bacteria 1036
51 Ga0070686_100899565 3300005544 Bacteria 720
52 Ga0070686_101772743 3300005544 Bacteria 525
53 Ga0070695_100000639 3300005545 Bacteria 18577
54 Ga0070695_100011521 3300005545 Bacteria 5288
55 Ga0070696_100002167 3300005546 Bacteria 12942
56 Ga0070696_100006694 3300005546 Bacteria 7700
57 Ga0070693_100060141 3300005547 Bacteria 2205
58 Ga0070665_100587256 3300005548 Bacteria 1127
59 Ga0070704_100001558 3300005549 Bacteria 12363
60 Ga0070704_100135482 3300005549 Bacteria 1915
61 Ga0070664_100112560 3300005564 Bacteria 2377
62 Ga0068856_102202813 3300005614 Bacteria 560
63 Ga0070702_100046729 3300005615 Bacteria 2455
64 Ga0070702_100074178 3300005615 Bacteria 2018
65 Ga0068864_102466942 3300005618 Bacteria 526
66 Ga0068866_10743504 3300005718 Bacteria 677
67 Ga0068861_100227118 3300005719 Bacteria 1581
68 Ga0068851_10954985 3300005834 Bacteria 539
69 Ga0068870_11089434 3300005840 Bacteria 574
70 Ga0068858_100175782 3300005842 Bacteria 2020
71 Ga0068860_101212044 3300005843 Bacteria 775
72 Ga0068862_100001758 3300005844 Bacteria 19587
73 Ga0068862_100799326 3300005844 Bacteria 921
74 Ga0081455_10011971 3300005937 Bacteria 8683
75 Ga0081540_1015934 3300005983 Bacteria 4736
76 Ga0075363_100855160 3300006048 Bacteria 555
77 Ga0075364_10208508 3300006051 Bacteria 1325
78 Ga0075364_10485452 3300006051 Bacteria 845
79 Ga0075364_10717784 3300006051 Bacteria 682
80 Ga0075432_10033056 3300006058 Bacteria 1793
81 Ga0075367_10697155 3300006178 Bacteria 646
82 Ga0075427_10010950 3300006194 Bacteria 1363
83 Ga0075366_10909684 3300006195 Bacteria 548
84 Ga0097621_100188337 3300006237 Bacteria 1786
85 Ga0075370_10325490 3300006353 Bacteria 916
86 Ga0068871_100130541 3300006358 Bacteria 2130
87 Ga0068871_100635864 3300006358 Bacteria 973
88 Ga0075428_100017835 3300006844 Bacteria 7844
89 Ga0075428_100030168 3300006844 Bacteria 5998
90 Ga0075430_100004696 3300006846 Bacteria 11490
91 Ga0075430_100064231 3300006846 Bacteria 3084
92 Ga0075431_100006639 3300006847 Bacteria 11490
93 Ga0075433_10001599 3300006852 Bacteria 16784
94 Ga0075434_100000576 3300006871 Bacteria 28251
95 Ga0075434_100943061 3300006871 Bacteria 877
96 Ga0075429_100050787 3300006880 Bacteria 3608
97 Ga0075436_100469752 3300006914 Bacteria 918
98 Ga0075435_100156307 3300007076 Bacteria 1919
99 Ga0105250_10205428 3300009092 Bacteria 832
100 Ga0105240_11570974 3300009093 Bacteria 689
101 Ga0111539_10000503 3300009094 Bacteria 49808
102 Ga0111539_10038117 3300009094 Bacteria 5799
103 Ga0105245_10024222 3300009098 Bacteria 5329
104 Ga0105245_10083234 3300009098 Bacteria 2929
105 Ga0105245_10559277 3300009098 Bacteria 1166
106 Ga0114129_10013874 3300009147 Bacteria 11481
107 Ga0114129_10029505 3300009147 Bacteria 7770
108 Ga0114129_10330763 3300009147 Bacteria 2023
109 Ga0114129_10716327 3300009147 Bacteria 1284
110 Ga0105243_10027825 3300009148 Bacteria 4336
111 Ga0105243_10130121 3300009148 Bacteria 2134
112 Ga0105243_11118624 3300009148 Bacteria 797
113 Ga0105241_10004682 3300009174 Bacteria 10103
114 Ga0105242_10876113 3300009176 Bacteria 896
115 Ga0105248_10019008 3300009177 Bacteria 7597
116 Ga0105237_10083294 3300009545 Bacteria 3190
117 Ga0105237_10105963 3300009545 Bacteria 2803
118 Ga0105238_10058399 3300009551 Bacteria 3867
119 Ga0105249_10001768 3300009553 Bacteria 18827
120 Ga0105239_10391703 3300010375 Bacteria 1572
121 Ga0105246_10084012 3300011119 Bacteria 2276
122 Ga0105246_10194096 3300011119 Bacteria 1574
123 Ga0105246_10313229 3300011119 Bacteria 1272
124 Ga0105246_10720271 3300011119 Bacteria 877
125 Ga0157373_10406496 3300013100 Bacteria 976
126 Ga0157370_10303577 3300013104 Bacteria 1473
127 Ga0157370_10331096 3300013104 Bacteria 1404
128 Ga0157369_10423552 3300013105 Bacteria 1380
129 Ga0157374_10674612 3300013296 Bacteria 1046
130 Ga0157374_11100660 3300013296 Bacteria 815
131 Ga0157378_10041471 3300013297 Bacteria 4083
132 Ga0157378_10402037 3300013297 Bacteria 1350
133 Ga0157378_10628199 3300013297 Bacteria 1088
134 Ga0163162_10096507 3300013306 Bacteria 3044
135 Ga0157375_10045104 3300013308 Bacteria 4290
136 Ga0157375_10308379 3300013308 Bacteria 1747
137 Ga0157380_10063356 3300014326 Bacteria 2964
138 Ga0157380_10610437 3300014326 Bacteria 1081
139 Ga0157380_10853078 3300014326 Bacteria 933
140 Ga0157376_10142775 3300014969 Bacteria 2150
141 Ga0157376_10350002 3300014969 Bacteria 1414
142 Ga0163161_11184326 3300017792 Bacteria 660
143 Ga0213873_10177064 3300021358 Bacteria 653
144 Ga0224572_1098376 3300024225 Bacteria 540
145 Ga0207682_10082211 3300025893 Bacteria 1383
146 Ga0207642_10708092 3300025899 Bacteria 635
147 Ga0207688_10053711 3300025901 Bacteria 2260
148 Ga0207647_10149075 3300025904 Bacteria 1368
149 Ga0207707_10082985 3300025912 Bacteria 2798
150 Ga0207671_10608623 3300025914 Bacteria 871
151 Ga0207663_10047280 3300025916 Bacteria 2656
152 Ga0207657_10204636 3300025919 Bacteria 1586
153 Ga0207652_10329877 3300025921 Bacteria 1378
154 Ga0207650_10465239 3300025925 Bacteria 1054
155 Ga0207659_11674738 3300025926 Bacteria 542
156 Ga0207687_10020034 3300025927 Bacteria 4435
157 Ga0207700_10368164 3300025928 Bacteria 1254
158 Ga0207664_10264901 3300025929 Bacteria 1504
159 Ga0207644_10638547 3300025931 Bacteria 886
160 Ga0207690_10006521 3300025932 Bacteria 6918
161 Ga0207706_10809845 3300025933 Bacteria 795
162 Ga0207706_11175361 3300025933 Bacteria 638
163 Ga0207686_10458074 3300025934 Bacteria 982
164 Ga0207709_10074251 3300025935 Bacteria 2169
165 Ga0207709_10613326 3300025935 Bacteria 863
166 Ga0207669_10051532 3300025937 Bacteria 2466
167 Ga0207691_10089680 3300025940 Bacteria 2757
168 Ga0207679_10109375 3300025945 Bacteria 2178
169 Ga0207651_10164009 3300025960 Bacteria 1745
170 Ga0207651_10249516 3300025960 Bacteria 1451
171 Ga0207703_10034453 3300026035 Bacteria 4017
172 Ga0207639_11314480 3300026041 Bacteria 679
173 Ga0207678_10000594 3300026067 Bacteria 33147
174 Ga0207708_10003552 3300026075 Bacteria 11490
175 Ga0207708_10079749 3300026075 Bacteria 2515
176 Ga0207702_12060726 3300026078 Bacteria 561
177 Ga0207648_10025772 3300026089 Bacteria 5233
178 Ga0207676_10273487 3300026095 Bacteria 1531
179 Ga0207674_10055194 3300026116 Bacteria 4040
180 Ga0207675_100224019 3300026118 Bacteria 1813
181 Ga0207675_100293685 3300026118 Bacteria 1581
182 Ga0207675_101367119 3300026118 Bacteria 729
183 Ga0207683_10046174 3300026121 Bacteria 3811
184 Ga0207683_10775419 3300026121 Bacteria 890
185 Ga0207428_10000114 3300027907 Bacteria 109533
186 Ga0268266_10655384 3300028379 Bacteria 1010
187 Ga0268265_11433103 3300028380 Bacteria 693
188 Ga0268264_12412806 3300028381 Bacteria 532
189 Ga0265338_10695220 3300028800 Bacteria 702
190 Ga0265332_10001014 3300031238 Bacteria 16568
191 Ga0265332_10138971 3300031238 Bacteria 1018
192 Ga0265320_10089323 3300031240 Bacteria 1429
193 Ga0265325_10010969 3300031241 Bacteria 5220
194 Ga0265325_10033971 3300031241 Bacteria 2717
195 Ga0265329_10054249 3300031242 Bacteria 1273
196 Ga0265340_10003609 3300031247 Bacteria 8704
197 Ga0265340_10027937 3300031247 Bacteria 2841
198 Ga0265340_10033530 3300031247 Bacteria 2556
199 Ga0265339_10014704 3300031249 Bacteria 4712
200 Ga0265339_10125258 3300031249 Bacteria 1317
201 Ga0265331_10051074 3300031250 Bacteria 1980
202 Ga0265316_10486219 3300031344 Bacteria 883
203 Ga0265316_10623666 3300031344 Bacteria 763
204 Ga0265316_10732662 3300031344 Bacteria 696
205 Ga0265316_10740473 3300031344 Bacteria 691
206 Ga0307408_101949216 3300031548 Bacteria 564
207 Ga0265313_10032083 3300031595 Bacteria 2686
208 Ga0265313_10138679 3300031595 Bacteria 1047
209 Ga0316579_10070170 3300031691 Bacteria 1659
210 Ga0265314_10026124 3300031711 Bacteria 4393
211 Ga0265314_10040963 3300031711 Bacteria 3320
212 Ga0265314_10081831 3300031711 Bacteria 2126
213 Ga0265342_10000035 3300031712 Bacteria 142886
214 Ga0265342_10006164 3300031712 Bacteria 8973
215 Ga0307410_10640260 3300031852 Bacteria 891
216 Ga0307406_10482265 3300031901 Bacteria 1002
217 Ga0307407_10311264 3300031903 Bacteria 1102
218 Ga0307409_100344799 3300031995 Bacteria 1403
219 Ga0373950_0072400 3300034818 Bacteria 708
220 Ga0373958_0062854 3300034819 Bacteria 808
221 Ga0373944_0389693 3300035089 Bacteria 535
222 Ga0373923_0442374 3300035111 Bacteria 629
223 Ga0373953_0099499 3300035117 Bacteria 1223
224 Ga0373954_0121000 3300035118 Bacteria 1271
225 Ga0373954_0384003 3300035118 Bacteria 694
226 Ga0373957_0057885 3300035120 Bacteria 1496
227 Ga0373942_0182155 3300035207 Bacteria 689
228 Ga0373924_0017358 3300035410 Bacteria 2760
229 Ga0373935_0714734 3300035692 Bacteria 737
230 Ga0373935_0766202 3300035692 Bacteria 712
231 Ga0373927_0008005 3300035695 Bacteria 7137
232 Ga0373933_0029801 3300035724 Bacteria 3157
233 Ga0373937_0041486 3300036401 Bacteria 4197
234 Ga0373937_0076549 3300036401 Bacteria 3090
235 Ga0373937_0587949 3300036401 Bacteria 1057
236 Ga0316582_0403639 3300036647 Bacteria 942
237 Ga0373925_0174194 3300037068 Bacteria 1700
238 Ga0436365_0247085 3300039437 Bacteria 737
239 Ga0436365_0660080 3300039437 Bacteria 522
240 Ga0436365_1482850 3300039437 Bacteria 3588
241 Ga0436361_1026286 3300039447 Bacteria 1071
242 Ga0439453_0002205 3300041408 Bacteria 2652
243 Ga0439441_167281 3300042001 Bacteria 524
244 Ga0439456_100937 3300042013 Bacteria 653
245 Ga0439440_0046805 3300042993 Bacteria 1070
246 Ga0495580_0672391 3300046472 Bacteria 679
247 Ga0495594_0216951 3300046499 Bacteria 1091
248 Ga0495663_0188772 3300046525 Bacteria 716
249 Ga0495652_0625260 3300046529 Bacteria 732
250 Ga0495667_0423756 3300046559 Bacteria 837
251 Ga0495657_0079980 3300046675 Bacteria 2116
252 Ga0495647_0262311 3300046681 Bacteria 771
253 Ga0495658_0030857 3300046683 Bacteria 2914
254 Ga0495581_0099987 3300047315 Bacteria 1685
255 Ga0495674_0439222 3300047319 Bacteria 1050
256 Ga0495675_0340529 3300047444 Bacteria 884
257 Ga0495675_0494615 3300047444 Bacteria 703
258 Ga0495677_0147190 3300047445 Bacteria 906
259 Ga0495685_192926 3300047447 Bacteria 654
260 Ga0495602_0888081 3300048088 Bacteria 594
261 Ga0496100_0335288 3300048903 Bacteria 1139
262 Ga0496101_0033073 3300048904 Bacteria 3645
263 Ga0496101_0124459 3300048904 Bacteria 1952
264 Ga0496102_0007185 3300048905 Bacteria 9508
265 Ga0496102_0046107 3300048905 Bacteria 3958
266 Ga0496103_0004391 3300048906 Bacteria 8556
267 Ga0496103_0008881 3300048906 Bacteria 5962
268 Ga0496104_0333369 3300048907 Bacteria 1430
269 Ga0496106_0000882 3300048909 Bacteria 21853
270 Ga0496106_0009124 3300048909 Bacteria 7329
271 Ga0496107_0070414 3300048910 Bacteria 2539
272 Ga0496107_0087972 3300048910 Bacteria 2268
273 Ga0496108_0613826 3300048911 Bacteria 947
274 Ga0496110_0721747 3300048913 Bacteria 899
275 Ga0496114_0341888 3300048917 Bacteria 1323
276 Ga0496114_1016005 3300048917 Bacteria 713
277 Ga0496115_0238819 3300048918 Bacteria 1498
278 Ga0496115_0289281 3300048918 Bacteria 1344
279 Ga0501031_0224394 3300049568 Bacteria 1223
280 Ga0501033_0012284 3300049570 Bacteria 6536
281 Ga0501033_0311464 3300049570 Bacteria 1107
282 Ga0501034_0000852 3300049571 Bacteria 45151
283 Ga0501034_0031584 3300049571 Bacteria 5379
284 Ga0501034_0237056 3300049571 Bacteria 1771
285 Ga0501034_0426501 3300049571 Bacteria 1246
286 Ga0501034_0801521 3300049571 Bacteria 834
287 Ga0501036_0001075 3300049572 Bacteria 20707
288 Ga0501036_0022844 3300049572 Bacteria 5266
289 Ga0501037_0075028 3300049573 Bacteria 2456
290 Ga0501037_0158321 3300049573 Bacteria 1615
291 Ga0501038_0037771 3300049574 Bacteria 4233
292 Ga0501038_0543595 3300049574 Bacteria 884
293 Ga0501040_0155403 3300049576 Bacteria 1615
294 Ga0501041_0300052 3300049577 Bacteria 1012
295 Ga0501043_0007548 3300049579 Bacteria 8628
296 Ga0501043_0035106 3300049579 Bacteria 3944
297 Ga0501043_0441238 3300049579 Bacteria 979
298 Ga0501043_0627076 3300049579 Bacteria 792
299 Ga0501043_1283835 3300049579 Bacteria 511
300 Ga0501046_0020605 3300049580 Bacteria 5451
301 Ga0501046_0140579 3300049580 Bacteria 1827
302 Ga0501046_0262443 3300049580 Bacteria 1269
303 Ga0501047_0000010 3300049581 Bacteria 429357
304 Ga0501047_0014941 3300049581 Bacteria 7389
305 Ga0501047_0021524 3300049581 Bacteria 6192
306 Ga0501048_0000592 3300049582 Bacteria 25706
307 Ga0501048_0173757 3300049582 Bacteria 1527
308 Ga0501068_0016558 3300049584 Bacteria 4251
309 Ga0501069_0363464 3300049585 Bacteria 854
310 Ga0501070_0062172 3300049586 Bacteria 3093
311 Ga0501070_0069351 3300049586 Bacteria 2919
312 Ga0501070_0095867 3300049586 Bacteria 2454
313 Ga0501070_0745504 3300049586 Bacteria 772
314 Ga0501070_0804516 3300049586 Bacteria 738
315 Ga0501071_0236392 3300049587 Bacteria 1377
316 Ga0501072_0000680 3300049588 Bacteria 24530
317 Ga0501073_0174604 3300049589 Bacteria 1487
318 Ga0501073_0274427 3300049589 Bacteria 1163
319 Ga0501074_0072966 3300049590 Bacteria 2465
320 Ga0501074_0217109 3300049590 Bacteria 1362
321 Ga0501075_0060859 3300049591 Bacteria 2844
322 Ga0501075_1241598 3300049591 Bacteria 565
323 Ga0501076_0059611 3300049592 Bacteria 3036
324 Ga0501076_0416883 3300049592 Bacteria 1105
325 Ga0501077_0003496 3300049593 Bacteria 9432
326 Ga0501077_0357832 3300049593 Bacteria 932
327 Ga0501079_0015775 3300049741 Bacteria 5772
328 Ga0501080_0000314 3300049742 Bacteria 37074
329 Ga0501080_0041600 3300049742 Bacteria 4281
330 Ga0501080_0481689 3300049742 Bacteria 1110
331 Ga0501081_0004329 3300049743 Bacteria 9105
332 Ga0501083_0001213 3300049744 Bacteria 17449
333 Ga0501083_0190676 3300049744 Bacteria 1338
334 Ga0501083_0371796 3300049744 Bacteria 929
335 Ga0501083_0428177 3300049744 Bacteria 861
336 Ga0501083_0754485 3300049744 Bacteria 633
337 Ga0501035_0408554 3300049822 Bacteria 1128
338 Ga0501044_0007386 3300049823 Bacteria 12086
339 Ga0501044_0113361 3300049823 Bacteria 2718
340 Ga0501044_0529444 3300049823 Bacteria 1077
341 Ga0501044_1094144 3300049823 Bacteria 666
342 Ga0501044_1224411 3300049823 Bacteria 618
343 Ga0501044_1256288 3300049823 Bacteria 608
344 Ga0501044_1332376 3300049823 Bacteria 584
345 Ga0501045_0003578 3300049824 Bacteria 10671
346 nmdc:mga00v17_223602_c1 3300050491 Bacteria 1219
347 nmdc:mga00v17_266208_c1 3300050491 Bacteria 1112
348 nmdc:mga00v17_773361_c1 3300050491 Bacteria 613
349 nmdc:mga0yw44_1076907_c1 3300050492 Bacteria 543
350 nmdc:mga07m45_225486_c1 3300050496 Bacteria 801
351 nmdc:mga05p37_18617_c1 3300050507 Bacteria 8392
352 nmdc:mga05p37_56_c3 3300050507 Bacteria 77819
353 nmdc:mga05p37_853700_c1 3300050507 Bacteria 988
354 nmdc:mga09592_568257_c1 3300050508 Bacteria 973
355 nmdc:mga09592_7647_c1 3300050508 Bacteria 8788
356 nmdc:mga0qj67_19135_c1 3300050509 Bacteria 5230
357 nmdc:mga06r32_6105_c1 3300050510 Bacteria 10821
358 nmdc:mga08y16_206_c1 3300050511 Bacteria 46039
359 nmdc:mga08y16_246811_c1 3300050511 Bacteria 1845
360 nmdc:mga0n895_44250_c1 3300050512 Bacteria 4342
361 nmdc:mga0n895_4632_c1 3300050512 Bacteria 11339
362 nmdc:mga0rr50_134236_c1 3300050513 Bacteria 1985
363 nmdc:mga0rr50_67118_c1 3300050513 Bacteria 2724
364 nmdc:mga08x19_396159_c1 3300050514 Bacteria 968
365 nmdc:mga0a205_80_c1 3300050515 Bacteria 53083
366 Ga0495601_0079223 3300053077 Bacteria 2106
367 Ga0495595_0086134 3300053084 Bacteria 1503
368 Ga0495595_0184442 3300053084 Bacteria 1035
369 Ga0495619_0049763 3300053085 Bacteria 2764
370 Ga0495619_0538216 3300053085 Bacteria 802
371 Ga0500643_005433 3300053087 Bacteria 5491
372 Ga0500644_0000331 3300053088 Bacteria 24183
373 Ga0500651_0061251 3300053093 Bacteria 2351
374 Ga0500651_0420371 3300053093 Bacteria 748
375 Ga0500566_0061750 3300053094 Bacteria 2120
376 Ga0500650_0337777 3300053098 Bacteria 661
377 Ga0500555_050560 3300053103 Bacteria 1138
378 Ga0500595_000002 3300053119 Bacteria 1074388
379 Ga0500652_050488 3300053131 Bacteria 1697
380 Ga0500573_0439968 3300053140 Bacteria 606
381 Ga0500616_0000002 3300053153 Bacteria 1611257
382 Ga0500645_000471 3300053730 Bacteria 27490
383 Ga0501084_0066048 3300054114 Bacteria 3027
384 Ga0501082_0005507 3300060353 Bacteria 10990
385 Ga0501082_0109951 3300060353 Bacteria 2386
386 Ga0501082_0544216 3300060353 Bacteria 1015
387 Ga0530510_0016090 3300061734 Bacteria 5288
388 Ga0530510_0039846 3300061734 Bacteria 3390
389 2509075925 2508501114 Bacteria 7082538
390 2511389482 2511231027 Bacteria 5013807
391 2643756400 2643221547 Bacteria 4740017
392 2776260631 2775506901 Bacteria 9631051
393 2842872703 2842871566 Bacteria 4827117
394 2884300073 2884298095 Bacteria 3823049
395 2928523284 2928521798 Bacteria 4960112
396 2954015556 2954011201 Bacteria 4762601
397 8054564554 8054563764 Bacteria 5592885
398 Ga0265314_10005122
399 JGI25405J52794_10009376
400 Ga0070690_100448413
401 Ga0068869_100037141
402 Ga0068869_100499810
403 Ga0070680_100190149
404 Ga0070682_100006521
405 Ga0070660_100019880
406 Ga0070689_101843435
407 Ga0070691_10007196
408 Ga0070691_10077528
409 Ga0070691_10694782
410 Ga0070687_100960188
411 Ga0070692_10173030
412 Ga0070668_100517475
413 Ga0070668_101661818
414 Ga0070673_100052909
415 Ga0070673_100724050
416 Ga0070659_100035177
417 Ga0070703_10019196
418 Ga0070709_10681802
419 Ga0070714_100633025
420 Ga0070710_11093856
421 Ga0070701_10706261
422 Ga0070711_100317869
423 Ga0070705_100002824
424 Ga0070705_100036473
425 Ga0070705_100251292
426 Ga0070700_100005113
427 Ga0070700_100087643
428 Ga0070694_100001395
429 Ga0070694_100034848
430 Ga0070708_100030598
431 Ga0070663_100135054
432 Ga0070663_100407678
433 Ga0070678_100841897
434 Ga0070662_100714910
435 Ga0070662_101682807
436 Ga0070681_10050829
437 Ga0070681_10084993
438 Ga0068867_101131369
439 Ga0070707_100669273
440 Ga0070698_100937241
441 Ga0070699_100000903
442 Ga0070699_100001464
443 Ga0070679_100068033
444 Ga0068853_101174949
445 Ga0068853_101631435
446 Ga0070672_100098801
447 Ga0070686_100406900
448 Ga0070686_100899565
449 Ga0070686_101772743
450 Ga0070695_100000639
451 Ga0070695_100011521
452 Ga0070696_100002167
453 Ga0070696_100006694
454 Ga0070693_100060141
455 Ga0070665_100587256
456 Ga0070704_100001558
457 Ga0070704_100135482
458 Ga0070664_100112560
459 Ga0068856_102202813
460 Ga0070702_100046729
461 Ga0070702_100074178
462 Ga0068864_102466942
463 Ga0068866_10743504
464 Ga0068861_100227118
465 Ga0068851_10954985
466 Ga0068870_11089434
467 Ga0068858_100175782
468 Ga0068860_101212044
469 Ga0068862_100001758
470 Ga0068862_100799326
471 Ga0081455_10011971
472 Ga0081540_1015934
473 Ga0075363_100855160
474 Ga0075364_10208508
475 Ga0075364_10485452
476 Ga0075364_10717784
477 Ga0075432_10033056
478 Ga0075367_10697155
479 Ga0075427_10010950
480 Ga0075366_10909684
481 Ga0097621_100188337
482 Ga0075370_10325490
483 Ga0068871_100130541
484 Ga0068871_100635864
485 Ga0075428_100017835
486 Ga0075428_100030168
487 Ga0075430_100004696
488 Ga0075430_100064231
489 Ga0075431_100006639
490 Ga0075433_10001599
491 Ga0075434_100000576
492 Ga0075434_100943061
493 Ga0075429_100050787
494 Ga0075436_100469752
495 Ga0075435_100156307
496 Ga0105250_10205428
497 Ga0105240_11570974
498 Ga0111539_10000503
499 Ga0111539_10038117
500 Ga0105245_10024222
501 Ga0105245_10083234
502 Ga0105245_10559277
503 Ga0114129_10013874
504 Ga0114129_10029505
505 Ga0114129_10330763
506 Ga0114129_10716327
507 Ga0105243_10027825
508 Ga0105243_10130121
509 Ga0105243_11118624
510 Ga0105241_10004682
511 Ga0105242_10876113
512 Ga0105248_10019008
513 Ga0105237_10083294
514 Ga0105237_10105963
515 Ga0105238_10058399
516 Ga0105249_10001768
517 Ga0105239_10391703
518 Ga0105246_10084012
519 Ga0105246_10194096
520 Ga0105246_10313229
521 Ga0105246_10720271
522 Ga0157373_10406496
523 Ga0157370_10303577
524 Ga0157370_10331096
525 Ga0157369_10423552
526 Ga0157374_10674612
527 Ga0157374_11100660
528 Ga0157378_10041471
529 Ga0157378_10402037
530 Ga0157378_10628199
531 Ga0163162_10096507
532 Ga0157375_10045104
533 Ga0157375_10308379
534 Ga0157380_10063356
535 Ga0157380_10610437
536 Ga0157380_10853078
537 Ga0157376_10142775
538 Ga0157376_10350002
539 Ga0163161_11184326
540 Ga0213873_10177064
541 Ga0224572_1098376
542 Ga0207682_10082211
543 Ga0207642_10708092
544 Ga0207688_10053711
545 Ga0207647_10149075
546 Ga0207707_10082985
547 Ga0207671_10608623
548 Ga0207663_10047280
549 Ga0207657_10204636
550 Ga0207652_10329877
551 Ga0207650_10465239
552 Ga0207659_11674738
553 Ga0207687_10020034
554 Ga0207700_10368164
555 Ga0207664_10264901
556 Ga0207644_10638547
557 Ga0207690_10006521
558 Ga0207706_10809845
559 Ga0207706_11175361
560 Ga0207686_10458074
561 Ga0207709_10074251
562 Ga0207709_10613326
563 Ga0207669_10051532
564 Ga0207691_10089680
565 Ga0207679_10109375
566 Ga0207651_10164009
567 Ga0207651_10249516
568 Ga0207703_10034453
569 Ga0207639_11314480
570 Ga0207678_10000594
571 Ga0207708_10003552
572 Ga0207708_10079749
573 Ga0207702_12060726
574 Ga0207648_10025772
575 Ga0207676_10273487
576 Ga0207674_10055194
577 Ga0207675_100224019
578 Ga0207675_100293685
579 Ga0207675_101367119
580 Ga0207683_10046174
581 Ga0207683_10775419
582 Ga0207428_10000114
583 Ga0268266_10655384
584 Ga0268265_11433103
585 Ga0268264_12412806
586 Ga0265338_10695220
587 Ga0265332_10001014
588 Ga0265332_10138971
589 Ga0265320_10089323
590 Ga0265325_10010969
591 Ga0265325_10033971
592 Ga0265329_10054249
593 Ga0265340_10003609
594 Ga0265340_10027937
595 Ga0265340_10033530
596 Ga0265339_10014704
597 Ga0265339_10125258
598 Ga0265331_10051074
599 Ga0265316_10486219
600 Ga0265316_10623666
601 Ga0265316_10732662
602 Ga0265316_10740473
603 Ga0307408_101949216
604 Ga0265313_10032083
605 Ga0265313_10138679
606 Ga0316579_10070170
607 Ga0265314_10026124
608 Ga0265314_10040963
609 Ga0265314_10081831
610 Ga0265342_10000035
611 Ga0265342_10006164
612 Ga0307410_10640260
613 Ga0307406_10482265
614 Ga0307407_10311264
615 Ga0307409_100344799
616 Ga0373950_0072400
617 Ga0373958_0062854
618 Ga0373944_0389693
619 Ga0373923_0442374
620 Ga0373953_0099499
621 Ga0373954_0121000
622 Ga0373954_0384003
623 Ga0373957_0057885
624 Ga0373942_0182155
625 Ga0373924_0017358
626 Ga0373935_0714734
627 Ga0373935_0766202
628 Ga0373927_0008005
629 Ga0373933_0029801
630 Ga0373937_0041486
631 Ga0373937_0076549
632 Ga0373937_0587949
633 Ga0316582_0403639
634 Ga0373925_0174194
635 Ga0436365_0247085
636 Ga0436365_0660080
637 Ga0436365_1482850
638 Ga0436361_1026286
639 Ga0439453_0002205
640 Ga0439441_167281
641 Ga0439456_100937
642 Ga0439440_0046805
643 Ga0495580_0672391
644 Ga0495594_0216951
645 Ga0495663_0188772
646 Ga0495652_0625260
647 Ga0495667_0423756
648 Ga0495657_0079980
649 Ga0495647_0262311
650 Ga0495658_0030857
651 Ga0495581_0099987
652 Ga0495674_0439222
653 Ga0495675_0340529
654 Ga0495675_0494615
655 Ga0495677_0147190
656 Ga0495685_192926
657 Ga0495602_0888081
658 Ga0496100_0335288
659 Ga0496101_0033073
660 Ga0496101_0124459
661 Ga0496102_0007185
662 Ga0496102_0046107
663 Ga0496103_0004391
664 Ga0496103_0008881
665 Ga0496104_0333369
666 Ga0496106_0000882
667 Ga0496106_0009124
668 Ga0496107_0070414
669 Ga0496107_0087972
670 Ga0496108_0613826
671 Ga0496110_0721747
672 Ga0496114_0341888
673 Ga0496114_1016005
674 Ga0496115_0238819
675 Ga0496115_0289281
676 Ga0501031_0224394
677 Ga0501033_0012284
678 Ga0501033_0311464
679 Ga0501034_0000852
680 Ga0501034_0031584
681 Ga0501034_0237056
682 Ga0501034_0426501
683 Ga0501034_0801521
684 Ga0501036_0001075
685 Ga0501036_0022844
686 Ga0501037_0075028
687 Ga0501037_0158321
688 Ga0501038_0037771
689 Ga0501038_0543595
690 Ga0501040_0155403
691 Ga0501041_0300052
692 Ga0501043_0007548
693 Ga0501043_0035106
694 Ga0501043_0441238
695 Ga0501043_0627076
696 Ga0501043_1283835
697 Ga0501046_0020605
698 Ga0501046_0140579
699 Ga0501046_0262443
700 Ga0501047_0000010
701 Ga0501047_0014941
702 Ga0501047_0021524
703 Ga0501048_0000592
704 Ga0501048_0173757
705 Ga0501068_0016558
706 Ga0501069_0363464
707 Ga0501070_0062172
708 Ga0501070_0069351
709 Ga0501070_0095867
710 Ga0501070_0745504
711 Ga0501070_0804516
712 Ga0501071_0236392
713 Ga0501072_0000680
714 Ga0501073_0174604
715 Ga0501073_0274427
716 Ga0501074_0072966
717 Ga0501074_0217109
718 Ga0501075_0060859
719 Ga0501075_1241598
720 Ga0501076_0059611
721 Ga0501076_0416883
722 Ga0501077_0003496
723 Ga0501077_0357832
724 Ga0501079_0015775
725 Ga0501080_0000314
726 Ga0501080_0041600
727 Ga0501080_0481689
728 Ga0501081_0004329
729 Ga0501083_0001213
730 Ga0501083_0190676
731 Ga0501083_0371796
732 Ga0501083_0428177
733 Ga0501083_0754485
734 Ga0501035_0408554
735 Ga0501044_0007386
736 Ga0501044_0113361
737 Ga0501044_0529444
738 Ga0501044_1094144
739 Ga0501044_1224411
740 Ga0501044_1256288
741 Ga0501044_1332376
742 Ga0501045_0003578
743 nmdc:mga00v17_223602_c1
744 nmdc:mga00v17_266208_c1
745 nmdc:mga00v17_773361_c1
746 nmdc:mga0yw44_1076907_c1
747 nmdc:mga07m45_225486_c1
748 nmdc:mga05p37_18617_c1
749 nmdc:mga05p37_56_c3
750 nmdc:mga05p37_853700_c1
751 nmdc:mga09592_568257_c1
752 nmdc:mga09592_7647_c1
753 nmdc:mga0qj67_19135_c1
754 nmdc:mga06r32_6105_c1
755 nmdc:mga08y16_206_c1
756 nmdc:mga08y16_246811_c1
757 nmdc:mga0n895_44250_c1
758 nmdc:mga0n895_4632_c1
759 nmdc:mga0rr50_134236_c1
760 nmdc:mga0rr50_67118_c1
761 nmdc:mga08x19_396159_c1
762 nmdc:mga0a205_80_c1
763 Ga0495601_0079223
764 Ga0495595_0086134
765 Ga0495595_0184442
766 Ga0495619_0049763
767 Ga0495619_0538216
768 Ga0500643_005433
769 Ga0500644_0000331
770 Ga0500651_0061251
771 Ga0500651_0420371
772 Ga0500566_0061750
773 Ga0500650_0337777
774 Ga0500555_050560
775 Ga0500595_000002
776 Ga0500652_050488
777 Ga0500573_0439968
778 Ga0500616_0000002
779 Ga0500645_000471
780 Ga0501084_0066048
781 Ga0501082_0005507
782 Ga0501082_0109951
783 Ga0501082_0544216
784 Ga0530510_0016090
785 Ga0530510_0039846
786 2509075925
787 2511389482
788 2643756400
789 2776260631
790 2842872703
791 2884300073
792 2928523284
793 2954015556
794 8054564554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08755

YccV-like

Hemimethylated DNA-binding protein YccV like

26

120

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ycq-assembly1.cif.gz_A unique specificity-enhancing factor for the aaa+ lon protease 0.7861 7 92
1nz9-assembly1.cif.gz_A solution structure of the n-utilization substance g (nusg) c-terminal (ngc) domain from thermus thermophilus 0.7543 9 79
8fkv-assembly1.cif.gz_LE human nucleolar pre-60s ribosomal subunit (state d1) 0.7537 9 81
2xhc-assembly1.cif.gz_A crystal structure of thermotoga maritima n-utilization substance g (nusg) 0.7355 8 79
7xn7-assembly1.cif.gz_W rna polymerase ii elongation complex containing spt4/5, elf1, spt6, spn1 and paf1c 0.7143 9 81
ID Description Score Start End Superfamily
af_Q67Y99_203_301_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.8322 6 98 2.30.30.390
af_Q7YTU9_87_190_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.8169 8 105 2.30.30.390
af_F1M5Q6_492_592_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.8065 9 108 2.30.30.390
af_E9QDW7_114_220_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.7949 9 105 2.30.30.390
af_Q9V460_456_512_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.7948 8 79 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A3D2VYI3-F1-model_v4 Heat shock protein HspQ 0.9823 6 104 GO:0003677
AF-A0A259D078-F1-model_v4 deleted 0.9822 3 105
AF-A0A519YQW3-F1-model_v4 deleted 0.9753 5 90
AF-A0A6N9ASG2-F1-model_v4 Heat shock protein HspQ 0.9752 7 62 GO:0003677
AF-A0A1H8F3J5-F1-model_v4 Heat shock protein HspQ 0.9717 1 107 GO:0003677

Map