F433863

General Info

Members Datasets Scaffolds Average Seq Length
397 195 776 443

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0047553|Ga0495672_0047553_27_1364
Length 436
Sequence MPILSKDEAQALLKKVLAYSKSNECEANLSGSDGGNIRYARNAVSTSGGISQNTLVVSSAYGKKLGTATINEFDDASLEKVVRRSEELAQLAPENPEFVPFLGPQQYAADSKTFEPRTAAIDPKFRTDAVAQSLQISKDNDLVAAGYLENTAGFAAMMNSKGLFAYNTSTNVNFNVTLRTKDGKGSGYASKGYTDVAKLDXVTAGSSGARALEPGKYTVILEPTAAIVLLETIFFGMDARSADEGRSFLSKPDGKTKLGEKLVDERVNIYSDPQNPDLPTSSWNSDGRPQEKINWIEKGVMKNLYYSRYWAQKKNVKAIPGPDGIIMEGGNASLEDLIKGTEKGVLVTRLWYIRPVDPQTLLYTGLTRDGTFYIENGQIKFPIKNFRFNESAIIMLNNLDALGKPERTVSGESGTQALIPPLKIRDFTFSSLSDAI

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
177 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
178 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
181 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
182 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
183 2738541302 Pedobacter sp. CF074 Isolate Unclassified
184 2739367651 Pedobacter sp. OK291 Isolate Unclassified
185 2818991437 Pedobacter terrae 518 Isolate Unclassified
186 2818991444 Filimonas endophytica 3197 Isolate Unclassified
187 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
188 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
189 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
190 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
191 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
192 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
193 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
194 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
195 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.96
Metatranscriptomes 0
Isolates 5.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.06
Nodule 0
Rhizoplane 0
Rhizosphere 81.36
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0047553 3300047320 Bacteria 2550
2 JGI24739J22299_10001144 3300001989 Bacteria 9897
3 JGI25154J39366_1000078 3300002738 Bacteria 90241
4 JGI25153J46596_10004809 3300003215 Bacteria 7194
5 rootH1_10038647 3300003316 Bacteria 3892
6 rootH2_10004814 3300003320 Bacteria 18173
7 rootH2_10055726 3300003320 Bacteria 1929
8 rootL2_10143320 3300003322 Bacteria 2708
9 rootH1_10086427 3300003323 Bacteria 16741
10 rootH1_10366573 3300003323 Bacteria 1956
11 JGI25160J50197_1002111 3300003354 Bacteria 9446
12 JGI25160J50197_1002797 3300003354 Bacteria 7989
13 JGI25160J50197_1008990 3300003354 Bacteria 3748
14 Ga0055526_1019603 3300003771 Bacteria 2456
15 Ga0055528_1003716 3300003790 Bacteria 7548
16 Ga0055530_10005011 3300003791 Bacteria 6532
17 Ga0065165_1000333 3300005262 Bacteria 77078
18 Ga0065165_1001407 3300005262 Bacteria 26218
19 Ga0065165_1023839 3300005262 Bacteria 2067
20 Ga0065714_10010088 3300005288 Bacteria 2413
21 Ga0065714_10064459 3300005288 Bacteria 66711
22 Ga0070676_10001440 3300005328 Bacteria 12023
23 Ga0070676_10007742 3300005328 Bacteria 5768
24 Ga0070670_100063328 3300005331 Bacteria 3174
25 Ga0070670_100110579 3300005331 Unclassified 2367
26 Ga0070670_100165655 3300005331 Bacteria 1916
27 Ga0070677_10045321 3300005333 Bacteria 1754
28 Ga0068869_100035056 3300005334 Bacteria 3555
29 Ga0068869_100079513 3300005334 Bacteria 2443
30 Ga0070666_10000072 3300005335 Bacteria 75356
31 Ga0070666_10007252 3300005335 Bacteria 6836
32 Ga0070666_10020400 3300005335 Bacteria 4284
33 Ga0070666_10139013 3300005335 Bacteria 1691
34 Ga0068868_100021866 3300005338 Bacteria 4821
35 Ga0068868_100047483 3300005338 Bacteria 3365
36 Ga0068868_100048754 3300005338 Bacteria 3323
37 Ga0068868_100152246 3300005338 Bacteria 1905
38 Ga0070661_100104474 3300005344 Unclassified 2110
39 Ga0070668_100146171 3300005347 Bacteria 1908
40 Ga0070669_100012772 3300005353 Bacteria 5963
41 Ga0070675_100017150 3300005354 Bacteria 5754
42 Ga0070675_100045260 3300005354 Bacteria 3601
43 Ga0070671_100017180 3300005355 Bacteria 5856
44 Ga0070671_100024497 3300005355 Bacteria 4941
45 Ga0070674_100047872 3300005356 Bacteria 2932
46 Ga0070674_100078741 3300005356 Bacteria 2349
47 Ga0070673_100012764 3300005364 Bacteria 5780
48 Ga0070673_100045071 3300005364 Bacteria 3418
49 Ga0070673_100073801 3300005364 Bacteria 2747
50 Ga0070667_100006188 3300005367 Bacteria 9955
51 Ga0070667_100014577 3300005367 Bacteria 6496
52 Ga0070667_100060170 3300005367 Bacteria 3214
53 Ga0070678_100007159 3300005456 Bacteria 6597
54 Ga0070678_100047159 3300005456 Bacteria 3094
55 Ga0070662_100000013 3300005457 Bacteria 125019
56 Ga0070662_100103105 3300005457 Bacteria 2163
57 Ga0068867_100003509 3300005459 Bacteria 11026
58 Ga0070698_100039590 3300005471 Bacteria 4850
59 Ga0070684_100061617 3300005535 Bacteria 3284
60 Ga0068853_100030965 3300005539 Bacteria 4522
61 Ga0068853_100053384 3300005539 Bacteria 3481
62 Ga0070672_100004660 3300005543 Bacteria 8991
63 Ga0070672_100051257 3300005543 Bacteria 3217
64 Ga0070672_100093608 3300005543 Bacteria 2428
65 Ga0070672_100099610 3300005543 Bacteria 2356
66 Ga0070665_100000010 3300005548 Bacteria 529545
67 Ga0070665_100000052 3300005548 Bacteria 245694
68 Ga0070665_100011887 3300005548 Bacteria 8791
69 Ga0070665_100088390 3300005548 Unclassified 3104
70 Ga0070704_100002073 3300005549 Bacteria 11137
71 Ga0068855_100006150 3300005563 Bacteria 14635
72 Ga0068855_100013413 3300005563 Bacteria 9881
73 Ga0068855_100047795 3300005563 Bacteria 5054
74 Ga0068855_100060168 3300005563 Bacteria 4443
75 Ga0070664_100037363 3300005564 Bacteria 4083
76 Ga0068857_100116503 3300005577 Bacteria 2404
77 Ga0068854_100017841 3300005578 Bacteria 4757
78 Ga0068852_100001694 3300005616 Bacteria 15026
79 Ga0068852_100002433 3300005616 Bacteria 12817
80 Ga0068852_100006679 3300005616 Bacteria 8361
81 Ga0068859_100000006 3300005617 Bacteria 421509
82 Ga0068859_100027257 3300005617 Bacteria 5731
83 Ga0068864_100008852 3300005618 Bacteria 8297
84 Ga0068864_100030220 3300005618 Bacteria 4592
85 Ga0068866_10019966 3300005718 Bacteria 3061
86 Ga0068866_10026258 3300005718 Bacteria 2748
87 Ga0068861_100005802 3300005719 Bacteria 8381
88 Ga0068870_10010474 3300005840 Bacteria 4265
89 Ga0068870_10020608 3300005840 Unclassified 3213
90 Ga0068863_100006997 3300005841 Bacteria 11057
91 Ga0068863_100022248 3300005841 Bacteria 6053
92 Ga0068860_100000004 3300005843 Bacteria 506126
93 Ga0068860_100001096 3300005843 Bacteria 29818
94 Ga0068860_100002117 3300005843 Bacteria 20935
95 Ga0068860_100002430 3300005843 Bacteria 19567
96 Ga0068862_100139709 3300005844 Bacteria 2149
97 Ga0075366_10001148 3300006195 Bacteria 13098
98 Ga0097621_100000146 3300006237 Bacteria 42998
99 Ga0097621_100000639 3300006237 Bacteria 24750
100 Ga0097621_100015728 3300006237 Bacteria 5701
101 Ga0068871_100000477 3300006358 Bacteria 27401
102 Ga0068871_100002101 3300006358 Bacteria 13481
103 Ga0068871_100004512 3300006358 Bacteria 9700
104 Ga0068871_100016612 3300006358 Bacteria 5550
105 Ga0068871_100064633 3300006358 Bacteria 2996
106 Ga0068865_100000079 3300006881 Bacteria 51370
107 Ga0068865_100003508 3300006881 Bacteria 9402
108 Ga0097620_100000006 3300006931 Bacteria 421509
109 Ga0097620_100027257 3300006931 Bacteria 5731
110 Ga0105240_10002508 3300009093 Bacteria 29504
111 Ga0105240_10011523 3300009093 Bacteria 12306
112 Ga0105240_10014577 3300009093 Bacteria 10725
113 Ga0105240_10113108 3300009093 Bacteria 3280
114 Ga0105240_10156082 3300009093 Bacteria 2714
115 Ga0105240_10201246 3300009093 Bacteria 2334
116 Ga0105241_10000888 3300009174 Bacteria 22590
117 Ga0105241_10002798 3300009174 Bacteria 13057
118 Ga0105241_10003043 3300009174 Bacteria 12512
119 Ga0105241_10195856 3300009174 Bacteria 1685
120 Ga0105242_10012932 3300009176 Bacteria 6435
121 Ga0105248_10037014 3300009177 Bacteria 5457
122 Ga0105237_10000157 3300009545 Bacteria 96235
123 Ga0105237_10000683 3300009545 Bacteria 46945
124 Ga0105237_10000886 3300009545 Bacteria 40329
125 Ga0105237_10001875 3300009545 Bacteria 26830
126 Ga0105237_10003344 3300009545 Bacteria 19091
127 Ga0105237_10011599 3300009545 Bacteria 9322
128 Ga0105237_10025060 3300009545 Bacteria 6101
129 Ga0105237_10056463 3300009545 Bacteria 3930
130 Ga0105238_10000980 3300009551 Bacteria 29183
131 Ga0105238_10001237 3300009551 Bacteria 25698
132 Ga0105238_10002843 3300009551 Bacteria 17277
133 Ga0105249_10005209 3300009553 Bacteria 11220
134 Ga0105249_10023107 3300009553 Bacteria 5576
135 Ga0105249_10055256 3300009553 Bacteria 3631
136 Ga0105239_10000029 3300010375 Bacteria 234749
137 Ga0105239_10004206 3300010375 Bacteria 17283
138 Ga0105239_10009224 3300010375 Bacteria 11160
139 Ga0105239_10042568 3300010375 Bacteria 4976
140 Ga0105239_10050076 3300010375 Bacteria 4582
141 Ga0105246_10007350 3300011119 Bacteria 6749
142 Ga0105246_10024473 3300011119 Bacteria 3924
143 Ga0105246_10028746 3300011119 Bacteria 3654
144 Ga0105246_10039992 3300011119 Bacteria 3162
145 Ga0157371_10000016 3300013102 Bacteria 330495
146 Ga0157371_10004224 3300013102 Bacteria 12634
147 Ga0157371_10004404 3300013102 Bacteria 12310
148 Ga0157370_10019477 3300013104 Bacteria 6806
149 Ga0157370_10178882 3300013104 Bacteria 1971
150 Ga0157369_10000008 3300013105 Bacteria 309315
151 Ga0157369_10026797 3300013105 Bacteria 6391
152 Ga0157369_10217798 3300013105 Bacteria 1999
153 Ga0157374_10000001 3300013296 Bacteria 1077351
154 Ga0157374_10000258 3300013296 Bacteria 48926
155 Ga0157374_10001763 3300013296 Bacteria 18206
156 Ga0157374_10014360 3300013296 Bacteria 6931
157 Ga0157374_10169566 3300013296 Unclassified 2128
158 Ga0157378_10003682 3300013297 Bacteria 13587
159 Ga0157378_10083361 3300013297 Bacteria 2893
160 Ga0157378_10212656 3300013297 Bacteria 1834
161 Ga0163162_10000005 3300013306 Bacteria 447195
162 Ga0163162_10000528 3300013306 Bacteria 35474
163 Ga0163162_10002184 3300013306 Bacteria 18347
164 Ga0163162_10016486 3300013306 Bacteria 7218
165 Ga0163162_10325931 3300013306 Bacteria 1668
166 Ga0157372_10000305 3300013307 Bacteria 54763
167 Ga0157372_10013020 3300013307 Bacteria 8870
168 Ga0157372_10058774 3300013307 Bacteria 4299
169 Ga0157372_10101679 3300013307 Bacteria 3282
170 Ga0157372_10117096 3300013307 Bacteria 3056
171 Ga0157375_10000207 3300013308 Bacteria 54636
172 Ga0157375_10035206 3300013308 Bacteria 4777
173 Ga0157375_10104158 3300013308 Bacteria 2926
174 Ga0163163_10000553 3300014325 Bacteria 32772
175 Ga0163163_10064759 3300014325 Bacteria 3627
176 Ga0163163_10078327 3300014325 Bacteria 3302
177 Ga0163163_10143652 3300014325 Bacteria 2429
178 Ga0182008_10000391 3300014497 Bacteria 34009
179 Ga0157377_10013129 3300014745 Bacteria 4185
180 Ga0157379_10028678 3300014968 Bacteria 4950
181 Ga0157379_10040875 3300014968 Bacteria 4139
182 Ga0157376_10000555 3300014969 Bacteria 24024
183 Ga0157376_10001344 3300014969 Bacteria 16206
184 Ga0157376_10084534 3300014969 Bacteria 2733
185 Ga0182006_1000146 3300015261 Bacteria 75345
186 Ga0182006_1001004 3300015261 Bacteria 18475
187 Ga0182007_10000003 3300015262 Bacteria 548244
188 Ga0183373_1001 3300015682 Bacteria 1410374
189 Ga0163161_10001075 3300017792 Bacteria 20677
190 Ga0163161_10001303 3300017792 Bacteria 18557
191 Ga0163161_10002039 3300017792 Bacteria 14629
192 Ga0163161_10003175 3300017792 Bacteria 11590
193 Ga0163161_10060206 3300017792 Bacteria 2763
194 Ga0163161_10123655 3300017792 Bacteria 1946
195 Ga0163161_10226468 3300017792 Bacteria 1449
196 Ga0213872_10003022 3300021361 Bacteria 9501
197 Ga0213876_10021968 3300021384 Bacteria 3374
198 Ga0213876_10037242 3300021384 Bacteria 2566
199 Ga0209646_1000004 3300025246 Bacteria 786587
200 Ga0209026_1000136 3300025250 Bacteria 116507
201 Ga0209026_1000842 3300025250 Bacteria 16208
202 Ga0209673_1000519 3300025273 Bacteria 63063
203 Ga0209025_1000005 3300025294 Bacteria 1272149
204 Ga0209564_1003135 3300025295 Bacteria 11670
205 Ga0209564_1005021 3300025295 Bacteria 7760
206 Ga0209758_1002710 3300025297 Bacteria 17456
207 Ga0209758_1009141 3300025297 Bacteria 6237
208 Ga0209758_1010338 3300025297 Bacteria 5600
209 Ga0209050_1000276 3300025298 Bacteria 109997
210 Ga0207426_1000032 3300025302 Bacteria 457997
211 Ga0207426_1000089 3300025302 Bacteria 281224
212 Ga0207426_1000367 3300025302 Bacteria 80232
213 Ga0207426_1001395 3300025302 Bacteria 20376
214 Ga0209257_1000931 3300025304 Bacteria 40523
215 Ga0207682_10014039 3300025893 Bacteria 3121
216 Ga0207682_10014550 3300025893 Bacteria 3067
217 Ga0207680_10000024 3300025903 Bacteria 82106
218 Ga0207680_10078657 3300025903 Bacteria 2066
219 Ga0207647_10000044 3300025904 Bacteria 90491
220 Ga0207645_10000219 3300025907 Bacteria 47364
221 Ga0207645_10000558 3300025907 Bacteria 30976
222 Ga0207643_10025264 3300025908 Bacteria 3282
223 Ga0207654_10001733 3300025911 Bacteria 11338
224 Ga0207654_10001873 3300025911 Bacteria 10898
225 Ga0207654_10050827 3300025911 Bacteria 2384
226 Ga0207695_10001521 3300025913 Bacteria 38468
227 Ga0207695_10014747 3300025913 Bacteria 9239
228 Ga0207695_10077767 3300025913 Bacteria 3369
229 Ga0207671_10000450 3300025914 Bacteria 56924
230 Ga0207671_10002380 3300025914 Bacteria 20199
231 Ga0207671_10002525 3300025914 Bacteria 19503
232 Ga0207671_10005345 3300025914 Bacteria 11881
233 Ga0207671_10006651 3300025914 Bacteria 10247
234 Ga0207671_10015022 3300025914 Bacteria 6087
235 Ga0207671_10057245 3300025914 Bacteria 2889
236 Ga0207681_10102020 3300025923 Bacteria 2071
237 Ga0207694_10002932 3300025924 Bacteria 13705
238 Ga0207694_10020187 3300025924 Bacteria 5040
239 Ga0207694_10030683 3300025924 Bacteria 4104
240 Ga0207694_10035316 3300025924 Bacteria 3834
241 Ga0207650_10015363 3300025925 Bacteria 5331
242 Ga0207650_10023987 3300025925 Bacteria 4331
243 Ga0207650_10142350 3300025925 Bacteria 1886
244 Ga0207659_10040039 3300025926 Bacteria 3274
245 Ga0207687_10043871 3300025927 Bacteria 3083
246 Ga0207644_10006227 3300025931 Bacteria 7779
247 Ga0207706_10000173 3300025933 Bacteria 71958
248 Ga0207706_10031779 3300025933 Bacteria 4702
249 Ga0207706_10089187 3300025933 Bacteria 2711
250 Ga0207669_10102922 3300025937 Bacteria 1893
251 Ga0207704_10000019 3300025938 Bacteria 152734
252 Ga0207691_10014563 3300025940 Bacteria 7496
253 Ga0207691_10019389 3300025940 Bacteria 6437
254 Ga0207689_10001199 3300025942 Bacteria 24909
255 Ga0207689_10001505 3300025942 Bacteria 22204
256 Ga0207689_10026945 3300025942 Bacteria 4811
257 Ga0207689_10066632 3300025942 Bacteria 2960
258 Ga0207667_10000968 3300025949 Bacteria 36617
259 Ga0207667_10007266 3300025949 Bacteria 13358
260 Ga0207667_10016309 3300025949 Bacteria 8397
261 Ga0207667_10244504 3300025949 Bacteria 1836
262 Ga0207712_10069522 3300025961 Bacteria 2526
263 Ga0207668_10043026 3300025972 Bacteria 3062
264 Ga0207668_10093180 3300025972 Bacteria 2219
265 Ga0207658_10008008 3300025986 Bacteria 7197
266 Ga0207658_10043905 3300025986 Bacteria 3252
267 Ga0207677_10017494 3300026023 Bacteria 4276
268 Ga0207677_10044355 3300026023 Bacteria 2962
269 Ga0207677_10086033 3300026023 Bacteria 2271
270 Ga0207677_10087160 3300026023 Bacteria 2259
271 Ga0207639_10004313 3300026041 Bacteria 9582
272 Ga0207641_10000058 3300026088 Bacteria 166385
273 Ga0207641_10020384 3300026088 Bacteria 5445
274 Ga0207641_10218483 3300026088 Unclassified 1766
275 Ga0207648_10002523 3300026089 Bacteria 19646
276 Ga0207648_10002973 3300026089 Bacteria 17907
277 Ga0207674_10000629 3300026116 Bacteria 46056
278 Ga0207675_100006970 3300026118 Bacteria 10691
279 Ga0207675_100026719 3300026118 Bacteria 5373
280 Ga0207683_10000730 3300026121 Bacteria 29877
281 Ga0207698_10001840 3300026142 Bacteria 12395
282 Ga0207698_10004648 3300026142 Bacteria 8389
283 Ga0207698_10042478 3300026142 Bacteria 3397
284 Ga0268266_10000032 3300028379 Bacteria 395079
285 Ga0268266_10000070 3300028379 Bacteria 235423
286 Ga0268266_10102248 3300028379 Bacteria 2527
287 Ga0268265_10127216 3300028380 Bacteria 2111
288 Ga0268265_10162706 3300028380 Bacteria 1898
289 Ga0268264_10000011 3300028381 Bacteria 580884
290 Ga0268264_10002040 3300028381 Bacteria 18038
291 Ga0268264_10002921 3300028381 Bacteria 14854
292 Ga0268264_10003791 3300028381 Bacteria 12967
293 Ga0307517_10000640 3300028786 Bacteria 59989
294 Ga0307515_10000059 3300028794 Bacteria 257520
295 Ga0307515_10004635 3300028794 Bacteria 28227
296 Ga0307515_10026520 3300028794 Bacteria 9970
297 Ga0307515_10034128 3300028794 Bacteria 8346
298 Ga0307515_10052539 3300028794 Bacteria 6041
299 Ga0307511_10001201 3300030521 Bacteria 27539
300 Ga0265327_10000168 3300031251 Bacteria 141392
301 Ga0265327_10024826 3300031251 Bacteria 3510
302 Ga0307509_10012028 3300031507 Bacteria 10390
303 Ga0307509_10096204 3300031507 Bacteria 3014
304 Ga0307516_10031082 3300031730 Bacteria 5384
305 Ga0307405_10000032 3300031731 Bacteria 98354
306 Ga0307407_10000151 3300031903 Bacteria 21356
307 Ga0307416_100000009 3300032002 Bacteria 374271
308 Ga0307414_10002186 3300032004 Bacteria 10202
309 Ga0307414_10032338 3300032004 Bacteria 3443
310 Ga0307414_10099782 3300032004 Bacteria 2182
311 Ga0307507_10000010 3300033179 Bacteria 265208
312 Ga0307510_10000062 3300033180 Bacteria 81920
313 Ga0307510_10004416 3300033180 Bacteria 16557
314 Ga0395899_0000563 3300037312 Bacteria 39619
315 Ga0395900_0000173 3300037418 Bacteria 103767
316 Ga0395898_0018685 3300037466 Bacteria 7067
317 Ga0395905_0000641 3300037471 Bacteria 46724
318 Ga0395901_0000294 3300038443 Bacteria 61869
319 Ga0436365_0935453 3300039437 Bacteria 8337
320 Ga0436361_0123021 3300039447 Bacteria 13910
321 Ga0466972_0000001 3300044658 Bacteria 412457
322 Ga0466972_0024963 3300044658 Bacteria 2965
323 Ga0466968_0064866 3300044735 Bacteria 1580
324 Ga0466970_0000065 3300044765 Bacteria 41709
325 Ga0466970_0001560 3300044765 Bacteria 11058
326 Ga0495627_038802 3300046453 Bacteria 1471
327 Ga0495638_0011610 3300046460 Bacteria 6066
328 Ga0495585_0006676 3300046492 Bacteria 7128
329 Ga0495606_0003716 3300046507 Bacteria 15924
330 Ga0495606_0029107 3300046507 Bacteria 3884
331 Ga0495610_0000150 3300046512 Bacteria 76876
332 Ga0495610_0000519 3300046512 Bacteria 38756
333 Ga0495616_0007790 3300046513 Bacteria 6392
334 Ga0495631_0007677 3300046518 Bacteria 5476
335 Ga0495637_0026159 3300046520 Bacteria 2623
336 Ga0495648_0005100 3300046524 Bacteria 11018
337 Ga0495648_0070368 3300046524 Bacteria 2033
338 Ga0495648_0078157 3300046524 Bacteria 1893
339 Ga0495609_0013557 3300046538 Bacteria 3847
340 Ga0495633_0000322 3300046558 Bacteria 54099
341 Ga0495668_0000044 3300046616 Bacteria 227585
342 Ga0495611_0001630 3300046648 Bacteria 10893
343 Ga0495625_0001984 3300046660 Bacteria 23086
344 Ga0495625_0003910 3300046660 Bacteria 14358
345 Ga0495625_0051693 3300046660 Bacteria 2945
346 Ga0495625_0154709 3300046660 Bacteria 1539
347 Ga0495661_0003287 3300046665 Bacteria 12000
348 Ga0495661_0037652 3300046665 Bacteria 3018
349 Ga0495658_0105319 3300046683 Bacteria 1689
350 Ga0495649_0027183 3300046694 Bacteria 3176
351 Ga0495600_0134920 3300046809 Bacteria 1604
352 Ga0495687_000006 3300047443 Bacteria 571936
353 Ga0495687_002515 3300047443 Bacteria 14572
354 Ga0495686_0000078 3300047472 Bacteria 203927
355 Ga0495614_0004553 3300048089 Bacteria 6252
356 Ga0496117_0002637 3300048920 Bacteria 22245
357 Ga0496118_0006062 3300048921 Bacteria 13466
358 Ga0496124_0058418 3300048927 Bacteria 3244
359 Ga0496125_0026821 3300048928 Bacteria 5235
360 Ga0501076_0071776 3300049592 Bacteria 2770
361 nmdc:mga0k408_116_c3 3300050493 Bacteria 24401
362 Ga0500647_0058781 3300053091 Bacteria 1849
363 Ga0500583_0001914 3300053092 Bacteria 6098
364 Ga0500608_000346 3300053122 Bacteria 17925
365 Ga0500608_001862 3300053122 Bacteria 7525
366 Ga0500622_0001084 3300053156 Bacteria 22666
367 Ga0500624_000800 3300053157 Bacteria 7339
368 Ga0500637_0045894 3300053178 Bacteria 2480
369 2578460243 2576861471 Bacteria 4648976
370 2738855713 2738541302 Bacteria 5944758
371 2739590627 2739367651 Bacteria 6359826
372 2819546561 2818991437 Bacteria 5805520
373 2819550015 2818991437 Bacteria 5805520
374 2819586017 2818991444 Bacteria 6968812
375 2842724928 2842722452 Bacteria 6263924
376 2842725258 2842722452 Bacteria 6263924
377 2842912530 2842909656 Bacteria 6185908
378 2842913051 2842909656 Bacteria 6185908
379 2849284595 2849281842 Bacteria 6065644
380 2849286257 2849281842 Bacteria 6065644
381 2904446708 2904445276 Bacteria 5310396
382 2904449384 2904445276 Bacteria 5310396
383 2939623323 2939622612 Bacteria 4698046
384 2946001900 2945997725 Bacteria 6404843
385 2954018753 2954016120 Bacteria 6446024
386 2954019072 2954016120 Bacteria 6446024
387 2977235809 2977232053 Bacteria 5485925
388 8003157156 8003151029 Bacteria 8187759
389 Ga0495672_0047553
390 JGI24739J22299_10001144
391 JGI25154J39366_1000078
392 JGI25153J46596_10004809
393 rootH1_10038647
394 rootH2_10004814
395 rootH2_10055726
396 rootL2_10143320
397 rootH1_10086427
398 rootH1_10366573
399 JGI25160J50197_1002111
400 JGI25160J50197_1002797
401 JGI25160J50197_1008990
402 Ga0055526_1019603
403 Ga0055528_1003716
404 Ga0055530_10005011
405 Ga0065165_1000333
406 Ga0065165_1001407
407 Ga0065165_1023839
408 Ga0065714_10010088
409 Ga0065714_10064459
410 Ga0070676_10001440
411 Ga0070676_10007742
412 Ga0070670_100063328
413 Ga0070670_100110579
414 Ga0070670_100165655
415 Ga0070677_10045321
416 Ga0068869_100035056
417 Ga0068869_100079513
418 Ga0070666_10000072
419 Ga0070666_10007252
420 Ga0070666_10020400
421 Ga0070666_10139013
422 Ga0068868_100021866
423 Ga0068868_100047483
424 Ga0068868_100048754
425 Ga0068868_100152246
426 Ga0070661_100104474
427 Ga0070668_100146171
428 Ga0070669_100012772
429 Ga0070675_100017150
430 Ga0070675_100045260
431 Ga0070671_100017180
432 Ga0070671_100024497
433 Ga0070674_100047872
434 Ga0070674_100078741
435 Ga0070673_100012764
436 Ga0070673_100045071
437 Ga0070673_100073801
438 Ga0070667_100006188
439 Ga0070667_100014577
440 Ga0070667_100060170
441 Ga0070678_100007159
442 Ga0070678_100047159
443 Ga0070662_100000013
444 Ga0070662_100103105
445 Ga0068867_100003509
446 Ga0070698_100039590
447 Ga0070684_100061617
448 Ga0068853_100030965
449 Ga0068853_100053384
450 Ga0070672_100004660
451 Ga0070672_100051257
452 Ga0070672_100093608
453 Ga0070672_100099610
454 Ga0070665_100000010
455 Ga0070665_100000052
456 Ga0070665_100011887
457 Ga0070665_100088390
458 Ga0070704_100002073
459 Ga0068855_100006150
460 Ga0068855_100013413
461 Ga0068855_100047795
462 Ga0068855_100060168
463 Ga0070664_100037363
464 Ga0068857_100116503
465 Ga0068854_100017841
466 Ga0068852_100001694
467 Ga0068852_100002433
468 Ga0068852_100006679
469 Ga0068859_100000006
470 Ga0068859_100027257
471 Ga0068864_100008852
472 Ga0068864_100030220
473 Ga0068866_10019966
474 Ga0068866_10026258
475 Ga0068861_100005802
476 Ga0068870_10010474
477 Ga0068870_10020608
478 Ga0068863_100006997
479 Ga0068863_100022248
480 Ga0068860_100000004
481 Ga0068860_100001096
482 Ga0068860_100002117
483 Ga0068860_100002430
484 Ga0068862_100139709
485 Ga0075366_10001148
486 Ga0097621_100000146
487 Ga0097621_100000639
488 Ga0097621_100015728
489 Ga0068871_100000477
490 Ga0068871_100002101
491 Ga0068871_100004512
492 Ga0068871_100016612
493 Ga0068871_100064633
494 Ga0068865_100000079
495 Ga0068865_100003508
496 Ga0097620_100000006
497 Ga0097620_100027257
498 Ga0105240_10002508
499 Ga0105240_10011523
500 Ga0105240_10014577
501 Ga0105240_10113108
502 Ga0105240_10156082
503 Ga0105240_10201246
504 Ga0105241_10000888
505 Ga0105241_10002798
506 Ga0105241_10003043
507 Ga0105241_10195856
508 Ga0105242_10012932
509 Ga0105248_10037014
510 Ga0105237_10000157
511 Ga0105237_10000683
512 Ga0105237_10000886
513 Ga0105237_10001875
514 Ga0105237_10003344
515 Ga0105237_10011599
516 Ga0105237_10025060
517 Ga0105237_10056463
518 Ga0105238_10000980
519 Ga0105238_10001237
520 Ga0105238_10002843
521 Ga0105249_10005209
522 Ga0105249_10023107
523 Ga0105249_10055256
524 Ga0105239_10000029
525 Ga0105239_10004206
526 Ga0105239_10009224
527 Ga0105239_10042568
528 Ga0105239_10050076
529 Ga0105246_10007350
530 Ga0105246_10024473
531 Ga0105246_10028746
532 Ga0105246_10039992
533 Ga0157371_10000016
534 Ga0157371_10004224
535 Ga0157371_10004404
536 Ga0157370_10019477
537 Ga0157370_10178882
538 Ga0157369_10000008
539 Ga0157369_10026797
540 Ga0157369_10217798
541 Ga0157374_10000001
542 Ga0157374_10000258
543 Ga0157374_10001763
544 Ga0157374_10014360
545 Ga0157374_10169566
546 Ga0157378_10003682
547 Ga0157378_10083361
548 Ga0157378_10212656
549 Ga0163162_10000005
550 Ga0163162_10000528
551 Ga0163162_10002184
552 Ga0163162_10016486
553 Ga0163162_10325931
554 Ga0157372_10000305
555 Ga0157372_10013020
556 Ga0157372_10058774
557 Ga0157372_10101679
558 Ga0157372_10117096
559 Ga0157375_10000207
560 Ga0157375_10035206
561 Ga0157375_10104158
562 Ga0163163_10000553
563 Ga0163163_10064759
564 Ga0163163_10078327
565 Ga0163163_10143652
566 Ga0182008_10000391
567 Ga0157377_10013129
568 Ga0157379_10028678
569 Ga0157379_10040875
570 Ga0157376_10000555
571 Ga0157376_10001344
572 Ga0157376_10084534
573 Ga0182006_1000146
574 Ga0182006_1001004
575 Ga0182007_10000003
576 Ga0183373_1001
577 Ga0163161_10001075
578 Ga0163161_10001303
579 Ga0163161_10002039
580 Ga0163161_10003175
581 Ga0163161_10060206
582 Ga0163161_10123655
583 Ga0163161_10226468
584 Ga0213872_10003022
585 Ga0213876_10021968
586 Ga0213876_10037242
587 Ga0209646_1000004
588 Ga0209026_1000136
589 Ga0209026_1000842
590 Ga0209673_1000519
591 Ga0209025_1000005
592 Ga0209564_1003135
593 Ga0209564_1005021
594 Ga0209758_1002710
595 Ga0209758_1009141
596 Ga0209758_1010338
597 Ga0209050_1000276
598 Ga0207426_1000032
599 Ga0207426_1000089
600 Ga0207426_1000367
601 Ga0207426_1001395
602 Ga0209257_1000931
603 Ga0207682_10014039
604 Ga0207682_10014550
605 Ga0207680_10000024
606 Ga0207680_10078657
607 Ga0207647_10000044
608 Ga0207645_10000219
609 Ga0207645_10000558
610 Ga0207643_10025264
611 Ga0207654_10001733
612 Ga0207654_10001873
613 Ga0207654_10050827
614 Ga0207695_10001521
615 Ga0207695_10014747
616 Ga0207695_10077767
617 Ga0207671_10000450
618 Ga0207671_10002380
619 Ga0207671_10002525
620 Ga0207671_10005345
621 Ga0207671_10006651
622 Ga0207671_10015022
623 Ga0207671_10057245
624 Ga0207681_10102020
625 Ga0207694_10002932
626 Ga0207694_10020187
627 Ga0207694_10030683
628 Ga0207694_10035316
629 Ga0207650_10015363
630 Ga0207650_10023987
631 Ga0207650_10142350
632 Ga0207659_10040039
633 Ga0207687_10043871
634 Ga0207644_10006227
635 Ga0207706_10000173
636 Ga0207706_10031779
637 Ga0207706_10089187
638 Ga0207669_10102922
639 Ga0207704_10000019
640 Ga0207691_10014563
641 Ga0207691_10019389
642 Ga0207689_10001199
643 Ga0207689_10001505
644 Ga0207689_10026945
645 Ga0207689_10066632
646 Ga0207667_10000968
647 Ga0207667_10007266
648 Ga0207667_10016309
649 Ga0207667_10244504
650 Ga0207712_10069522
651 Ga0207668_10043026
652 Ga0207668_10093180
653 Ga0207658_10008008
654 Ga0207658_10043905
655 Ga0207677_10017494
656 Ga0207677_10044355
657 Ga0207677_10086033
658 Ga0207677_10087160
659 Ga0207639_10004313
660 Ga0207641_10000058
661 Ga0207641_10020384
662 Ga0207641_10218483
663 Ga0207648_10002523
664 Ga0207648_10002973
665 Ga0207674_10000629
666 Ga0207675_100006970
667 Ga0207675_100026719
668 Ga0207683_10000730
669 Ga0207698_10001840
670 Ga0207698_10004648
671 Ga0207698_10042478
672 Ga0268266_10000032
673 Ga0268266_10000070
674 Ga0268266_10102248
675 Ga0268265_10127216
676 Ga0268265_10162706
677 Ga0268264_10000011
678 Ga0268264_10002040
679 Ga0268264_10002921
680 Ga0268264_10003791
681 Ga0307517_10000640
682 Ga0307515_10000059
683 Ga0307515_10004635
684 Ga0307515_10026520
685 Ga0307515_10034128
686 Ga0307515_10052539
687 Ga0307511_10001201
688 Ga0265327_10000168
689 Ga0265327_10024826
690 Ga0307509_10012028
691 Ga0307509_10096204
692 Ga0307516_10031082
693 Ga0307405_10000032
694 Ga0307407_10000151
695 Ga0307416_100000009
696 Ga0307414_10002186
697 Ga0307414_10032338
698 Ga0307414_10099782
699 Ga0307507_10000010
700 Ga0307510_10000062
701 Ga0307510_10004416
702 Ga0395899_0000563
703 Ga0395900_0000173
704 Ga0395898_0018685
705 Ga0395905_0000641
706 Ga0395901_0000294
707 Ga0436365_0935453
708 Ga0436361_0123021
709 Ga0466972_0000001
710 Ga0466972_0024963
711 Ga0466968_0064866
712 Ga0466970_0000065
713 Ga0466970_0001560
714 Ga0495627_038802
715 Ga0495638_0011610
716 Ga0495585_0006676
717 Ga0495606_0003716
718 Ga0495606_0029107
719 Ga0495610_0000150
720 Ga0495610_0000519
721 Ga0495616_0007790
722 Ga0495631_0007677
723 Ga0495637_0026159
724 Ga0495648_0005100
725 Ga0495648_0070368
726 Ga0495648_0078157
727 Ga0495609_0013557
728 Ga0495633_0000322
729 Ga0495668_0000044
730 Ga0495611_0001630
731 Ga0495625_0001984
732 Ga0495625_0003910
733 Ga0495625_0051693
734 Ga0495625_0154709
735 Ga0495661_0003287
736 Ga0495661_0037652
737 Ga0495658_0105319
738 Ga0495649_0027183
739 Ga0495600_0134920
740 Ga0495687_000006
741 Ga0495687_002515
742 Ga0495686_0000078
743 Ga0495614_0004553
744 Ga0496117_0002637
745 Ga0496118_0006062
746 Ga0496124_0058418
747 Ga0496125_0026821
748 Ga0501076_0071776
749 nmdc:mga0k408_116_c3
750 Ga0500647_0058781
751 Ga0500583_0001914
752 Ga0500608_000346
753 Ga0500608_001862
754 Ga0500622_0001084
755 Ga0500624_000800
756 Ga0500637_0045894
757 2578460243
758 2738855713
759 2739590627
760 2819546561
761 2819550015
762 2819586017
763 2842724928
764 2842725258
765 2842912530
766 2842913051
767 2849284595
768 2849286257
769 2904446708
770 2904449384
771 2939623323
772 2946001900
773 2954018753
774 2954019072
775 2977235809
776 8003157156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19289

PmbA_TldD_3rd

PmbA/TldA metallopeptidase C-terminal domain

214

431

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vl4-assembly1.cif.gz_B crystal structure of a putative modulator of a dna gyrase (tm0727) from thermotoga maritima msb8 at 1.95 a resolution 0.877 9 438
6j6a-assembly1.cif.gz_B crystal structure of tlde from thermococcus kodakarensis 0.8746 9 439
1vl4-assembly1.cif.gz_B crystal structure of a putative modulator of a dna gyrase (tm0727) from thermotoga maritima msb8 at 1.95 a resolution 0.8732 9 438
3qtd-assembly2.cif.gz_B crystal structure of putative modulator of gyrase (pmba) from pseudomonas aeruginosa pao1 0.8638 6 439
3tv9-assembly1.cif.gz_A-2 crystal structure of putative peptide maturation protein from shigella flexneri 0.8549 6 434
ID Description Score Start End Superfamily
af_Q57684_3_193_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8798 13 207 3.30.2290.10
1vl4B01 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8583 4 211 3.30.2290.10
af_Q57684_3_193_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8582 13 207 3.30.2290.10
af_P71898_23_321_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8575 25 310 3.30.2290.10
1vl4B01 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8505 4 211 3.30.2290.10
ID Description Score Start End GO Terms
AF-A0A4Q3DBT1-F1-model_v4 TldD/PmbA family protein 0.9945 1 212 GO:0006508
GO:0008237
AF-A0A4Q3DBT1-F1-model_v4 TldD/PmbA family protein 0.9899 1 212 GO:0006508
GO:0008237
AF-A0A7Y4VI98-F1-model_v4 TldD/PmbA family protein 0.9852 3 349 GO:0006508
GO:0008237
AF-A0A0S8A8Y1-F1-model_v4 Peptidase C69 0.9827 2 443 GO:0006508
GO:0008237
AF-A0A5E6MGA2-F1-model_v4 PmbA protein 0.9806 3 443 GO:0006508
GO:0008237

Map