F433863
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 397 | 195 | 776 | 443 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0047553|Ga0495672_0047553_27_1364 |
| Length | 436 |
| Sequence | MPILSKDEAQALLKKVLAYSKSNECEANLSGSDGGNIRYARNAVSTSGGISQNTLVVSSAYGKKLGTATINEFDDASLEKVVRRSEELAQLAPENPEFVPFLGPQQYAADSKTFEPRTAAIDPKFRTDAVAQSLQISKDNDLVAAGYLENTAGFAAMMNSKGLFAYNTSTNVNFNVTLRTKDGKGSGYASKGYTDVAKLDXVTAGSSGARALEPGKYTVILEPTAAIVLLETIFFGMDARSADEGRSFLSKPDGKTKLGEKLVDERVNIYSDPQNPDLPTSSWNSDGRPQEKINWIEKGVMKNLYYSRYWAQKKNVKAIPGPDGIIMEGGNASLEDLIKGTEKGVLVTRLWYIRPVDPQTLLYTGLTRDGTFYIENGQIKFPIKNFRFNESAIIMLNNLDALGKPERTVSGESGTQALIPPLKIRDFTFSSLSDAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 83 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 84 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 128 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 129 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 130 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 132 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 135 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 137 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 138 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 145 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 146 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 147 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 148 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 149 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 171 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 172 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 173 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 174 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 176 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 177 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 178 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 179 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 180 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 181 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 182 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 183 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 184 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 185 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 186 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 187 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 188 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 189 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 190 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 191 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 192 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 193 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 194 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 195 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.96 |
| Metatranscriptomes | 0 |
| Isolates | 5.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.06 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 81.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495672_0047553 | 3300047320 | Bacteria | 2550 |
| 2 | JGI24739J22299_10001144 | 3300001989 | Bacteria | 9897 |
| 3 | JGI25154J39366_1000078 | 3300002738 | Bacteria | 90241 |
| 4 | JGI25153J46596_10004809 | 3300003215 | Bacteria | 7194 |
| 5 | rootH1_10038647 | 3300003316 | Bacteria | 3892 |
| 6 | rootH2_10004814 | 3300003320 | Bacteria | 18173 |
| 7 | rootH2_10055726 | 3300003320 | Bacteria | 1929 |
| 8 | rootL2_10143320 | 3300003322 | Bacteria | 2708 |
| 9 | rootH1_10086427 | 3300003323 | Bacteria | 16741 |
| 10 | rootH1_10366573 | 3300003323 | Bacteria | 1956 |
| 11 | JGI25160J50197_1002111 | 3300003354 | Bacteria | 9446 |
| 12 | JGI25160J50197_1002797 | 3300003354 | Bacteria | 7989 |
| 13 | JGI25160J50197_1008990 | 3300003354 | Bacteria | 3748 |
| 14 | Ga0055526_1019603 | 3300003771 | Bacteria | 2456 |
| 15 | Ga0055528_1003716 | 3300003790 | Bacteria | 7548 |
| 16 | Ga0055530_10005011 | 3300003791 | Bacteria | 6532 |
| 17 | Ga0065165_1000333 | 3300005262 | Bacteria | 77078 |
| 18 | Ga0065165_1001407 | 3300005262 | Bacteria | 26218 |
| 19 | Ga0065165_1023839 | 3300005262 | Bacteria | 2067 |
| 20 | Ga0065714_10010088 | 3300005288 | Bacteria | 2413 |
| 21 | Ga0065714_10064459 | 3300005288 | Bacteria | 66711 |
| 22 | Ga0070676_10001440 | 3300005328 | Bacteria | 12023 |
| 23 | Ga0070676_10007742 | 3300005328 | Bacteria | 5768 |
| 24 | Ga0070670_100063328 | 3300005331 | Bacteria | 3174 |
| 25 | Ga0070670_100110579 | 3300005331 | Unclassified | 2367 |
| 26 | Ga0070670_100165655 | 3300005331 | Bacteria | 1916 |
| 27 | Ga0070677_10045321 | 3300005333 | Bacteria | 1754 |
| 28 | Ga0068869_100035056 | 3300005334 | Bacteria | 3555 |
| 29 | Ga0068869_100079513 | 3300005334 | Bacteria | 2443 |
| 30 | Ga0070666_10000072 | 3300005335 | Bacteria | 75356 |
| 31 | Ga0070666_10007252 | 3300005335 | Bacteria | 6836 |
| 32 | Ga0070666_10020400 | 3300005335 | Bacteria | 4284 |
| 33 | Ga0070666_10139013 | 3300005335 | Bacteria | 1691 |
| 34 | Ga0068868_100021866 | 3300005338 | Bacteria | 4821 |
| 35 | Ga0068868_100047483 | 3300005338 | Bacteria | 3365 |
| 36 | Ga0068868_100048754 | 3300005338 | Bacteria | 3323 |
| 37 | Ga0068868_100152246 | 3300005338 | Bacteria | 1905 |
| 38 | Ga0070661_100104474 | 3300005344 | Unclassified | 2110 |
| 39 | Ga0070668_100146171 | 3300005347 | Bacteria | 1908 |
| 40 | Ga0070669_100012772 | 3300005353 | Bacteria | 5963 |
| 41 | Ga0070675_100017150 | 3300005354 | Bacteria | 5754 |
| 42 | Ga0070675_100045260 | 3300005354 | Bacteria | 3601 |
| 43 | Ga0070671_100017180 | 3300005355 | Bacteria | 5856 |
| 44 | Ga0070671_100024497 | 3300005355 | Bacteria | 4941 |
| 45 | Ga0070674_100047872 | 3300005356 | Bacteria | 2932 |
| 46 | Ga0070674_100078741 | 3300005356 | Bacteria | 2349 |
| 47 | Ga0070673_100012764 | 3300005364 | Bacteria | 5780 |
| 48 | Ga0070673_100045071 | 3300005364 | Bacteria | 3418 |
| 49 | Ga0070673_100073801 | 3300005364 | Bacteria | 2747 |
| 50 | Ga0070667_100006188 | 3300005367 | Bacteria | 9955 |
| 51 | Ga0070667_100014577 | 3300005367 | Bacteria | 6496 |
| 52 | Ga0070667_100060170 | 3300005367 | Bacteria | 3214 |
| 53 | Ga0070678_100007159 | 3300005456 | Bacteria | 6597 |
| 54 | Ga0070678_100047159 | 3300005456 | Bacteria | 3094 |
| 55 | Ga0070662_100000013 | 3300005457 | Bacteria | 125019 |
| 56 | Ga0070662_100103105 | 3300005457 | Bacteria | 2163 |
| 57 | Ga0068867_100003509 | 3300005459 | Bacteria | 11026 |
| 58 | Ga0070698_100039590 | 3300005471 | Bacteria | 4850 |
| 59 | Ga0070684_100061617 | 3300005535 | Bacteria | 3284 |
| 60 | Ga0068853_100030965 | 3300005539 | Bacteria | 4522 |
| 61 | Ga0068853_100053384 | 3300005539 | Bacteria | 3481 |
| 62 | Ga0070672_100004660 | 3300005543 | Bacteria | 8991 |
| 63 | Ga0070672_100051257 | 3300005543 | Bacteria | 3217 |
| 64 | Ga0070672_100093608 | 3300005543 | Bacteria | 2428 |
| 65 | Ga0070672_100099610 | 3300005543 | Bacteria | 2356 |
| 66 | Ga0070665_100000010 | 3300005548 | Bacteria | 529545 |
| 67 | Ga0070665_100000052 | 3300005548 | Bacteria | 245694 |
| 68 | Ga0070665_100011887 | 3300005548 | Bacteria | 8791 |
| 69 | Ga0070665_100088390 | 3300005548 | Unclassified | 3104 |
| 70 | Ga0070704_100002073 | 3300005549 | Bacteria | 11137 |
| 71 | Ga0068855_100006150 | 3300005563 | Bacteria | 14635 |
| 72 | Ga0068855_100013413 | 3300005563 | Bacteria | 9881 |
| 73 | Ga0068855_100047795 | 3300005563 | Bacteria | 5054 |
| 74 | Ga0068855_100060168 | 3300005563 | Bacteria | 4443 |
| 75 | Ga0070664_100037363 | 3300005564 | Bacteria | 4083 |
| 76 | Ga0068857_100116503 | 3300005577 | Bacteria | 2404 |
| 77 | Ga0068854_100017841 | 3300005578 | Bacteria | 4757 |
| 78 | Ga0068852_100001694 | 3300005616 | Bacteria | 15026 |
| 79 | Ga0068852_100002433 | 3300005616 | Bacteria | 12817 |
| 80 | Ga0068852_100006679 | 3300005616 | Bacteria | 8361 |
| 81 | Ga0068859_100000006 | 3300005617 | Bacteria | 421509 |
| 82 | Ga0068859_100027257 | 3300005617 | Bacteria | 5731 |
| 83 | Ga0068864_100008852 | 3300005618 | Bacteria | 8297 |
| 84 | Ga0068864_100030220 | 3300005618 | Bacteria | 4592 |
| 85 | Ga0068866_10019966 | 3300005718 | Bacteria | 3061 |
| 86 | Ga0068866_10026258 | 3300005718 | Bacteria | 2748 |
| 87 | Ga0068861_100005802 | 3300005719 | Bacteria | 8381 |
| 88 | Ga0068870_10010474 | 3300005840 | Bacteria | 4265 |
| 89 | Ga0068870_10020608 | 3300005840 | Unclassified | 3213 |
| 90 | Ga0068863_100006997 | 3300005841 | Bacteria | 11057 |
| 91 | Ga0068863_100022248 | 3300005841 | Bacteria | 6053 |
| 92 | Ga0068860_100000004 | 3300005843 | Bacteria | 506126 |
| 93 | Ga0068860_100001096 | 3300005843 | Bacteria | 29818 |
| 94 | Ga0068860_100002117 | 3300005843 | Bacteria | 20935 |
| 95 | Ga0068860_100002430 | 3300005843 | Bacteria | 19567 |
| 96 | Ga0068862_100139709 | 3300005844 | Bacteria | 2149 |
| 97 | Ga0075366_10001148 | 3300006195 | Bacteria | 13098 |
| 98 | Ga0097621_100000146 | 3300006237 | Bacteria | 42998 |
| 99 | Ga0097621_100000639 | 3300006237 | Bacteria | 24750 |
| 100 | Ga0097621_100015728 | 3300006237 | Bacteria | 5701 |
| 101 | Ga0068871_100000477 | 3300006358 | Bacteria | 27401 |
| 102 | Ga0068871_100002101 | 3300006358 | Bacteria | 13481 |
| 103 | Ga0068871_100004512 | 3300006358 | Bacteria | 9700 |
| 104 | Ga0068871_100016612 | 3300006358 | Bacteria | 5550 |
| 105 | Ga0068871_100064633 | 3300006358 | Bacteria | 2996 |
| 106 | Ga0068865_100000079 | 3300006881 | Bacteria | 51370 |
| 107 | Ga0068865_100003508 | 3300006881 | Bacteria | 9402 |
| 108 | Ga0097620_100000006 | 3300006931 | Bacteria | 421509 |
| 109 | Ga0097620_100027257 | 3300006931 | Bacteria | 5731 |
| 110 | Ga0105240_10002508 | 3300009093 | Bacteria | 29504 |
| 111 | Ga0105240_10011523 | 3300009093 | Bacteria | 12306 |
| 112 | Ga0105240_10014577 | 3300009093 | Bacteria | 10725 |
| 113 | Ga0105240_10113108 | 3300009093 | Bacteria | 3280 |
| 114 | Ga0105240_10156082 | 3300009093 | Bacteria | 2714 |
| 115 | Ga0105240_10201246 | 3300009093 | Bacteria | 2334 |
| 116 | Ga0105241_10000888 | 3300009174 | Bacteria | 22590 |
| 117 | Ga0105241_10002798 | 3300009174 | Bacteria | 13057 |
| 118 | Ga0105241_10003043 | 3300009174 | Bacteria | 12512 |
| 119 | Ga0105241_10195856 | 3300009174 | Bacteria | 1685 |
| 120 | Ga0105242_10012932 | 3300009176 | Bacteria | 6435 |
| 121 | Ga0105248_10037014 | 3300009177 | Bacteria | 5457 |
| 122 | Ga0105237_10000157 | 3300009545 | Bacteria | 96235 |
| 123 | Ga0105237_10000683 | 3300009545 | Bacteria | 46945 |
| 124 | Ga0105237_10000886 | 3300009545 | Bacteria | 40329 |
| 125 | Ga0105237_10001875 | 3300009545 | Bacteria | 26830 |
| 126 | Ga0105237_10003344 | 3300009545 | Bacteria | 19091 |
| 127 | Ga0105237_10011599 | 3300009545 | Bacteria | 9322 |
| 128 | Ga0105237_10025060 | 3300009545 | Bacteria | 6101 |
| 129 | Ga0105237_10056463 | 3300009545 | Bacteria | 3930 |
| 130 | Ga0105238_10000980 | 3300009551 | Bacteria | 29183 |
| 131 | Ga0105238_10001237 | 3300009551 | Bacteria | 25698 |
| 132 | Ga0105238_10002843 | 3300009551 | Bacteria | 17277 |
| 133 | Ga0105249_10005209 | 3300009553 | Bacteria | 11220 |
| 134 | Ga0105249_10023107 | 3300009553 | Bacteria | 5576 |
| 135 | Ga0105249_10055256 | 3300009553 | Bacteria | 3631 |
| 136 | Ga0105239_10000029 | 3300010375 | Bacteria | 234749 |
| 137 | Ga0105239_10004206 | 3300010375 | Bacteria | 17283 |
| 138 | Ga0105239_10009224 | 3300010375 | Bacteria | 11160 |
| 139 | Ga0105239_10042568 | 3300010375 | Bacteria | 4976 |
| 140 | Ga0105239_10050076 | 3300010375 | Bacteria | 4582 |
| 141 | Ga0105246_10007350 | 3300011119 | Bacteria | 6749 |
| 142 | Ga0105246_10024473 | 3300011119 | Bacteria | 3924 |
| 143 | Ga0105246_10028746 | 3300011119 | Bacteria | 3654 |
| 144 | Ga0105246_10039992 | 3300011119 | Bacteria | 3162 |
| 145 | Ga0157371_10000016 | 3300013102 | Bacteria | 330495 |
| 146 | Ga0157371_10004224 | 3300013102 | Bacteria | 12634 |
| 147 | Ga0157371_10004404 | 3300013102 | Bacteria | 12310 |
| 148 | Ga0157370_10019477 | 3300013104 | Bacteria | 6806 |
| 149 | Ga0157370_10178882 | 3300013104 | Bacteria | 1971 |
| 150 | Ga0157369_10000008 | 3300013105 | Bacteria | 309315 |
| 151 | Ga0157369_10026797 | 3300013105 | Bacteria | 6391 |
| 152 | Ga0157369_10217798 | 3300013105 | Bacteria | 1999 |
| 153 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 154 | Ga0157374_10000258 | 3300013296 | Bacteria | 48926 |
| 155 | Ga0157374_10001763 | 3300013296 | Bacteria | 18206 |
| 156 | Ga0157374_10014360 | 3300013296 | Bacteria | 6931 |
| 157 | Ga0157374_10169566 | 3300013296 | Unclassified | 2128 |
| 158 | Ga0157378_10003682 | 3300013297 | Bacteria | 13587 |
| 159 | Ga0157378_10083361 | 3300013297 | Bacteria | 2893 |
| 160 | Ga0157378_10212656 | 3300013297 | Bacteria | 1834 |
| 161 | Ga0163162_10000005 | 3300013306 | Bacteria | 447195 |
| 162 | Ga0163162_10000528 | 3300013306 | Bacteria | 35474 |
| 163 | Ga0163162_10002184 | 3300013306 | Bacteria | 18347 |
| 164 | Ga0163162_10016486 | 3300013306 | Bacteria | 7218 |
| 165 | Ga0163162_10325931 | 3300013306 | Bacteria | 1668 |
| 166 | Ga0157372_10000305 | 3300013307 | Bacteria | 54763 |
| 167 | Ga0157372_10013020 | 3300013307 | Bacteria | 8870 |
| 168 | Ga0157372_10058774 | 3300013307 | Bacteria | 4299 |
| 169 | Ga0157372_10101679 | 3300013307 | Bacteria | 3282 |
| 170 | Ga0157372_10117096 | 3300013307 | Bacteria | 3056 |
| 171 | Ga0157375_10000207 | 3300013308 | Bacteria | 54636 |
| 172 | Ga0157375_10035206 | 3300013308 | Bacteria | 4777 |
| 173 | Ga0157375_10104158 | 3300013308 | Bacteria | 2926 |
| 174 | Ga0163163_10000553 | 3300014325 | Bacteria | 32772 |
| 175 | Ga0163163_10064759 | 3300014325 | Bacteria | 3627 |
| 176 | Ga0163163_10078327 | 3300014325 | Bacteria | 3302 |
| 177 | Ga0163163_10143652 | 3300014325 | Bacteria | 2429 |
| 178 | Ga0182008_10000391 | 3300014497 | Bacteria | 34009 |
| 179 | Ga0157377_10013129 | 3300014745 | Bacteria | 4185 |
| 180 | Ga0157379_10028678 | 3300014968 | Bacteria | 4950 |
| 181 | Ga0157379_10040875 | 3300014968 | Bacteria | 4139 |
| 182 | Ga0157376_10000555 | 3300014969 | Bacteria | 24024 |
| 183 | Ga0157376_10001344 | 3300014969 | Bacteria | 16206 |
| 184 | Ga0157376_10084534 | 3300014969 | Bacteria | 2733 |
| 185 | Ga0182006_1000146 | 3300015261 | Bacteria | 75345 |
| 186 | Ga0182006_1001004 | 3300015261 | Bacteria | 18475 |
| 187 | Ga0182007_10000003 | 3300015262 | Bacteria | 548244 |
| 188 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 189 | Ga0163161_10001075 | 3300017792 | Bacteria | 20677 |
| 190 | Ga0163161_10001303 | 3300017792 | Bacteria | 18557 |
| 191 | Ga0163161_10002039 | 3300017792 | Bacteria | 14629 |
| 192 | Ga0163161_10003175 | 3300017792 | Bacteria | 11590 |
| 193 | Ga0163161_10060206 | 3300017792 | Bacteria | 2763 |
| 194 | Ga0163161_10123655 | 3300017792 | Bacteria | 1946 |
| 195 | Ga0163161_10226468 | 3300017792 | Bacteria | 1449 |
| 196 | Ga0213872_10003022 | 3300021361 | Bacteria | 9501 |
| 197 | Ga0213876_10021968 | 3300021384 | Bacteria | 3374 |
| 198 | Ga0213876_10037242 | 3300021384 | Bacteria | 2566 |
| 199 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 200 | Ga0209026_1000136 | 3300025250 | Bacteria | 116507 |
| 201 | Ga0209026_1000842 | 3300025250 | Bacteria | 16208 |
| 202 | Ga0209673_1000519 | 3300025273 | Bacteria | 63063 |
| 203 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 204 | Ga0209564_1003135 | 3300025295 | Bacteria | 11670 |
| 205 | Ga0209564_1005021 | 3300025295 | Bacteria | 7760 |
| 206 | Ga0209758_1002710 | 3300025297 | Bacteria | 17456 |
| 207 | Ga0209758_1009141 | 3300025297 | Bacteria | 6237 |
| 208 | Ga0209758_1010338 | 3300025297 | Bacteria | 5600 |
| 209 | Ga0209050_1000276 | 3300025298 | Bacteria | 109997 |
| 210 | Ga0207426_1000032 | 3300025302 | Bacteria | 457997 |
| 211 | Ga0207426_1000089 | 3300025302 | Bacteria | 281224 |
| 212 | Ga0207426_1000367 | 3300025302 | Bacteria | 80232 |
| 213 | Ga0207426_1001395 | 3300025302 | Bacteria | 20376 |
| 214 | Ga0209257_1000931 | 3300025304 | Bacteria | 40523 |
| 215 | Ga0207682_10014039 | 3300025893 | Bacteria | 3121 |
| 216 | Ga0207682_10014550 | 3300025893 | Bacteria | 3067 |
| 217 | Ga0207680_10000024 | 3300025903 | Bacteria | 82106 |
| 218 | Ga0207680_10078657 | 3300025903 | Bacteria | 2066 |
| 219 | Ga0207647_10000044 | 3300025904 | Bacteria | 90491 |
| 220 | Ga0207645_10000219 | 3300025907 | Bacteria | 47364 |
| 221 | Ga0207645_10000558 | 3300025907 | Bacteria | 30976 |
| 222 | Ga0207643_10025264 | 3300025908 | Bacteria | 3282 |
| 223 | Ga0207654_10001733 | 3300025911 | Bacteria | 11338 |
| 224 | Ga0207654_10001873 | 3300025911 | Bacteria | 10898 |
| 225 | Ga0207654_10050827 | 3300025911 | Bacteria | 2384 |
| 226 | Ga0207695_10001521 | 3300025913 | Bacteria | 38468 |
| 227 | Ga0207695_10014747 | 3300025913 | Bacteria | 9239 |
| 228 | Ga0207695_10077767 | 3300025913 | Bacteria | 3369 |
| 229 | Ga0207671_10000450 | 3300025914 | Bacteria | 56924 |
| 230 | Ga0207671_10002380 | 3300025914 | Bacteria | 20199 |
| 231 | Ga0207671_10002525 | 3300025914 | Bacteria | 19503 |
| 232 | Ga0207671_10005345 | 3300025914 | Bacteria | 11881 |
| 233 | Ga0207671_10006651 | 3300025914 | Bacteria | 10247 |
| 234 | Ga0207671_10015022 | 3300025914 | Bacteria | 6087 |
| 235 | Ga0207671_10057245 | 3300025914 | Bacteria | 2889 |
| 236 | Ga0207681_10102020 | 3300025923 | Bacteria | 2071 |
| 237 | Ga0207694_10002932 | 3300025924 | Bacteria | 13705 |
| 238 | Ga0207694_10020187 | 3300025924 | Bacteria | 5040 |
| 239 | Ga0207694_10030683 | 3300025924 | Bacteria | 4104 |
| 240 | Ga0207694_10035316 | 3300025924 | Bacteria | 3834 |
| 241 | Ga0207650_10015363 | 3300025925 | Bacteria | 5331 |
| 242 | Ga0207650_10023987 | 3300025925 | Bacteria | 4331 |
| 243 | Ga0207650_10142350 | 3300025925 | Bacteria | 1886 |
| 244 | Ga0207659_10040039 | 3300025926 | Bacteria | 3274 |
| 245 | Ga0207687_10043871 | 3300025927 | Bacteria | 3083 |
| 246 | Ga0207644_10006227 | 3300025931 | Bacteria | 7779 |
| 247 | Ga0207706_10000173 | 3300025933 | Bacteria | 71958 |
| 248 | Ga0207706_10031779 | 3300025933 | Bacteria | 4702 |
| 249 | Ga0207706_10089187 | 3300025933 | Bacteria | 2711 |
| 250 | Ga0207669_10102922 | 3300025937 | Bacteria | 1893 |
| 251 | Ga0207704_10000019 | 3300025938 | Bacteria | 152734 |
| 252 | Ga0207691_10014563 | 3300025940 | Bacteria | 7496 |
| 253 | Ga0207691_10019389 | 3300025940 | Bacteria | 6437 |
| 254 | Ga0207689_10001199 | 3300025942 | Bacteria | 24909 |
| 255 | Ga0207689_10001505 | 3300025942 | Bacteria | 22204 |
| 256 | Ga0207689_10026945 | 3300025942 | Bacteria | 4811 |
| 257 | Ga0207689_10066632 | 3300025942 | Bacteria | 2960 |
| 258 | Ga0207667_10000968 | 3300025949 | Bacteria | 36617 |
| 259 | Ga0207667_10007266 | 3300025949 | Bacteria | 13358 |
| 260 | Ga0207667_10016309 | 3300025949 | Bacteria | 8397 |
| 261 | Ga0207667_10244504 | 3300025949 | Bacteria | 1836 |
| 262 | Ga0207712_10069522 | 3300025961 | Bacteria | 2526 |
| 263 | Ga0207668_10043026 | 3300025972 | Bacteria | 3062 |
| 264 | Ga0207668_10093180 | 3300025972 | Bacteria | 2219 |
| 265 | Ga0207658_10008008 | 3300025986 | Bacteria | 7197 |
| 266 | Ga0207658_10043905 | 3300025986 | Bacteria | 3252 |
| 267 | Ga0207677_10017494 | 3300026023 | Bacteria | 4276 |
| 268 | Ga0207677_10044355 | 3300026023 | Bacteria | 2962 |
| 269 | Ga0207677_10086033 | 3300026023 | Bacteria | 2271 |
| 270 | Ga0207677_10087160 | 3300026023 | Bacteria | 2259 |
| 271 | Ga0207639_10004313 | 3300026041 | Bacteria | 9582 |
| 272 | Ga0207641_10000058 | 3300026088 | Bacteria | 166385 |
| 273 | Ga0207641_10020384 | 3300026088 | Bacteria | 5445 |
| 274 | Ga0207641_10218483 | 3300026088 | Unclassified | 1766 |
| 275 | Ga0207648_10002523 | 3300026089 | Bacteria | 19646 |
| 276 | Ga0207648_10002973 | 3300026089 | Bacteria | 17907 |
| 277 | Ga0207674_10000629 | 3300026116 | Bacteria | 46056 |
| 278 | Ga0207675_100006970 | 3300026118 | Bacteria | 10691 |
| 279 | Ga0207675_100026719 | 3300026118 | Bacteria | 5373 |
| 280 | Ga0207683_10000730 | 3300026121 | Bacteria | 29877 |
| 281 | Ga0207698_10001840 | 3300026142 | Bacteria | 12395 |
| 282 | Ga0207698_10004648 | 3300026142 | Bacteria | 8389 |
| 283 | Ga0207698_10042478 | 3300026142 | Bacteria | 3397 |
| 284 | Ga0268266_10000032 | 3300028379 | Bacteria | 395079 |
| 285 | Ga0268266_10000070 | 3300028379 | Bacteria | 235423 |
| 286 | Ga0268266_10102248 | 3300028379 | Bacteria | 2527 |
| 287 | Ga0268265_10127216 | 3300028380 | Bacteria | 2111 |
| 288 | Ga0268265_10162706 | 3300028380 | Bacteria | 1898 |
| 289 | Ga0268264_10000011 | 3300028381 | Bacteria | 580884 |
| 290 | Ga0268264_10002040 | 3300028381 | Bacteria | 18038 |
| 291 | Ga0268264_10002921 | 3300028381 | Bacteria | 14854 |
| 292 | Ga0268264_10003791 | 3300028381 | Bacteria | 12967 |
| 293 | Ga0307517_10000640 | 3300028786 | Bacteria | 59989 |
| 294 | Ga0307515_10000059 | 3300028794 | Bacteria | 257520 |
| 295 | Ga0307515_10004635 | 3300028794 | Bacteria | 28227 |
| 296 | Ga0307515_10026520 | 3300028794 | Bacteria | 9970 |
| 297 | Ga0307515_10034128 | 3300028794 | Bacteria | 8346 |
| 298 | Ga0307515_10052539 | 3300028794 | Bacteria | 6041 |
| 299 | Ga0307511_10001201 | 3300030521 | Bacteria | 27539 |
| 300 | Ga0265327_10000168 | 3300031251 | Bacteria | 141392 |
| 301 | Ga0265327_10024826 | 3300031251 | Bacteria | 3510 |
| 302 | Ga0307509_10012028 | 3300031507 | Bacteria | 10390 |
| 303 | Ga0307509_10096204 | 3300031507 | Bacteria | 3014 |
| 304 | Ga0307516_10031082 | 3300031730 | Bacteria | 5384 |
| 305 | Ga0307405_10000032 | 3300031731 | Bacteria | 98354 |
| 306 | Ga0307407_10000151 | 3300031903 | Bacteria | 21356 |
| 307 | Ga0307416_100000009 | 3300032002 | Bacteria | 374271 |
| 308 | Ga0307414_10002186 | 3300032004 | Bacteria | 10202 |
| 309 | Ga0307414_10032338 | 3300032004 | Bacteria | 3443 |
| 310 | Ga0307414_10099782 | 3300032004 | Bacteria | 2182 |
| 311 | Ga0307507_10000010 | 3300033179 | Bacteria | 265208 |
| 312 | Ga0307510_10000062 | 3300033180 | Bacteria | 81920 |
| 313 | Ga0307510_10004416 | 3300033180 | Bacteria | 16557 |
| 314 | Ga0395899_0000563 | 3300037312 | Bacteria | 39619 |
| 315 | Ga0395900_0000173 | 3300037418 | Bacteria | 103767 |
| 316 | Ga0395898_0018685 | 3300037466 | Bacteria | 7067 |
| 317 | Ga0395905_0000641 | 3300037471 | Bacteria | 46724 |
| 318 | Ga0395901_0000294 | 3300038443 | Bacteria | 61869 |
| 319 | Ga0436365_0935453 | 3300039437 | Bacteria | 8337 |
| 320 | Ga0436361_0123021 | 3300039447 | Bacteria | 13910 |
| 321 | Ga0466972_0000001 | 3300044658 | Bacteria | 412457 |
| 322 | Ga0466972_0024963 | 3300044658 | Bacteria | 2965 |
| 323 | Ga0466968_0064866 | 3300044735 | Bacteria | 1580 |
| 324 | Ga0466970_0000065 | 3300044765 | Bacteria | 41709 |
| 325 | Ga0466970_0001560 | 3300044765 | Bacteria | 11058 |
| 326 | Ga0495627_038802 | 3300046453 | Bacteria | 1471 |
| 327 | Ga0495638_0011610 | 3300046460 | Bacteria | 6066 |
| 328 | Ga0495585_0006676 | 3300046492 | Bacteria | 7128 |
| 329 | Ga0495606_0003716 | 3300046507 | Bacteria | 15924 |
| 330 | Ga0495606_0029107 | 3300046507 | Bacteria | 3884 |
| 331 | Ga0495610_0000150 | 3300046512 | Bacteria | 76876 |
| 332 | Ga0495610_0000519 | 3300046512 | Bacteria | 38756 |
| 333 | Ga0495616_0007790 | 3300046513 | Bacteria | 6392 |
| 334 | Ga0495631_0007677 | 3300046518 | Bacteria | 5476 |
| 335 | Ga0495637_0026159 | 3300046520 | Bacteria | 2623 |
| 336 | Ga0495648_0005100 | 3300046524 | Bacteria | 11018 |
| 337 | Ga0495648_0070368 | 3300046524 | Bacteria | 2033 |
| 338 | Ga0495648_0078157 | 3300046524 | Bacteria | 1893 |
| 339 | Ga0495609_0013557 | 3300046538 | Bacteria | 3847 |
| 340 | Ga0495633_0000322 | 3300046558 | Bacteria | 54099 |
| 341 | Ga0495668_0000044 | 3300046616 | Bacteria | 227585 |
| 342 | Ga0495611_0001630 | 3300046648 | Bacteria | 10893 |
| 343 | Ga0495625_0001984 | 3300046660 | Bacteria | 23086 |
| 344 | Ga0495625_0003910 | 3300046660 | Bacteria | 14358 |
| 345 | Ga0495625_0051693 | 3300046660 | Bacteria | 2945 |
| 346 | Ga0495625_0154709 | 3300046660 | Bacteria | 1539 |
| 347 | Ga0495661_0003287 | 3300046665 | Bacteria | 12000 |
| 348 | Ga0495661_0037652 | 3300046665 | Bacteria | 3018 |
| 349 | Ga0495658_0105319 | 3300046683 | Bacteria | 1689 |
| 350 | Ga0495649_0027183 | 3300046694 | Bacteria | 3176 |
| 351 | Ga0495600_0134920 | 3300046809 | Bacteria | 1604 |
| 352 | Ga0495687_000006 | 3300047443 | Bacteria | 571936 |
| 353 | Ga0495687_002515 | 3300047443 | Bacteria | 14572 |
| 354 | Ga0495686_0000078 | 3300047472 | Bacteria | 203927 |
| 355 | Ga0495614_0004553 | 3300048089 | Bacteria | 6252 |
| 356 | Ga0496117_0002637 | 3300048920 | Bacteria | 22245 |
| 357 | Ga0496118_0006062 | 3300048921 | Bacteria | 13466 |
| 358 | Ga0496124_0058418 | 3300048927 | Bacteria | 3244 |
| 359 | Ga0496125_0026821 | 3300048928 | Bacteria | 5235 |
| 360 | Ga0501076_0071776 | 3300049592 | Bacteria | 2770 |
| 361 | nmdc:mga0k408_116_c3 | 3300050493 | Bacteria | 24401 |
| 362 | Ga0500647_0058781 | 3300053091 | Bacteria | 1849 |
| 363 | Ga0500583_0001914 | 3300053092 | Bacteria | 6098 |
| 364 | Ga0500608_000346 | 3300053122 | Bacteria | 17925 |
| 365 | Ga0500608_001862 | 3300053122 | Bacteria | 7525 |
| 366 | Ga0500622_0001084 | 3300053156 | Bacteria | 22666 |
| 367 | Ga0500624_000800 | 3300053157 | Bacteria | 7339 |
| 368 | Ga0500637_0045894 | 3300053178 | Bacteria | 2480 |
| 369 | 2578460243 | 2576861471 | Bacteria | 4648976 |
| 370 | 2738855713 | 2738541302 | Bacteria | 5944758 |
| 371 | 2739590627 | 2739367651 | Bacteria | 6359826 |
| 372 | 2819546561 | 2818991437 | Bacteria | 5805520 |
| 373 | 2819550015 | 2818991437 | Bacteria | 5805520 |
| 374 | 2819586017 | 2818991444 | Bacteria | 6968812 |
| 375 | 2842724928 | 2842722452 | Bacteria | 6263924 |
| 376 | 2842725258 | 2842722452 | Bacteria | 6263924 |
| 377 | 2842912530 | 2842909656 | Bacteria | 6185908 |
| 378 | 2842913051 | 2842909656 | Bacteria | 6185908 |
| 379 | 2849284595 | 2849281842 | Bacteria | 6065644 |
| 380 | 2849286257 | 2849281842 | Bacteria | 6065644 |
| 381 | 2904446708 | 2904445276 | Bacteria | 5310396 |
| 382 | 2904449384 | 2904445276 | Bacteria | 5310396 |
| 383 | 2939623323 | 2939622612 | Bacteria | 4698046 |
| 384 | 2946001900 | 2945997725 | Bacteria | 6404843 |
| 385 | 2954018753 | 2954016120 | Bacteria | 6446024 |
| 386 | 2954019072 | 2954016120 | Bacteria | 6446024 |
| 387 | 2977235809 | 2977232053 | Bacteria | 5485925 |
| 388 | 8003157156 | 8003151029 | Bacteria | 8187759 |
| 389 | Ga0495672_0047553 | |||
| 390 | JGI24739J22299_10001144 | |||
| 391 | JGI25154J39366_1000078 | |||
| 392 | JGI25153J46596_10004809 | |||
| 393 | rootH1_10038647 | |||
| 394 | rootH2_10004814 | |||
| 395 | rootH2_10055726 | |||
| 396 | rootL2_10143320 | |||
| 397 | rootH1_10086427 | |||
| 398 | rootH1_10366573 | |||
| 399 | JGI25160J50197_1002111 | |||
| 400 | JGI25160J50197_1002797 | |||
| 401 | JGI25160J50197_1008990 | |||
| 402 | Ga0055526_1019603 | |||
| 403 | Ga0055528_1003716 | |||
| 404 | Ga0055530_10005011 | |||
| 405 | Ga0065165_1000333 | |||
| 406 | Ga0065165_1001407 | |||
| 407 | Ga0065165_1023839 | |||
| 408 | Ga0065714_10010088 | |||
| 409 | Ga0065714_10064459 | |||
| 410 | Ga0070676_10001440 | |||
| 411 | Ga0070676_10007742 | |||
| 412 | Ga0070670_100063328 | |||
| 413 | Ga0070670_100110579 | |||
| 414 | Ga0070670_100165655 | |||
| 415 | Ga0070677_10045321 | |||
| 416 | Ga0068869_100035056 | |||
| 417 | Ga0068869_100079513 | |||
| 418 | Ga0070666_10000072 | |||
| 419 | Ga0070666_10007252 | |||
| 420 | Ga0070666_10020400 | |||
| 421 | Ga0070666_10139013 | |||
| 422 | Ga0068868_100021866 | |||
| 423 | Ga0068868_100047483 | |||
| 424 | Ga0068868_100048754 | |||
| 425 | Ga0068868_100152246 | |||
| 426 | Ga0070661_100104474 | |||
| 427 | Ga0070668_100146171 | |||
| 428 | Ga0070669_100012772 | |||
| 429 | Ga0070675_100017150 | |||
| 430 | Ga0070675_100045260 | |||
| 431 | Ga0070671_100017180 | |||
| 432 | Ga0070671_100024497 | |||
| 433 | Ga0070674_100047872 | |||
| 434 | Ga0070674_100078741 | |||
| 435 | Ga0070673_100012764 | |||
| 436 | Ga0070673_100045071 | |||
| 437 | Ga0070673_100073801 | |||
| 438 | Ga0070667_100006188 | |||
| 439 | Ga0070667_100014577 | |||
| 440 | Ga0070667_100060170 | |||
| 441 | Ga0070678_100007159 | |||
| 442 | Ga0070678_100047159 | |||
| 443 | Ga0070662_100000013 | |||
| 444 | Ga0070662_100103105 | |||
| 445 | Ga0068867_100003509 | |||
| 446 | Ga0070698_100039590 | |||
| 447 | Ga0070684_100061617 | |||
| 448 | Ga0068853_100030965 | |||
| 449 | Ga0068853_100053384 | |||
| 450 | Ga0070672_100004660 | |||
| 451 | Ga0070672_100051257 | |||
| 452 | Ga0070672_100093608 | |||
| 453 | Ga0070672_100099610 | |||
| 454 | Ga0070665_100000010 | |||
| 455 | Ga0070665_100000052 | |||
| 456 | Ga0070665_100011887 | |||
| 457 | Ga0070665_100088390 | |||
| 458 | Ga0070704_100002073 | |||
| 459 | Ga0068855_100006150 | |||
| 460 | Ga0068855_100013413 | |||
| 461 | Ga0068855_100047795 | |||
| 462 | Ga0068855_100060168 | |||
| 463 | Ga0070664_100037363 | |||
| 464 | Ga0068857_100116503 | |||
| 465 | Ga0068854_100017841 | |||
| 466 | Ga0068852_100001694 | |||
| 467 | Ga0068852_100002433 | |||
| 468 | Ga0068852_100006679 | |||
| 469 | Ga0068859_100000006 | |||
| 470 | Ga0068859_100027257 | |||
| 471 | Ga0068864_100008852 | |||
| 472 | Ga0068864_100030220 | |||
| 473 | Ga0068866_10019966 | |||
| 474 | Ga0068866_10026258 | |||
| 475 | Ga0068861_100005802 | |||
| 476 | Ga0068870_10010474 | |||
| 477 | Ga0068870_10020608 | |||
| 478 | Ga0068863_100006997 | |||
| 479 | Ga0068863_100022248 | |||
| 480 | Ga0068860_100000004 | |||
| 481 | Ga0068860_100001096 | |||
| 482 | Ga0068860_100002117 | |||
| 483 | Ga0068860_100002430 | |||
| 484 | Ga0068862_100139709 | |||
| 485 | Ga0075366_10001148 | |||
| 486 | Ga0097621_100000146 | |||
| 487 | Ga0097621_100000639 | |||
| 488 | Ga0097621_100015728 | |||
| 489 | Ga0068871_100000477 | |||
| 490 | Ga0068871_100002101 | |||
| 491 | Ga0068871_100004512 | |||
| 492 | Ga0068871_100016612 | |||
| 493 | Ga0068871_100064633 | |||
| 494 | Ga0068865_100000079 | |||
| 495 | Ga0068865_100003508 | |||
| 496 | Ga0097620_100000006 | |||
| 497 | Ga0097620_100027257 | |||
| 498 | Ga0105240_10002508 | |||
| 499 | Ga0105240_10011523 | |||
| 500 | Ga0105240_10014577 | |||
| 501 | Ga0105240_10113108 | |||
| 502 | Ga0105240_10156082 | |||
| 503 | Ga0105240_10201246 | |||
| 504 | Ga0105241_10000888 | |||
| 505 | Ga0105241_10002798 | |||
| 506 | Ga0105241_10003043 | |||
| 507 | Ga0105241_10195856 | |||
| 508 | Ga0105242_10012932 | |||
| 509 | Ga0105248_10037014 | |||
| 510 | Ga0105237_10000157 | |||
| 511 | Ga0105237_10000683 | |||
| 512 | Ga0105237_10000886 | |||
| 513 | Ga0105237_10001875 | |||
| 514 | Ga0105237_10003344 | |||
| 515 | Ga0105237_10011599 | |||
| 516 | Ga0105237_10025060 | |||
| 517 | Ga0105237_10056463 | |||
| 518 | Ga0105238_10000980 | |||
| 519 | Ga0105238_10001237 | |||
| 520 | Ga0105238_10002843 | |||
| 521 | Ga0105249_10005209 | |||
| 522 | Ga0105249_10023107 | |||
| 523 | Ga0105249_10055256 | |||
| 524 | Ga0105239_10000029 | |||
| 525 | Ga0105239_10004206 | |||
| 526 | Ga0105239_10009224 | |||
| 527 | Ga0105239_10042568 | |||
| 528 | Ga0105239_10050076 | |||
| 529 | Ga0105246_10007350 | |||
| 530 | Ga0105246_10024473 | |||
| 531 | Ga0105246_10028746 | |||
| 532 | Ga0105246_10039992 | |||
| 533 | Ga0157371_10000016 | |||
| 534 | Ga0157371_10004224 | |||
| 535 | Ga0157371_10004404 | |||
| 536 | Ga0157370_10019477 | |||
| 537 | Ga0157370_10178882 | |||
| 538 | Ga0157369_10000008 | |||
| 539 | Ga0157369_10026797 | |||
| 540 | Ga0157369_10217798 | |||
| 541 | Ga0157374_10000001 | |||
| 542 | Ga0157374_10000258 | |||
| 543 | Ga0157374_10001763 | |||
| 544 | Ga0157374_10014360 | |||
| 545 | Ga0157374_10169566 | |||
| 546 | Ga0157378_10003682 | |||
| 547 | Ga0157378_10083361 | |||
| 548 | Ga0157378_10212656 | |||
| 549 | Ga0163162_10000005 | |||
| 550 | Ga0163162_10000528 | |||
| 551 | Ga0163162_10002184 | |||
| 552 | Ga0163162_10016486 | |||
| 553 | Ga0163162_10325931 | |||
| 554 | Ga0157372_10000305 | |||
| 555 | Ga0157372_10013020 | |||
| 556 | Ga0157372_10058774 | |||
| 557 | Ga0157372_10101679 | |||
| 558 | Ga0157372_10117096 | |||
| 559 | Ga0157375_10000207 | |||
| 560 | Ga0157375_10035206 | |||
| 561 | Ga0157375_10104158 | |||
| 562 | Ga0163163_10000553 | |||
| 563 | Ga0163163_10064759 | |||
| 564 | Ga0163163_10078327 | |||
| 565 | Ga0163163_10143652 | |||
| 566 | Ga0182008_10000391 | |||
| 567 | Ga0157377_10013129 | |||
| 568 | Ga0157379_10028678 | |||
| 569 | Ga0157379_10040875 | |||
| 570 | Ga0157376_10000555 | |||
| 571 | Ga0157376_10001344 | |||
| 572 | Ga0157376_10084534 | |||
| 573 | Ga0182006_1000146 | |||
| 574 | Ga0182006_1001004 | |||
| 575 | Ga0182007_10000003 | |||
| 576 | Ga0183373_1001 | |||
| 577 | Ga0163161_10001075 | |||
| 578 | Ga0163161_10001303 | |||
| 579 | Ga0163161_10002039 | |||
| 580 | Ga0163161_10003175 | |||
| 581 | Ga0163161_10060206 | |||
| 582 | Ga0163161_10123655 | |||
| 583 | Ga0163161_10226468 | |||
| 584 | Ga0213872_10003022 | |||
| 585 | Ga0213876_10021968 | |||
| 586 | Ga0213876_10037242 | |||
| 587 | Ga0209646_1000004 | |||
| 588 | Ga0209026_1000136 | |||
| 589 | Ga0209026_1000842 | |||
| 590 | Ga0209673_1000519 | |||
| 591 | Ga0209025_1000005 | |||
| 592 | Ga0209564_1003135 | |||
| 593 | Ga0209564_1005021 | |||
| 594 | Ga0209758_1002710 | |||
| 595 | Ga0209758_1009141 | |||
| 596 | Ga0209758_1010338 | |||
| 597 | Ga0209050_1000276 | |||
| 598 | Ga0207426_1000032 | |||
| 599 | Ga0207426_1000089 | |||
| 600 | Ga0207426_1000367 | |||
| 601 | Ga0207426_1001395 | |||
| 602 | Ga0209257_1000931 | |||
| 603 | Ga0207682_10014039 | |||
| 604 | Ga0207682_10014550 | |||
| 605 | Ga0207680_10000024 | |||
| 606 | Ga0207680_10078657 | |||
| 607 | Ga0207647_10000044 | |||
| 608 | Ga0207645_10000219 | |||
| 609 | Ga0207645_10000558 | |||
| 610 | Ga0207643_10025264 | |||
| 611 | Ga0207654_10001733 | |||
| 612 | Ga0207654_10001873 | |||
| 613 | Ga0207654_10050827 | |||
| 614 | Ga0207695_10001521 | |||
| 615 | Ga0207695_10014747 | |||
| 616 | Ga0207695_10077767 | |||
| 617 | Ga0207671_10000450 | |||
| 618 | Ga0207671_10002380 | |||
| 619 | Ga0207671_10002525 | |||
| 620 | Ga0207671_10005345 | |||
| 621 | Ga0207671_10006651 | |||
| 622 | Ga0207671_10015022 | |||
| 623 | Ga0207671_10057245 | |||
| 624 | Ga0207681_10102020 | |||
| 625 | Ga0207694_10002932 | |||
| 626 | Ga0207694_10020187 | |||
| 627 | Ga0207694_10030683 | |||
| 628 | Ga0207694_10035316 | |||
| 629 | Ga0207650_10015363 | |||
| 630 | Ga0207650_10023987 | |||
| 631 | Ga0207650_10142350 | |||
| 632 | Ga0207659_10040039 | |||
| 633 | Ga0207687_10043871 | |||
| 634 | Ga0207644_10006227 | |||
| 635 | Ga0207706_10000173 | |||
| 636 | Ga0207706_10031779 | |||
| 637 | Ga0207706_10089187 | |||
| 638 | Ga0207669_10102922 | |||
| 639 | Ga0207704_10000019 | |||
| 640 | Ga0207691_10014563 | |||
| 641 | Ga0207691_10019389 | |||
| 642 | Ga0207689_10001199 | |||
| 643 | Ga0207689_10001505 | |||
| 644 | Ga0207689_10026945 | |||
| 645 | Ga0207689_10066632 | |||
| 646 | Ga0207667_10000968 | |||
| 647 | Ga0207667_10007266 | |||
| 648 | Ga0207667_10016309 | |||
| 649 | Ga0207667_10244504 | |||
| 650 | Ga0207712_10069522 | |||
| 651 | Ga0207668_10043026 | |||
| 652 | Ga0207668_10093180 | |||
| 653 | Ga0207658_10008008 | |||
| 654 | Ga0207658_10043905 | |||
| 655 | Ga0207677_10017494 | |||
| 656 | Ga0207677_10044355 | |||
| 657 | Ga0207677_10086033 | |||
| 658 | Ga0207677_10087160 | |||
| 659 | Ga0207639_10004313 | |||
| 660 | Ga0207641_10000058 | |||
| 661 | Ga0207641_10020384 | |||
| 662 | Ga0207641_10218483 | |||
| 663 | Ga0207648_10002523 | |||
| 664 | Ga0207648_10002973 | |||
| 665 | Ga0207674_10000629 | |||
| 666 | Ga0207675_100006970 | |||
| 667 | Ga0207675_100026719 | |||
| 668 | Ga0207683_10000730 | |||
| 669 | Ga0207698_10001840 | |||
| 670 | Ga0207698_10004648 | |||
| 671 | Ga0207698_10042478 | |||
| 672 | Ga0268266_10000032 | |||
| 673 | Ga0268266_10000070 | |||
| 674 | Ga0268266_10102248 | |||
| 675 | Ga0268265_10127216 | |||
| 676 | Ga0268265_10162706 | |||
| 677 | Ga0268264_10000011 | |||
| 678 | Ga0268264_10002040 | |||
| 679 | Ga0268264_10002921 | |||
| 680 | Ga0268264_10003791 | |||
| 681 | Ga0307517_10000640 | |||
| 682 | Ga0307515_10000059 | |||
| 683 | Ga0307515_10004635 | |||
| 684 | Ga0307515_10026520 | |||
| 685 | Ga0307515_10034128 | |||
| 686 | Ga0307515_10052539 | |||
| 687 | Ga0307511_10001201 | |||
| 688 | Ga0265327_10000168 | |||
| 689 | Ga0265327_10024826 | |||
| 690 | Ga0307509_10012028 | |||
| 691 | Ga0307509_10096204 | |||
| 692 | Ga0307516_10031082 | |||
| 693 | Ga0307405_10000032 | |||
| 694 | Ga0307407_10000151 | |||
| 695 | Ga0307416_100000009 | |||
| 696 | Ga0307414_10002186 | |||
| 697 | Ga0307414_10032338 | |||
| 698 | Ga0307414_10099782 | |||
| 699 | Ga0307507_10000010 | |||
| 700 | Ga0307510_10000062 | |||
| 701 | Ga0307510_10004416 | |||
| 702 | Ga0395899_0000563 | |||
| 703 | Ga0395900_0000173 | |||
| 704 | Ga0395898_0018685 | |||
| 705 | Ga0395905_0000641 | |||
| 706 | Ga0395901_0000294 | |||
| 707 | Ga0436365_0935453 | |||
| 708 | Ga0436361_0123021 | |||
| 709 | Ga0466972_0000001 | |||
| 710 | Ga0466972_0024963 | |||
| 711 | Ga0466968_0064866 | |||
| 712 | Ga0466970_0000065 | |||
| 713 | Ga0466970_0001560 | |||
| 714 | Ga0495627_038802 | |||
| 715 | Ga0495638_0011610 | |||
| 716 | Ga0495585_0006676 | |||
| 717 | Ga0495606_0003716 | |||
| 718 | Ga0495606_0029107 | |||
| 719 | Ga0495610_0000150 | |||
| 720 | Ga0495610_0000519 | |||
| 721 | Ga0495616_0007790 | |||
| 722 | Ga0495631_0007677 | |||
| 723 | Ga0495637_0026159 | |||
| 724 | Ga0495648_0005100 | |||
| 725 | Ga0495648_0070368 | |||
| 726 | Ga0495648_0078157 | |||
| 727 | Ga0495609_0013557 | |||
| 728 | Ga0495633_0000322 | |||
| 729 | Ga0495668_0000044 | |||
| 730 | Ga0495611_0001630 | |||
| 731 | Ga0495625_0001984 | |||
| 732 | Ga0495625_0003910 | |||
| 733 | Ga0495625_0051693 | |||
| 734 | Ga0495625_0154709 | |||
| 735 | Ga0495661_0003287 | |||
| 736 | Ga0495661_0037652 | |||
| 737 | Ga0495658_0105319 | |||
| 738 | Ga0495649_0027183 | |||
| 739 | Ga0495600_0134920 | |||
| 740 | Ga0495687_000006 | |||
| 741 | Ga0495687_002515 | |||
| 742 | Ga0495686_0000078 | |||
| 743 | Ga0495614_0004553 | |||
| 744 | Ga0496117_0002637 | |||
| 745 | Ga0496118_0006062 | |||
| 746 | Ga0496124_0058418 | |||
| 747 | Ga0496125_0026821 | |||
| 748 | Ga0501076_0071776 | |||
| 749 | nmdc:mga0k408_116_c3 | |||
| 750 | Ga0500647_0058781 | |||
| 751 | Ga0500583_0001914 | |||
| 752 | Ga0500608_000346 | |||
| 753 | Ga0500608_001862 | |||
| 754 | Ga0500622_0001084 | |||
| 755 | Ga0500624_000800 | |||
| 756 | Ga0500637_0045894 | |||
| 757 | 2578460243 | |||
| 758 | 2738855713 | |||
| 759 | 2739590627 | |||
| 760 | 2819546561 | |||
| 761 | 2819550015 | |||
| 762 | 2819586017 | |||
| 763 | 2842724928 | |||
| 764 | 2842725258 | |||
| 765 | 2842912530 | |||
| 766 | 2842913051 | |||
| 767 | 2849284595 | |||
| 768 | 2849286257 | |||
| 769 | 2904446708 | |||
| 770 | 2904449384 | |||
| 771 | 2939623323 | |||
| 772 | 2946001900 | |||
| 773 | 2954018753 | |||
| 774 | 2954019072 | |||
| 775 | 2977235809 | |||
| 776 | 8003157156 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vl4-assembly1.cif.gz_B | crystal structure of a putative modulator of a dna gyrase (tm0727) from thermotoga maritima msb8 at 1.95 a resolution | 0.877 | 9 | 438 |
| 6j6a-assembly1.cif.gz_B | crystal structure of tlde from thermococcus kodakarensis | 0.8746 | 9 | 439 |
| 1vl4-assembly1.cif.gz_B | crystal structure of a putative modulator of a dna gyrase (tm0727) from thermotoga maritima msb8 at 1.95 a resolution | 0.8732 | 9 | 438 |
| 3qtd-assembly2.cif.gz_B | crystal structure of putative modulator of gyrase (pmba) from pseudomonas aeruginosa pao1 | 0.8638 | 6 | 439 |
| 3tv9-assembly1.cif.gz_A-2 | crystal structure of putative peptide maturation protein from shigella flexneri | 0.8549 | 6 | 434 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57684_3_193_3.30.2290.10 | Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily | 0.8798 | 13 | 207 | 3.30.2290.10 |
| 1vl4B01 | Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily | 0.8583 | 4 | 211 | 3.30.2290.10 |
| af_Q57684_3_193_3.30.2290.10 | Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily | 0.8582 | 13 | 207 | 3.30.2290.10 |
| af_P71898_23_321_3.30.2290.10 | Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily | 0.8575 | 25 | 310 | 3.30.2290.10 |
| 1vl4B01 | Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily | 0.8505 | 4 | 211 | 3.30.2290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3DBT1-F1-model_v4 | TldD/PmbA family protein | 0.9945 | 1 | 212 |
GO:0006508
GO:0008237 |
| AF-A0A4Q3DBT1-F1-model_v4 | TldD/PmbA family protein | 0.9899 | 1 | 212 |
GO:0006508
GO:0008237 |
| AF-A0A7Y4VI98-F1-model_v4 | TldD/PmbA family protein | 0.9852 | 3 | 349 |
GO:0006508
GO:0008237 |
| AF-A0A0S8A8Y1-F1-model_v4 | Peptidase C69 | 0.9827 | 2 | 443 |
GO:0006508
GO:0008237 |
| AF-A0A5E6MGA2-F1-model_v4 | PmbA protein | 0.9806 | 3 | 443 |
GO:0006508
GO:0008237 |