F433833

General Info

Members Datasets Scaffolds Average Seq Length
397 260 794 193

Family's Representative Sequence

Representative Sequence 3300041406|Ga0439439_0000816|Ga0439439_0000816_4303_4989
Length 228
Sequence MPDRTDRIAPTGPQRHESASAAEFSVFLEATAIRHENRPMPTDTLPPLSRQFIAHFGEMGSKWGINRTVGQIYALIFISERALNADEIAEALAFSRSNVSMGLKELQSWRLVRLRHQPGDRREYFEAPSDVWEIFRVLAEERRRREIEPTLSMLRMALLEKPTTDEERHAQQRMREMHDLIDRLMKWFDDVQRLAPETAMQLMGMGATVTKVLGLKDRITGAKGKKAV

Samples

Sample ID Description Type Environment
1 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
103 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
128 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
133 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
134 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
135 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
136 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
137 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
138 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
141 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
142 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
143 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
144 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
145 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
146 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
147 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
148 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
149 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
150 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
151 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
152 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
153 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
154 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
155 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
222 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
223 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
224 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
236 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
237 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
238 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
241 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
242 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
243 2547132374 Acidovorax radicis N35 Isolate Unclassified
244 2643221609 Acidovorax sp. Root217 Isolate Unclassified
245 2643221611 Acidovorax sp. Root219 Isolate Unclassified
246 2643221660 Methylibium sp. Root1272 Isolate Unclassified
247 2643221717 Acidovorax sp. Root267 Isolate Unclassified
248 2721755523 Delftia sp. HK171 Isolate Unclassified
249 2818991436 Collimonas arenae 515 Isolate Unclassified
250 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
251 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
252 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
253 2842733646 Variovorax sp. R-72446 Isolate Unclassified
254 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
255 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
256 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
257 2919476304 Duganella sp. 3397 Isolate Unclassified
258 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
259 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
260 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.47
Metatranscriptomes 0
Isolates 4.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.66
Nodule 0.5
Rhizoplane 2.27
Rhizosphere 61.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439439_0000816 3300041406 Bacteria 5672
2 JGI25162J39368_1000131 3300002737 Bacteria 81755
3 JGI25162J39368_1000370 3300002737 Bacteria 38244
4 JGI25164J39214_1003182 3300002772 Bacteria 2167
5 JGI25165J46597_1000022 3300003214 Bacteria 357959
6 Ga0055538_1000011 3300003751 Bacteria 357959
7 Ga0055539_1000016 3300003752 Bacteria 358248
8 Ga0055533_1000019 3300003756 Bacteria 357959
9 Ga0055525_1000042 3300003759 Bacteria 279804
10 Ga0055525_1000173 3300003759 Bacteria 81767
11 Ga0055541_1000017 3300003841 Bacteria 286811
12 Ga0055541_1000084 3300003841 Bacteria 81767
13 Ga0065714_10096727 3300005288 Bacteria 1753
14 Ga0065714_10198816 3300005288 Bacteria 902
15 Ga0065704_10099156 3300005289 Bacteria 2323
16 Ga0070658_10305132 3300005327 Bacteria 1358
17 Ga0070660_100031645 3300005339 Bacteria 3975
18 Ga0070668_100334567 3300005347 Bacteria 1278
19 Ga0070669_100035144 3300005353 Bacteria 3630
20 Ga0070675_101179232 3300005354 Bacteria 705
21 Ga0070673_100150141 3300005364 Bacteria 1973
22 Ga0070659_100001694 3300005366 Bacteria 15853
23 Ga0070667_100125903 3300005367 Bacteria 2233
24 Ga0070708_100570895 3300005445 Bacteria 1067
25 Ga0070663_100010841 3300005455 Bacteria 5695
26 Ga0070678_100026881 3300005456 Bacteria 3898
27 Ga0070678_100054534 3300005456 Bacteria 2914
28 Ga0070678_101370755 3300005456 Bacteria 659
29 Ga0070662_100026594 3300005457 Bacteria 4009
30 Ga0068867_100044524 3300005459 Bacteria 3252
31 Ga0068867_100928088 3300005459 Bacteria 785
32 Ga0070706_100003421 3300005467 Bacteria 15654
33 Ga0070707_100050657 3300005468 Bacteria 3981
34 Ga0070698_100344350 3300005471 Bacteria 1422
35 Ga0068853_100165050 3300005539 Bacteria 2001
36 Ga0068853_100355253 3300005539 Bacteria 1364
37 Ga0070665_100315602 3300005548 Bacteria 1567
38 Ga0070664_100000939 3300005564 Bacteria 22774
39 Ga0068857_100080512 3300005577 Bacteria 2908
40 Ga0068852_101131062 3300005616 Bacteria 803
41 Ga0068864_100551292 3300005618 Bacteria 1114
42 Ga0068860_101051281 3300005843 Bacteria 833
43 Ga0075365_10010392 3300006038 Bacteria 5418
44 Ga0075365_10250830 3300006038 Bacteria 1244
45 Ga0075365_10530028 3300006038 Bacteria 833
46 Ga0075368_10024174 3300006042 Bacteria 2325
47 Ga0075368_10079437 3300006042 Bacteria 1333
48 Ga0075363_100092229 3300006048 Bacteria 1668
49 Ga0075363_100153007 3300006048 Bacteria 1303
50 Ga0075363_100428095 3300006048 Bacteria 780
51 Ga0075364_10319969 3300006051 Bacteria 1056
52 Ga0070716_100194190 3300006173 Bacteria 1344
53 Ga0075362_10001502 3300006177 Bacteria 7497
54 Ga0075362_10017083 3300006177 Bacteria 2984
55 Ga0075362_10110771 3300006177 Bacteria 1292
56 Ga0075362_10110803 3300006177 Bacteria 1292
57 Ga0075362_10189580 3300006177 Bacteria 998
58 Ga0075367_10013975 3300006178 Bacteria 4334
59 Ga0075367_10034975 3300006178 Bacteria 2905
60 Ga0075367_10078199 3300006178 Bacteria 1997
61 Ga0075367_10357193 3300006178 Bacteria 922
62 Ga0075369_10012535 3300006186 Bacteria 3350
63 Ga0075366_10001005 3300006195 Bacteria 13778
64 Ga0075366_10003168 3300006195 Bacteria 8617
65 Ga0075366_10006875 3300006195 Bacteria 6259
66 Ga0075366_10026606 3300006195 Bacteria 3389
67 Ga0075366_10040929 3300006195 Bacteria 2741
68 Ga0075366_10044522 3300006195 Bacteria 2630
69 Ga0075370_10004907 3300006353 Bacteria 6570
70 Ga0075370_10006166 3300006353 Bacteria 6014
71 Ga0075370_10013190 3300006353 Bacteria 4386
72 Ga0075370_10044485 3300006353 Bacteria 2510
73 Ga0068865_100914009 3300006881 Bacteria 764
74 Ga0105240_10010309 3300009093 Bacteria 13156
75 Ga0114129_10030221 3300009147 Bacteria 7672
76 Ga0105242_10437059 3300009176 Bacteria 1230
77 Ga0105242_11099025 3300009176 Bacteria 809
78 Ga0105248_10007009 3300009177 Bacteria 12342
79 Ga0105248_10050398 3300009177 Bacteria 4669
80 Ga0105248_11510105 3300009177 Bacteria 761
81 Ga0105237_10008586 3300009545 Bacteria 11047
82 Ga0105237_10014572 3300009545 Bacteria 8216
83 Ga0105238_10127702 3300009551 Bacteria 2521
84 Ga0105249_11001558 3300009553 Bacteria 904
85 Ga0105239_10002709 3300010375 Bacteria 22282
86 Ga0105239_10016215 3300010375 Bacteria 8242
87 Ga0157373_10013449 3300013100 Bacteria 6004
88 Ga0157370_10258911 3300013104 Bacteria 1608
89 Ga0163162_10264143 3300013306 Bacteria 1853
90 Ga0157375_10866702 3300013308 Bacteria 1049
91 Ga0182008_10021722 3300014497 Bacteria 3295
92 Ga0182008_10033537 3300014497 Bacteria 2576
93 Ga0157376_10668247 3300014969 Bacteria 1041
94 Ga0182006_1000035 3300015261 Bacteria 232349
95 Ga0182006_1000054 3300015261 Bacteria 174021
96 Ga0182006_1002575 3300015261 Bacteria 9828
97 Ga0182006_1008780 3300015261 Bacteria 4571
98 Ga0182006_1022667 3300015261 Bacteria 2608
99 Ga0182006_1067666 3300015261 Bacteria 1332
100 Ga0182007_10000040 3300015262 Bacteria 120364
101 Ga0182007_10004694 3300015262 Bacteria 6160
102 Ga0182007_10007657 3300015262 Bacteria 4500
103 Ga0182007_10105831 3300015262 Bacteria 934
104 Ga0182005_1000012 3300015265 Bacteria 396944
105 Ga0182005_1000025 3300015265 Bacteria 235532
106 Ga0182005_1000351 3300015265 Bacteria 26159
107 Ga0182005_1095800 3300015265 Bacteria 828
108 Ga0183362_10001 3300015683 Bacteria 2046624
109 Ga0163161_10130614 3300017792 Bacteria 1894
110 Ga0163161_10212947 3300017792 Bacteria 1493
111 Ga0209784_100019 3300025224 Bacteria 453558
112 Ga0209566_100017 3300025225 Bacteria 453558
113 Ga0209674_100031 3300025226 Bacteria 453558
114 Ga0209563_100035 3300025230 Bacteria 453558
115 Ga0207427_101950 3300025231 Bacteria 6345
116 Ga0209437_100038 3300025233 Bacteria 453558
117 Ga0209677_100020 3300025253 Bacteria 453558
118 Ga0209233_1000049 3300025261 Bacteria 453558
119 Ga0207680_10025347 3300025903 Bacteria 3271
120 Ga0207645_10123542 3300025907 Bacteria 1682
121 Ga0207684_10016021 3300025910 Bacteria 6438
122 Ga0207695_10016767 3300025913 Bacteria 8552
123 Ga0207695_10242346 3300025913 Bacteria 1704
124 Ga0207671_10027278 3300025914 Bacteria 4270
125 Ga0207671_10527087 3300025914 Bacteria 942
126 Ga0207657_10071613 3300025919 Bacteria 2935
127 Ga0207649_10001323 3300025920 Bacteria 14731
128 Ga0207646_10040699 3300025922 Bacteria 4179
129 Ga0207681_10477918 3300025923 Bacteria 1017
130 Ga0207694_10010847 3300025924 Bacteria 6878
131 Ga0207690_10004800 3300025932 Bacteria 7976
132 Ga0207706_10314711 3300025933 Bacteria 1363
133 Ga0207706_10788730 3300025933 Bacteria 808
134 Ga0207669_10166736 3300025937 Bacteria 1563
135 Ga0207669_10393800 3300025937 Bacteria 1083
136 Ga0207665_10245135 3300025939 Bacteria 1322
137 Ga0207711_10758814 3300025941 Bacteria 904
138 Ga0207679_10000201 3300025945 Bacteria 48099
139 Ga0207679_11082059 3300025945 Bacteria 735
140 Ga0207651_10158797 3300025960 Bacteria 1770
141 Ga0207651_10989927 3300025960 Bacteria 751
142 Ga0207712_10830398 3300025961 Bacteria 814
143 Ga0207668_10404934 3300025972 Bacteria 1154
144 Ga0207640_10075050 3300025981 Bacteria 2290
145 Ga0207639_10164868 3300026041 Bacteria 1871
146 Ga0207639_10588471 3300026041 Bacteria 1025
147 Ga0207678_10054402 3300026067 Bacteria 3447
148 Ga0207641_10517963 3300026088 Bacteria 1160
149 Ga0207641_10937058 3300026088 Bacteria 861
150 Ga0207648_10058885 3300026089 Bacteria 3350
151 Ga0207676_10121556 3300026095 Bacteria 2203
152 Ga0207674_10106327 3300026116 Bacteria 2784
153 Ga0207675_100379777 3300026118 Bacteria 1389
154 Ga0207683_10013526 3300026121 Bacteria 6962
155 Ga0207683_10234025 3300026121 Bacteria 1675
156 Ga0207683_10783109 3300026121 Bacteria 885
157 Ga0207698_10060244 3300026142 Bacteria 2951
158 Ga0207698_10947971 3300026142 Bacteria 869
159 Ga0209281_1025665 3300027111 Bacteria 1096
160 Ga0209813_10032190 3300027866 Bacteria 1553
161 Ga0209974_10005575 3300027876 Bacteria 4423
162 Ga0268266_10919454 3300028379 Bacteria 846
163 Ga0307517_10000174 3300028786 Bacteria 105578
164 Ga0307515_10000954 3300028794 Bacteria 66117
165 Ga0307515_10001052 3300028794 Bacteria 63228
166 Ga0307515_10048555 3300028794 Bacteria 6414
167 Ga0307512_10196728 3300030522 Bacteria 1100
168 Ga0307512_10287840 3300030522 Bacteria 778
169 Ga0265327_10000341 3300031251 Bacteria 88581
170 Ga0265327_10001863 3300031251 Bacteria 24454
171 Ga0265327_10008281 3300031251 Bacteria 7786
172 Ga0265316_10000181 3300031344 Bacteria 71764
173 Ga0307513_10013362 3300031456 Bacteria 10082
174 Ga0307513_10218812 3300031456 Bacteria 1728
175 Ga0307509_10000904 3300031507 Bacteria 50711
176 Ga0307509_10011898 3300031507 Bacteria 10462
177 Ga0307509_10092522 3300031507 Bacteria 3090
178 Ga0307408_100064307 3300031548 Bacteria 2686
179 Ga0307408_100068496 3300031548 Bacteria 2613
180 Ga0307408_100402166 3300031548 Bacteria 1176
181 Ga0307408_100624584 3300031548 Bacteria 960
182 Ga0307408_100786131 3300031548 Bacteria 862
183 Ga0307508_10000911 3300031616 Bacteria 34435
184 Ga0307508_10068258 3300031616 Bacteria 3125
185 Ga0307508_10135072 3300031616 Bacteria 2070
186 Ga0307514_10003805 3300031649 Bacteria 14199
187 Ga0307516_10005347 3300031730 Bacteria 15436
188 Ga0307516_10316962 3300031730 Bacteria 1231
189 Ga0307405_10291937 3300031731 Bacteria 1233
190 Ga0307406_10570720 3300031901 Bacteria 928
191 Ga0307412_10145537 3300031911 Bacteria 1741
192 Ga0307412_10194477 3300031911 Bacteria 1536
193 Ga0307412_10205636 3300031911 Bacteria 1498
194 Ga0307412_11282537 3300031911 Bacteria 659
195 Ga0307414_10020097 3300032004 Bacteria 4154
196 Ga0307510_10225981 3300033180 Bacteria 1379
197 Ga0373930_0027111 3300034816 Bacteria 1159
198 Ga0373931_0048127 3300035691 Bacteria 2259
199 Ga0395899_0192186 3300037312 Bacteria 1428
200 Ga0395905_0089897 3300037471 Bacteria 2878
201 Ga0395905_0134563 3300037471 Bacteria 2325
202 Ga0395905_0422391 3300037471 Bacteria 1229
203 Ga0395905_0617948 3300037471 Bacteria 985
204 Ga0395901_0084141 3300038443 Bacteria 3325
205 Ga0439439_0088582 3300041406 Bacteria 843
206 Ga0439447_087827 3300041407 Bacteria 716
207 Ga0439461_0007771 3300041410 Bacteria 1910
208 Ga0439466_0004196 3300041411 Bacteria 5559
209 Ga0439466_0009742 3300041411 Bacteria 3583
210 Ga0439465_0000786 3300041413 Bacteria 9908
211 Ga0451807_1136989 3300041486 Bacteria 697
212 Ga0451835_0392221 3300041492 Bacteria 1480
213 Ga0451845_0274005 3300041501 Bacteria 1046
214 Ga0439431_0003163 3300041997 Bacteria 3620
215 Ga0439431_0105925 3300041997 Bacteria 776
216 Ga0439433_0000470 3300041999 Bacteria 7440
217 Ga0439441_059350 3300042001 Bacteria 803
218 Ga0439445_0000144 3300042004 Bacteria 12650
219 Ga0439432_002552 3300042006 Bacteria 6867
220 Ga0439432_009880 3300042006 Bacteria 3319
221 Ga0439449_0000477 3300042007 Bacteria 14977
222 Ga0439449_0002907 3300042007 Bacteria 6661
223 Ga0439449_0007248 3300042007 Bacteria 4216
224 Ga0439452_001451 3300042010 Bacteria 9676
225 Ga0439452_009011 3300042010 Bacteria 2967
226 Ga0439457_003298 3300042014 Bacteria 4417
227 Ga0439457_005237 3300042014 Bacteria 3284
228 Ga0439462_0002663 3300042015 Bacteria 4188
229 Ga0439462_0004834 3300042015 Bacteria 3305
230 Ga0450911_001695 3300042115 Bacteria 4847
231 Ga0450919_001758 3300042121 Bacteria 2828
232 Ga0450921_004840 3300042123 Bacteria 999
233 Ga0450923_001976 3300042125 Bacteria 2847
234 Ga0450890_010093 3300042127 Bacteria 1214
235 Ga0450895_013990 3300042132 Bacteria 707
236 Ga0450899_011962 3300042135 Bacteria 972
237 Ga0439446_0027773 3300042156 Bacteria 1625
238 Ga0450909_005156 3300042185 Bacteria 1880
239 Ga0439434_0000884 3300042435 Bacteria 8630
240 Ga0439434_0069523 3300042435 Bacteria 1107
241 Ga0450916_013672 3300042530 Bacteria 1050
242 Ga0450918_013461 3300042531 Bacteria 1423
243 Ga0450893_0011165 3300042532 Bacteria 1482
244 Ga0450893_0022850 3300042532 Bacteria 1085
245 Ga0451577_0001786 3300042876 Bacteria 27587
246 Ga0466969_0006705 3300044656 Bacteria 6122
247 Ga0466972_0064354 3300044658 Bacteria 1755
248 Ga0466965_0018304 3300044683 Bacteria 3357
249 Ga0466965_0229922 3300044683 Bacteria 990
250 Ga0466966_0015196 3300044684 Bacteria 5093
251 Ga0466961_0129160 3300044693 Bacteria 1584
252 Ga0453684_1045825 3300044712 Bacteria 866
253 Ga0466971_0185180 3300044719 Bacteria 980
254 Ga0466970_0112594 3300044765 Bacteria 1487
255 Ga0466970_0349128 3300044765 Bacteria 839
256 Ga0466960_0122597 3300044901 Bacteria 1363
257 Ga0466960_0149415 3300044901 Bacteria 1247
258 Ga0451576_0262953 3300045051 Bacteria 1804
259 Ga0495592_0028419 3300046454 Bacteria 4236
260 Ga0495629_0670946 3300046459 Bacteria 690
261 Ga0495651_0540485 3300046462 Bacteria 741
262 Ga0495653_0015181 3300046463 Bacteria 6279
263 Ga0495650_0004936 3300046471 Bacteria 8909
264 Ga0495639_0025635 3300046475 Bacteria 2601
265 Ga0495608_0006949 3300046511 Bacteria 8013
266 Ga0495610_0053794 3300046512 Bacteria 1948
267 Ga0495628_0001453 3300046516 Bacteria 21731
268 Ga0495632_0011336 3300046519 Bacteria 5205
269 Ga0495663_0080625 3300046525 Bacteria 1048
270 Ga0495666_0136525 3300046526 Bacteria 1145
271 Ga0495666_0321044 3300046526 Bacteria 699
272 Ga0495652_0005080 3300046529 Bacteria 12452
273 Ga0495652_0029637 3300046529 Bacteria 4807
274 Ga0495654_0001761 3300046530 Bacteria 14505
275 Ga0495654_0032722 3300046530 Bacteria 2635
276 Ga0495609_0117567 3300046538 Bacteria 1145
277 Ga0495597_0001824 3300046542 Bacteria 14575
278 Ga0495597_0004186 3300046542 Bacteria 7997
279 Ga0495645_0112192 3300046543 Bacteria 1928
280 Ga0495645_0168537 3300046543 Bacteria 1509
281 Ga0495645_0203138 3300046543 Bacteria 1342
282 Ga0495622_0075587 3300046557 Bacteria 1552
283 Ga0495633_0000271 3300046558 Bacteria 60538
284 Ga0495633_0010681 3300046558 Bacteria 4996
285 Ga0495656_0000060 3300046615 Bacteria 52471
286 Ga0495668_0244807 3300046616 Bacteria 982
287 Ga0495625_0149137 3300046660 Bacteria 1573
288 Ga0495635_0296402 3300046663 Bacteria 1085
289 Ga0495646_0009890 3300046680 Bacteria 6060
290 Ga0495646_0164006 3300046680 Bacteria 1228
291 Ga0495658_0337171 3300046683 Bacteria 957
292 Ga0495624_0011627 3300046690 Bacteria 6046
293 Ga0495624_0113738 3300046690 Bacteria 1664
294 Ga0495649_0021230 3300046694 Bacteria 3639
295 Ga0495600_0000303 3300046809 Bacteria 26375
296 Ga0495660_0169772 3300046810 Bacteria 1063
297 Ga0495604_0007470 3300047317 Bacteria 8653
298 Ga0495636_0172244 3300047318 Bacteria 979
299 Ga0495687_000327 3300047443 Bacteria 61677
300 Ga0495687_017242 3300047443 Bacteria 3608
301 Ga0495686_0007124 3300047472 Bacteria 8422
302 Ga0495593_0341242 3300047673 Bacteria 749
303 Ga0495602_0345797 3300048088 Bacteria 1074
304 Ga0495615_0007994 3300048090 Bacteria 2028
305 Ga0496101_0004597 3300048904 Bacteria 8715
306 Ga0496102_0021528 3300048905 Bacteria 5702
307 Ga0496103_0324065 3300048906 Bacteria 991
308 Ga0496104_0163155 3300048907 Bacteria 2137
309 Ga0496105_0057687 3300048908 Bacteria 3205
310 Ga0496108_0790006 3300048911 Bacteria 819
311 Ga0496114_0009373 3300048917 Bacteria 7772
312 Ga0496114_0468934 3300048917 Bacteria 1114
313 Ga0496116_0010574 3300048919 Bacteria 7719
314 Ga0496117_0000045 3300048920 Bacteria 301047
315 Ga0496118_0000041 3300048921 Bacteria 301047
316 Ga0496121_0004980 3300048924 Bacteria 17403
317 Ga0496121_0011590 3300048924 Bacteria 9757
318 Ga0496122_0000718 3300048925 Bacteria 64979
319 Ga0496122_0006181 3300048925 Bacteria 13901
320 Ga0496122_0011015 3300048925 Bacteria 9240
321 Ga0496123_0000179 3300048926 Bacteria 127833
322 Ga0496123_0037469 3300048926 Bacteria 3423
323 Ga0496123_0084150 3300048926 Bacteria 1919
324 Ga0496123_0241022 3300048926 Bacteria 898
325 Ga0496124_0043714 3300048927 Bacteria 3850
326 Ga0496124_0264870 3300048927 Bacteria 1262
327 Ga0496124_0317759 3300048927 Bacteria 1116
328 Ga0496124_0471063 3300048927 Bacteria 851
329 Ga0496125_0001090 3300048928 Bacteria 41847
330 Ga0496125_0037914 3300048928 Bacteria 4183
331 Ga0496125_0059397 3300048928 Bacteria 3081
332 Ga0496125_0219080 3300048928 Bacteria 1228
333 Ga0496126_0116636 3300048929 Bacteria 2320
334 Ga0495682_0034194 3300049460 Bacteria 1875
335 Ga0495682_0145054 3300049460 Bacteria 847
336 Ga0501067_0459763 3300049583 Bacteria 711
337 Ga0501250_029228 3300049680 Bacteria 757
338 Ga0501257_039851 3300049686 Bacteria 1151
339 Ga0501280_056100 3300049776 Bacteria 674
340 Ga0501226_009330 3300049853 Bacteria 1092
341 nmdc:mga03683_201164_c1 3300050489 Bacteria 914
342 nmdc:mga03683_43303_c1 3300050489 Bacteria 1857
343 nmdc:mga03683_9897_c1 3300050489 Bacteria 3405
344 nmdc:mga03n38_11110_c1 3300050490 Bacteria 3342
345 nmdc:mga03n38_95769_c1 3300050490 Bacteria 1422
346 nmdc:mga00v17_292980_c1 3300050491 Bacteria 1057
347 nmdc:mga0yw44_34354_c1 3300050492 Bacteria 2971
348 nmdc:mga0yw44_64331_c1 3300050492 Bacteria 2257
349 nmdc:mga0k408_123906_c1 3300050493 Bacteria 1532
350 nmdc:mga0k408_215463_c1 3300050493 Bacteria 1147
351 nmdc:mga0k408_22044_c1 3300050493 Bacteria 3584
352 nmdc:mga0k408_275161_c1 3300050493 Bacteria 1005
353 nmdc:mga0k408_39675_c1 3300050493 Bacteria 2707
354 nmdc:mga0k408_444071_c1 3300050493 Bacteria 771
355 nmdc:mga0k408_47702_c1 3300050493 Bacteria 2476
356 nmdc:mga0k408_73959_c1 3300050493 Bacteria 1991
357 nmdc:mga06z11_11170_c1 3300050494 Bacteria 3860
358 nmdc:mga06z11_124204_c1 3300050494 Bacteria 1443
359 nmdc:mga06z11_303724_c1 3300050494 Bacteria 949
360 nmdc:mga04h51_131939_c1 3300050495 Bacteria 940
361 nmdc:mga04h51_189604_c1 3300050495 Bacteria 804
362 nmdc:mga07m45_118928_c1 3300050496 Bacteria 1526
363 nmdc:mga07m45_163239_c1 3300050496 Bacteria 1294
364 nmdc:mga07m45_18025_c1 3300050496 Bacteria 3803
365 nmdc:mga07m45_276858_c1 3300050496 Bacteria 976
366 nmdc:mga07m45_3603_c2 3300050496 Bacteria 7082
367 nmdc:mga07m45_44968_c1 3300050496 Bacteria 2479
368 nmdc:mga07m45_47280_c1 3300050496 Bacteria 2419
369 nmdc:mga07m45_7800_c1 3300050496 Bacteria 5478
370 nmdc:mga05p37_22640_c1 3300050507 Bacteria 7619
371 Ga0495601_0226104 3300053077 Bacteria 1222
372 Ga0500583_0182171 3300053092 Bacteria 1046
373 Ga0500597_062695 3300053120 Bacteria 1599
374 Ga0500608_006349 3300053122 Bacteria 4802
375 Ga0500658_0015083 3300053134 Bacteria 2864
376 Ga0500559_0111986 3300053136 Bacteria 1265
377 Ga0500573_0032008 3300053140 Bacteria 3035
378 Ga0500574_016142 3300053141 Bacteria 1798
379 Ga0500634_0045520 3300053161 Bacteria 2374
380 2548498052 2547132374 Bacteria 5530232
381 2644057248 2643221609 Bacteria 6756331
382 2644071932 2643221611 Bacteria 6820941
383 2644340706 2643221660 Bacteria 4208257
384 2644645996 2643221717 Bacteria 5676132
385 2722884912 2721755523 Bacteria 6430384
386 2819542392 2818991436 Bacteria 5376622
387 2831270306 2831265667 Bacteria 7184833
388 2838056537 2838054893 Bacteria 7451788
389 2839142229 2839138175 Bacteria 6549354
390 2842736110 2842733646 Bacteria 5716726
391 2857551066 2857547612 Bacteria 6179999
392 2885196240 2885192300 Bacteria 5882526
393 2904546402 2904541872 Bacteria 8915136
394 2919480025 2919476304 Bacteria 5888696
395 2919707465 2919704043 Bacteria 5560311
396 2929164212 2929160207 Bacteria 9075316
397 2995395496 2995392953 Bacteria 4539380
398 Ga0439439_0000816
399 JGI25162J39368_1000131
400 JGI25162J39368_1000370
401 JGI25164J39214_1003182
402 JGI25165J46597_1000022
403 Ga0055538_1000011
404 Ga0055539_1000016
405 Ga0055533_1000019
406 Ga0055525_1000042
407 Ga0055525_1000173
408 Ga0055541_1000017
409 Ga0055541_1000084
410 Ga0065714_10096727
411 Ga0065714_10198816
412 Ga0065704_10099156
413 Ga0070658_10305132
414 Ga0070660_100031645
415 Ga0070668_100334567
416 Ga0070669_100035144
417 Ga0070675_101179232
418 Ga0070673_100150141
419 Ga0070659_100001694
420 Ga0070667_100125903
421 Ga0070708_100570895
422 Ga0070663_100010841
423 Ga0070678_100026881
424 Ga0070678_100054534
425 Ga0070678_101370755
426 Ga0070662_100026594
427 Ga0068867_100044524
428 Ga0068867_100928088
429 Ga0070706_100003421
430 Ga0070707_100050657
431 Ga0070698_100344350
432 Ga0068853_100165050
433 Ga0068853_100355253
434 Ga0070665_100315602
435 Ga0070664_100000939
436 Ga0068857_100080512
437 Ga0068852_101131062
438 Ga0068864_100551292
439 Ga0068860_101051281
440 Ga0075365_10010392
441 Ga0075365_10250830
442 Ga0075365_10530028
443 Ga0075368_10024174
444 Ga0075368_10079437
445 Ga0075363_100092229
446 Ga0075363_100153007
447 Ga0075363_100428095
448 Ga0075364_10319969
449 Ga0070716_100194190
450 Ga0075362_10001502
451 Ga0075362_10017083
452 Ga0075362_10110771
453 Ga0075362_10110803
454 Ga0075362_10189580
455 Ga0075367_10013975
456 Ga0075367_10034975
457 Ga0075367_10078199
458 Ga0075367_10357193
459 Ga0075369_10012535
460 Ga0075366_10001005
461 Ga0075366_10003168
462 Ga0075366_10006875
463 Ga0075366_10026606
464 Ga0075366_10040929
465 Ga0075366_10044522
466 Ga0075370_10004907
467 Ga0075370_10006166
468 Ga0075370_10013190
469 Ga0075370_10044485
470 Ga0068865_100914009
471 Ga0105240_10010309
472 Ga0114129_10030221
473 Ga0105242_10437059
474 Ga0105242_11099025
475 Ga0105248_10007009
476 Ga0105248_10050398
477 Ga0105248_11510105
478 Ga0105237_10008586
479 Ga0105237_10014572
480 Ga0105238_10127702
481 Ga0105249_11001558
482 Ga0105239_10002709
483 Ga0105239_10016215
484 Ga0157373_10013449
485 Ga0157370_10258911
486 Ga0163162_10264143
487 Ga0157375_10866702
488 Ga0182008_10021722
489 Ga0182008_10033537
490 Ga0157376_10668247
491 Ga0182006_1000035
492 Ga0182006_1000054
493 Ga0182006_1002575
494 Ga0182006_1008780
495 Ga0182006_1022667
496 Ga0182006_1067666
497 Ga0182007_10000040
498 Ga0182007_10004694
499 Ga0182007_10007657
500 Ga0182007_10105831
501 Ga0182005_1000012
502 Ga0182005_1000025
503 Ga0182005_1000351
504 Ga0182005_1095800
505 Ga0183362_10001
506 Ga0163161_10130614
507 Ga0163161_10212947
508 Ga0209784_100019
509 Ga0209566_100017
510 Ga0209674_100031
511 Ga0209563_100035
512 Ga0207427_101950
513 Ga0209437_100038
514 Ga0209677_100020
515 Ga0209233_1000049
516 Ga0207680_10025347
517 Ga0207645_10123542
518 Ga0207684_10016021
519 Ga0207695_10016767
520 Ga0207695_10242346
521 Ga0207671_10027278
522 Ga0207671_10527087
523 Ga0207657_10071613
524 Ga0207649_10001323
525 Ga0207646_10040699
526 Ga0207681_10477918
527 Ga0207694_10010847
528 Ga0207690_10004800
529 Ga0207706_10314711
530 Ga0207706_10788730
531 Ga0207669_10166736
532 Ga0207669_10393800
533 Ga0207665_10245135
534 Ga0207711_10758814
535 Ga0207679_10000201
536 Ga0207679_11082059
537 Ga0207651_10158797
538 Ga0207651_10989927
539 Ga0207712_10830398
540 Ga0207668_10404934
541 Ga0207640_10075050
542 Ga0207639_10164868
543 Ga0207639_10588471
544 Ga0207678_10054402
545 Ga0207641_10517963
546 Ga0207641_10937058
547 Ga0207648_10058885
548 Ga0207676_10121556
549 Ga0207674_10106327
550 Ga0207675_100379777
551 Ga0207683_10013526
552 Ga0207683_10234025
553 Ga0207683_10783109
554 Ga0207698_10060244
555 Ga0207698_10947971
556 Ga0209281_1025665
557 Ga0209813_10032190
558 Ga0209974_10005575
559 Ga0268266_10919454
560 Ga0307517_10000174
561 Ga0307515_10000954
562 Ga0307515_10001052
563 Ga0307515_10048555
564 Ga0307512_10196728
565 Ga0307512_10287840
566 Ga0265327_10000341
567 Ga0265327_10001863
568 Ga0265327_10008281
569 Ga0265316_10000181
570 Ga0307513_10013362
571 Ga0307513_10218812
572 Ga0307509_10000904
573 Ga0307509_10011898
574 Ga0307509_10092522
575 Ga0307408_100064307
576 Ga0307408_100068496
577 Ga0307408_100402166
578 Ga0307408_100624584
579 Ga0307408_100786131
580 Ga0307508_10000911
581 Ga0307508_10068258
582 Ga0307508_10135072
583 Ga0307514_10003805
584 Ga0307516_10005347
585 Ga0307516_10316962
586 Ga0307405_10291937
587 Ga0307406_10570720
588 Ga0307412_10145537
589 Ga0307412_10194477
590 Ga0307412_10205636
591 Ga0307412_11282537
592 Ga0307414_10020097
593 Ga0307510_10225981
594 Ga0373930_0027111
595 Ga0373931_0048127
596 Ga0395899_0192186
597 Ga0395905_0089897
598 Ga0395905_0134563
599 Ga0395905_0422391
600 Ga0395905_0617948
601 Ga0395901_0084141
602 Ga0439439_0088582
603 Ga0439447_087827
604 Ga0439461_0007771
605 Ga0439466_0004196
606 Ga0439466_0009742
607 Ga0439465_0000786
608 Ga0451807_1136989
609 Ga0451835_0392221
610 Ga0451845_0274005
611 Ga0439431_0003163
612 Ga0439431_0105925
613 Ga0439433_0000470
614 Ga0439441_059350
615 Ga0439445_0000144
616 Ga0439432_002552
617 Ga0439432_009880
618 Ga0439449_0000477
619 Ga0439449_0002907
620 Ga0439449_0007248
621 Ga0439452_001451
622 Ga0439452_009011
623 Ga0439457_003298
624 Ga0439457_005237
625 Ga0439462_0002663
626 Ga0439462_0004834
627 Ga0450911_001695
628 Ga0450919_001758
629 Ga0450921_004840
630 Ga0450923_001976
631 Ga0450890_010093
632 Ga0450895_013990
633 Ga0450899_011962
634 Ga0439446_0027773
635 Ga0450909_005156
636 Ga0439434_0000884
637 Ga0439434_0069523
638 Ga0450916_013672
639 Ga0450918_013461
640 Ga0450893_0011165
641 Ga0450893_0022850
642 Ga0451577_0001786
643 Ga0466969_0006705
644 Ga0466972_0064354
645 Ga0466965_0018304
646 Ga0466965_0229922
647 Ga0466966_0015196
648 Ga0466961_0129160
649 Ga0453684_1045825
650 Ga0466971_0185180
651 Ga0466970_0112594
652 Ga0466970_0349128
653 Ga0466960_0122597
654 Ga0466960_0149415
655 Ga0451576_0262953
656 Ga0495592_0028419
657 Ga0495629_0670946
658 Ga0495651_0540485
659 Ga0495653_0015181
660 Ga0495650_0004936
661 Ga0495639_0025635
662 Ga0495608_0006949
663 Ga0495610_0053794
664 Ga0495628_0001453
665 Ga0495632_0011336
666 Ga0495663_0080625
667 Ga0495666_0136525
668 Ga0495666_0321044
669 Ga0495652_0005080
670 Ga0495652_0029637
671 Ga0495654_0001761
672 Ga0495654_0032722
673 Ga0495609_0117567
674 Ga0495597_0001824
675 Ga0495597_0004186
676 Ga0495645_0112192
677 Ga0495645_0168537
678 Ga0495645_0203138
679 Ga0495622_0075587
680 Ga0495633_0000271
681 Ga0495633_0010681
682 Ga0495656_0000060
683 Ga0495668_0244807
684 Ga0495625_0149137
685 Ga0495635_0296402
686 Ga0495646_0009890
687 Ga0495646_0164006
688 Ga0495658_0337171
689 Ga0495624_0011627
690 Ga0495624_0113738
691 Ga0495649_0021230
692 Ga0495600_0000303
693 Ga0495660_0169772
694 Ga0495604_0007470
695 Ga0495636_0172244
696 Ga0495687_000327
697 Ga0495687_017242
698 Ga0495686_0007124
699 Ga0495593_0341242
700 Ga0495602_0345797
701 Ga0495615_0007994
702 Ga0496101_0004597
703 Ga0496102_0021528
704 Ga0496103_0324065
705 Ga0496104_0163155
706 Ga0496105_0057687
707 Ga0496108_0790006
708 Ga0496114_0009373
709 Ga0496114_0468934
710 Ga0496116_0010574
711 Ga0496117_0000045
712 Ga0496118_0000041
713 Ga0496121_0004980
714 Ga0496121_0011590
715 Ga0496122_0000718
716 Ga0496122_0006181
717 Ga0496122_0011015
718 Ga0496123_0000179
719 Ga0496123_0037469
720 Ga0496123_0084150
721 Ga0496123_0241022
722 Ga0496124_0043714
723 Ga0496124_0264870
724 Ga0496124_0317759
725 Ga0496124_0471063
726 Ga0496125_0001090
727 Ga0496125_0037914
728 Ga0496125_0059397
729 Ga0496125_0219080
730 Ga0496126_0116636
731 Ga0495682_0034194
732 Ga0495682_0145054
733 Ga0501067_0459763
734 Ga0501250_029228
735 Ga0501257_039851
736 Ga0501280_056100
737 Ga0501226_009330
738 nmdc:mga03683_201164_c1
739 nmdc:mga03683_43303_c1
740 nmdc:mga03683_9897_c1
741 nmdc:mga03n38_11110_c1
742 nmdc:mga03n38_95769_c1
743 nmdc:mga00v17_292980_c1
744 nmdc:mga0yw44_34354_c1
745 nmdc:mga0yw44_64331_c1
746 nmdc:mga0k408_123906_c1
747 nmdc:mga0k408_215463_c1
748 nmdc:mga0k408_22044_c1
749 nmdc:mga0k408_275161_c1
750 nmdc:mga0k408_39675_c1
751 nmdc:mga0k408_444071_c1
752 nmdc:mga0k408_47702_c1
753 nmdc:mga0k408_73959_c1
754 nmdc:mga06z11_11170_c1
755 nmdc:mga06z11_124204_c1
756 nmdc:mga06z11_303724_c1
757 nmdc:mga04h51_131939_c1
758 nmdc:mga04h51_189604_c1
759 nmdc:mga07m45_118928_c1
760 nmdc:mga07m45_163239_c1
761 nmdc:mga07m45_18025_c1
762 nmdc:mga07m45_276858_c1
763 nmdc:mga07m45_3603_c2
764 nmdc:mga07m45_44968_c1
765 nmdc:mga07m45_47280_c1
766 nmdc:mga07m45_7800_c1
767 nmdc:mga05p37_22640_c1
768 Ga0495601_0226104
769 Ga0500583_0182171
770 Ga0500597_062695
771 Ga0500608_006349
772 Ga0500658_0015083
773 Ga0500559_0111986
774 Ga0500573_0032008
775 Ga0500574_016142
776 Ga0500634_0045520
777 2548498052
778 2644057248
779 2644071932
780 2644340706
781 2644645996
782 2722884912
783 2819542392
784 2831270306
785 2838056537
786 2839142229
787 2842736110
788 2857551066
789 2885196240
790 2904546402
791 2919480025
792 2919707465
793 2929164212
794 2995395496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

63

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i7h-assembly1.cif.gz_A structural basis for peroxide sensing and gene regulation by perr from streptococcus pyogenes 0.9225 29 91
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.911 46 92
3bp8-assembly2.cif.gz_B crystal structure of mlc/eiib complex 0.9106 32 92
7rhe-assembly1.cif.gz_A-2 crystal structure of rok family protein from burkholderia vietnamiensis g4 0.9072 32 92
2dk5-assembly1.cif.gz_A solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide 0.9019 30 91
ID Description Score Start End Superfamily
2ia2D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9451 45 77 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9368 36 92 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.933 32 91 1.10.10.10
af_Q58958_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9252 14 92 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9214 32 91 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A658A5H2-F1-model_v4 deleted 0.9807 10 90
AF-A0A4Q6E1W3-F1-model_v4 deleted 0.9538 14 110
AF-X1PRH1-F1-model_v4 HTH arsR-type domain-containing protein 0.9363 15 95 GO:0003677
GO:0003700
AF-A0A658A5H2-F1-model_v4 deleted 0.9351 10 90
AF-A0A535HIQ7-F1-model_v4 MarR family transcriptional regulator 0.9346 15 96 GO:0003677
GO:0003700

Map