F433866

General Info

Members Datasets Scaffolds Average Seq Length
397 197 374 341

Family's Representative Sequence

Representative Sequence 3300047446|Ga0495679_005406|Ga0495679_005406_4004_5119
Length 371
Sequence MTDGFLNNMNARNKMRLAQKTMLVLRGLLLPLAVLGTPSYAANPIVPGWYADPEIRIFKGEYWIYPTYSDDFGKPDRSTSFTAEQQRQRAQSKLIWEPYLKQTFLNAFSSPDLVHWTKHDHVLDVENVAWAAYAVWAPSAIEHKGKYYLFFGANDIKGNGQPGGIGVAVSERPEGPFKDAIGKPLVGEIRNGAQPIDQMVFKDDDGQMYMYYGGWKHANVVKLAPDLLSLVPFPDGETFKEITPDPAYVEGSFMAKRKGKYYLMWSEGGWTGPDYRVAYAMGTSPFGPFKRVGTILQQDGKIARGAGHHSVVNIPGTDDWYIVYHRRPLNDDNGHHRELAIEHMYFNEDGTIRPVRMSTEGVAPRRLGAGD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
8 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
9 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
10 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
11 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
12 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
13 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
14 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
15 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
16 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
17 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
18 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
19 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
20 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
21 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
22 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
126 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
170 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
184 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
187 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
195 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
196 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
197 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.46
Metatranscriptomes 0
Isolates 5.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.79
Nodule 0
Rhizoplane 1.26
Rhizosphere 84.13
Stem 0
Stem Tuber 0
Unclassified 8.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_778235 2162886007 Bacteria 1287
2 JGI24737J22298_10000550 3300001990 Bacteria 13126
3 JGI24737J22298_10002954 3300001990 Bacteria 6028
4 JGI24735J21928_10000007 3300002067 Bacteria 333510
5 JGI25162J39368_1000097 3300002737 Bacteria 96520
6 JGI25153J46596_10000011 3300003215 Bacteria 319992
7 rootH1_10018613 3300003316 Bacteria 14456
8 rootH2_10044912 3300003320 Bacteria 3842
9 rootH2_10053064 3300003320 Bacteria 11968
10 rootH2_10074909 3300003320 Bacteria 2900
11 rootH1_10048119 3300003323 Bacteria 5269
12 JGI25160J50197_1004108 3300003354 Bacteria 6343
13 Ga0055525_1000099 3300003759 Bacteria 136491
14 Ga0055542_1000226 3300003762 Bacteria 67157
15 Ga0055529_1000243 3300003763 Bacteria 67164
16 Ga0065165_1003334 3300005262 Bacteria 11452
17 Ga0065704_10072016 3300005289 Bacteria 9369
18 Ga0065704_10110786 3300005289 Bacteria 1973
19 Ga0070658_10000517 3300005327 Bacteria 33499
20 Ga0070661_100119937 3300005344 Bacteria 1969
21 Ga0070668_100074713 3300005347 Bacteria 2645
22 Ga0070675_100041467 3300005354 Bacteria 3760
23 Ga0070674_100023057 3300005356 Bacteria 4022
24 Ga0070659_100079091 3300005366 Bacteria 2624
25 Ga0070678_100000110 3300005456 Bacteria 32092
26 Ga0068867_100053699 3300005459 Bacteria 2976
27 Ga0068867_100198466 3300005459 Bacteria 1605
28 Ga0068853_100116854 3300005539 Bacteria 2375
29 Ga0068853_100235221 3300005539 Bacteria 1677
30 Ga0070672_100121817 3300005543 Bacteria 2136
31 Ga0070665_100000063 3300005548 Bacteria 218300
32 Ga0068855_100036513 3300005563 Bacteria 5848
33 Ga0068854_100001702 3300005578 Bacteria 13388
34 Ga0068854_100069255 3300005578 Bacteria 2575
35 Ga0068852_100000321 3300005616 Bacteria 32639
36 Ga0068864_100231724 3300005618 Bacteria 1708
37 Ga0068870_10057225 3300005840 Bacteria 2084
38 Ga0068860_100010556 3300005843 Bacteria 9126
39 Ga0075366_10000107 3300006195 Bacteria 33692
40 Ga0075366_10007709 3300006195 Bacteria 5962
41 Ga0105240_10000623 3300009093 Bacteria 65495
42 Ga0105240_10002005 3300009093 Bacteria 33578
43 Ga0105240_10002522 3300009093 Bacteria 29394
44 Ga0111539_10226583 3300009094 Bacteria 2177
45 Ga0105243_10000007 3300009148 Bacteria 445042
46 Ga0105243_10000236 3300009148 Bacteria 63301
47 Ga0105241_10001608 3300009174 Bacteria 17237
48 Ga0105241_10005848 3300009174 Bacteria 9078
49 Ga0105237_10000902 3300009545 Bacteria 39969
50 Ga0105237_10004303 3300009545 Bacteria 16508
51 Ga0105237_10007917 3300009545 Bacteria 11581
52 Ga0105237_10019933 3300009545 Bacteria 6923
53 Ga0105237_10043799 3300009545 Bacteria 4507
54 Ga0105237_10050900 3300009545 Bacteria 4162
55 Ga0105237_10425050 3300009545 Bacteria 1334
56 Ga0105237_10670940 3300009545 Bacteria 1043
57 Ga0105238_10075741 3300009551 Bacteria 3356
58 Ga0105238_10142651 3300009551 Bacteria 2372
59 Ga0105238_10306878 3300009551 Bacteria 1571
60 Ga0105239_10001148 3300010375 Bacteria 36457
61 Ga0105239_10003569 3300010375 Bacteria 19023
62 Ga0105239_10004630 3300010375 Bacteria 16346
63 Ga0105239_10058955 3300010375 Bacteria 4214
64 Ga0105239_10263184 3300010375 Bacteria 1938
65 Ga0105239_10447975 3300010375 Bacteria 1464
66 Ga0105246_10064869 3300011119 Bacteria 2552
67 Ga0157373_10020709 3300013100 Bacteria 4776
68 Ga0157373_10206423 3300013100 Bacteria 1385
69 Ga0157371_10000114 3300013102 Bacteria 122406
70 Ga0157371_10001005 3300013102 Bacteria 31122
71 Ga0157371_10119645 3300013102 Bacteria 1872
72 Ga0157370_10000648 3300013104 Bacteria 43385
73 Ga0157370_10001850 3300013104 Bacteria 26088
74 Ga0157370_10017016 3300013104 Bacteria 7346
75 Ga0157369_10101342 3300013105 Bacteria 3068
76 Ga0163162_10000223 3300013306 Bacteria 51991
77 Ga0163162_10063498 3300013306 Bacteria 3736
78 Ga0157372_10006333 3300013307 Bacteria 12591
79 Ga0157372_10059053 3300013307 Bacteria 4289
80 Ga0157372_10233139 3300013307 Bacteria 2134
81 Ga0157372_10362122 3300013307 Bacteria 1690
82 Ga0182008_10002168 3300014497 Bacteria 12493
83 Ga0182006_1000792 3300015261 Bacteria 21253
84 Ga0163161_10004368 3300017792 Bacteria 9855
85 Ga0163161_10007749 3300017792 Bacteria 7428
86 Ga0209674_105281 3300025226 Bacteria 1939
87 Ga0209563_100081 3300025230 Bacteria 199455
88 Ga0209437_100030 3300025233 Bacteria 532466
89 Ga0209026_1014315 3300025250 Bacteria 1328
90 Ga0209148_1000008 3300025254 Bacteria 1504371
91 Ga0209455_1000002 3300025272 Bacteria 1505459
92 Ga0209758_1000007 3300025297 Bacteria 1270410
93 Ga0207426_1000002 3300025302 Bacteria 1249660
94 Ga0207647_10038913 3300025904 Bacteria 3004
95 Ga0207643_10147959 3300025908 Bacteria 1406
96 Ga0207705_10000229 3300025909 Bacteria 55757
97 Ga0207654_10002361 3300025911 Bacteria 9675
98 Ga0207654_10088927 3300025911 Bacteria 1878
99 Ga0207654_10117828 3300025911 Bacteria 1662
100 Ga0207695_10000197 3300025913 Bacteria 168837
101 Ga0207695_10000993 3300025913 Bacteria 50217
102 Ga0207695_10005021 3300025913 Bacteria 17768
103 Ga0207671_10002851 3300025914 Bacteria 17936
104 Ga0207671_10003362 3300025914 Bacteria 16046
105 Ga0207671_10006318 3300025914 Bacteria 10576
106 Ga0207671_10009608 3300025914 Bacteria 8063
107 Ga0207671_10032410 3300025914 Unclassified 3890
108 Ga0207671_10075230 3300025914 Bacteria 2525
109 Ga0207694_10089271 3300025924 Bacteria 2431
110 Ga0207694_10133825 3300025924 Bacteria 1989
111 Ga0207694_10296997 3300025924 Bacteria 1329
112 Ga0207659_10027975 3300025926 Bacteria 3825
113 Ga0207659_10132296 3300025926 Bacteria 1927
114 Ga0207690_10000890 3300025932 Bacteria 19076
115 Ga0207709_10000033 3300025935 Bacteria 320483
116 Ga0207709_10000065 3300025935 Bacteria 189826
117 Ga0207669_10000696 3300025937 Bacteria 14490
118 Ga0207691_10008921 3300025940 Bacteria 9628
119 Ga0207667_10000001 3300025949 Bacteria 1178522
120 Ga0207667_10006196 3300025949 Bacteria 14521
121 Ga0207667_10204561 3300025949 Bacteria 2025
122 Ga0207712_10144360 3300025961 Unclassified 1830
123 Ga0207640_10001843 3300025981 Bacteria 11365
124 Ga0207639_10021759 3300026041 Bacteria 4609
125 Ga0207639_10044383 3300026041 Bacteria 3343
126 Ga0207702_10297243 3300026078 Bacteria 1531
127 Ga0207648_10072763 3300026089 Bacteria 2996
128 Ga0207648_10119023 3300026089 Bacteria 2321
129 Ga0207676_10216725 3300026095 Bacteria 1702
130 Ga0207674_10009101 3300026116 Bacteria 11396
131 Ga0207674_10024344 3300026116 Bacteria 6472
132 Ga0207683_10001008 3300026121 Bacteria 25712
133 Ga0268266_10000057 3300028379 Bacteria 284777
134 Ga0268264_10000098 3300028381 Bacteria 229055
135 Ga0307517_10011803 3300028786 Bacteria 12077
136 Ga0307517_10034292 3300028786 Bacteria 5785
137 Ga0307515_10000081 3300028794 Bacteria 224753
138 Ga0265327_10000642 3300031251 Bacteria 56704
139 Ga0307513_10022849 3300031456 Bacteria 7336
140 Ga0307410_10000092 3300031852 Bacteria 30603
141 Ga0307406_10000003 3300031901 Bacteria 251998
142 Ga0307407_10066469 3300031903 Bacteria 2126
143 Ga0307412_10003311 3300031911 Bacteria 8948
144 Ga0307412_10055161 3300031911 Bacteria 2642
145 Ga0307414_10000001 3300032004 Bacteria 1352954
146 Ga0307411_10254737 3300032005 Bacteria 1382
147 Ga0307411_10339103 3300032005 Bacteria 1221
148 Ga0307507_10000111 3300033179 Bacteria 134722
149 Ga0307510_10021023 3300033180 Bacteria 7612
150 Ga0395899_0020088 3300037312 Bacteria 5068
151 Ga0395905_0051630 3300037471 Bacteria 3852
152 Ga0439466_0014039 3300041411 Bacteria 2923
153 Ga0439431_0020762 3300041997 Bacteria 1572
154 Ga0439449_0023824 3300042007 Bacteria 2289
155 Ga0439434_0002978 3300042435 Bacteria 4954
156 Ga0466972_0015909 3300044658 Bacteria 3761
157 Ga0466968_0121688 3300044735 Bacteria 1181
158 Ga0466958_0019560 3300045836 Bacteria 3943
159 Ga0495617_000008 3300046452 Bacteria 340369
160 Ga0495627_000875 3300046453 Bacteria 21309
161 Ga0495627_005133 3300046453 Bacteria 5342
162 Ga0495627_005900 3300046453 Bacteria 4868
163 Ga0495590_0000017 3300046457 Bacteria 216944
164 Ga0495590_0000351 3300046457 Bacteria 23818
165 Ga0495591_000422 3300046458 Bacteria 35248
166 Ga0495638_0006752 3300046460 Bacteria 8311
167 Ga0495650_0000147 3300046471 Bacteria 160862
168 Ga0495650_0000268 3300046471 Bacteria 99891
169 Ga0495650_0065856 3300046471 Bacteria 1436
170 Ga0495605_0000083 3300046474 Bacteria 124953
171 Ga0495605_0021517 3300046474 Bacteria 3415
172 Ga0495605_0048261 3300046474 Bacteria 2085
173 Ga0495639_0064449 3300046475 Bacteria 1684
174 Ga0495584_0000705 3300046491 Bacteria 22028
175 Ga0495585_0000698 3300046492 Bacteria 30500
176 Ga0495585_0001887 3300046492 Bacteria 15805
177 Ga0495585_0002184 3300046492 Bacteria 14202
178 Ga0495585_0002269 3300046492 Bacteria 13886
179 Ga0495585_0006993 3300046492 Bacteria 6945
180 Ga0495585_0030813 3300046492 Bacteria 3049
181 Ga0495585_0076598 3300046492 Bacteria 1816
182 Ga0495596_0003776 3300046500 Bacteria 7558
183 Ga0495596_0003828 3300046500 Bacteria 7487
184 Ga0495596_0007336 3300046500 Bacteria 4981
185 Ga0495596_0018383 3300046500 Bacteria 2881
186 Ga0495607_0002851 3300046501 Bacteria 13697
187 Ga0495607_0003020 3300046501 Bacteria 13134
188 Ga0495607_0007739 3300046501 Bacteria 7400
189 Ga0495607_0029322 3300046501 Bacteria 3386
190 Ga0495607_0061537 3300046501 Bacteria 2132
191 Ga0495583_0002165 3300046506 Bacteria 17538
192 Ga0495583_0006440 3300046506 Bacteria 7677
193 Ga0495583_0009396 3300046506 Bacteria 5846
194 Ga0495583_0021723 3300046506 Bacteria 3294
195 Ga0495583_0043390 3300046506 Bacteria 2094
196 Ga0495583_0067654 3300046506 Bacteria 1577
197 Ga0495606_0000273 3300046507 Bacteria 90641
198 Ga0495606_0000531 3300046507 Bacteria 61676
199 Ga0495606_0013357 3300046507 Bacteria 6493
200 Ga0495606_0019315 3300046507 Bacteria 5076
201 Ga0495606_0023538 3300046507 Bacteria 4458
202 Ga0495606_0024311 3300046507 Bacteria 4369
203 Ga0495606_0081934 3300046507 Bacteria 2005
204 Ga0495606_0109487 3300046507 Bacteria 1668
205 Ga0495606_0126700 3300046507 Bacteria 1522
206 Ga0495610_0001291 3300046512 Bacteria 22303
207 Ga0495610_0002736 3300046512 Bacteria 14494
208 Ga0495616_0002188 3300046513 Bacteria 13073
209 Ga0495616_0016609 3300046513 Bacteria 4070
210 Ga0495616_0026539 3300046513 Bacteria 3081
211 Ga0495616_0026672 3300046513 Bacteria 3071
212 Ga0495616_0036731 3300046513 Bacteria 2527
213 Ga0495616_0076799 3300046513 Bacteria 1604
214 Ga0495631_0000987 3300046518 Bacteria 17648
215 Ga0495631_0013023 3300046518 Bacteria 4047
216 Ga0495631_0015331 3300046518 Bacteria 3674
217 Ga0495631_0022514 3300046518 Bacteria 2929
218 Ga0495632_0000065 3300046519 Bacteria 116086
219 Ga0495632_0001943 3300046519 Bacteria 16506
220 Ga0495632_0007490 3300046519 Bacteria 6848
221 Ga0495637_0000026 3300046520 Bacteria 158526
222 Ga0495637_0015978 3300046520 Bacteria 3515
223 Ga0495637_0060537 3300046520 Bacteria 1554
224 Ga0495643_0000781 3300046522 Bacteria 35415
225 Ga0495643_0001715 3300046522 Bacteria 18991
226 Ga0495643_0049900 3300046522 Bacteria 2255
227 Ga0495643_0052707 3300046522 Bacteria 2183
228 Ga0495644_0010063 3300046523 Bacteria 3644
229 Ga0495644_0015305 3300046523 Bacteria 2937
230 Ga0495644_0017013 3300046523 Bacteria 2782
231 Ga0495644_0017736 3300046523 Bacteria 2720
232 Ga0495648_0000807 3300046524 Bacteria 33208
233 Ga0495648_0002247 3300046524 Bacteria 18047
234 Ga0495648_0006513 3300046524 Bacteria 9517
235 Ga0495648_0011490 3300046524 Bacteria 6663
236 Ga0495648_0031286 3300046524 Bacteria 3506
237 Ga0495648_0058502 3300046524 Bacteria 2305
238 Ga0495648_0066239 3300046524 Bacteria 2118
239 Ga0495648_0066290 3300046524 Bacteria 2117
240 Ga0495648_0083563 3300046524 Bacteria 1808
241 Ga0495642_0000666 3300046528 Bacteria 17171
242 Ga0495642_0016136 3300046528 Bacteria 2909
243 Ga0495642_0034951 3300046528 Bacteria 2026
244 Ga0495642_0050913 3300046528 Bacteria 1703
245 Ga0495652_0123065 3300046529 Bacteria 2065
246 Ga0495654_0006901 3300046530 Bacteria 6403
247 Ga0495609_0000722 3300046538 Bacteria 25126
248 Ga0495609_0009731 3300046538 Bacteria 4637
249 Ga0495609_0012481 3300046538 Bacteria 4030
250 Ga0495609_0018367 3300046538 Bacteria 3239
251 Ga0495609_0030381 3300046538 Bacteria 2459
252 Ga0495609_0041608 3300046538 Bacteria 2065
253 Ga0495597_0000881 3300046542 Bacteria 23360
254 Ga0495597_0001302 3300046542 Bacteria 18321
255 Ga0495597_0012324 3300046542 Bacteria 4125
256 Ga0495597_0014857 3300046542 Bacteria 3701
257 Ga0495597_0127758 3300046542 Bacteria 1056
258 Ga0495633_0000042 3300046558 Bacteria 173748
259 Ga0495633_0000462 3300046558 Bacteria 41723
260 Ga0495633_0002047 3300046558 Bacteria 14543
261 Ga0495633_0003096 3300046558 Bacteria 11293
262 Ga0495668_0000011 3300046616 Bacteria 472186
263 Ga0495668_0000033 3300046616 Bacteria 254277
264 Ga0495668_0002470 3300046616 Bacteria 15205
265 Ga0495668_0004743 3300046616 Bacteria 9520
266 Ga0495668_0025053 3300046616 Bacteria 3391
267 Ga0495668_0076924 3300046616 Bacteria 1832
268 Ga0495611_0000096 3300046648 Bacteria 60765
269 Ga0495611_0004154 3300046648 Bacteria 6303
270 Ga0495611_0022084 3300046648 Bacteria 2752
271 Ga0495611_0032338 3300046648 Bacteria 2305
272 Ga0495625_0000007 3300046660 Bacteria 565749
273 Ga0495625_0000126 3300046660 Bacteria 119900
274 Ga0495625_0000239 3300046660 Bacteria 85876
275 Ga0495625_0031871 3300046660 Bacteria 3916
276 Ga0495625_0083667 3300046660 Bacteria 2217
277 Ga0495661_0001414 3300046665 Bacteria 20103
278 Ga0495661_0011780 3300046665 Bacteria 5923
279 Ga0495661_0016226 3300046665 Bacteria 4944
280 Ga0495661_0024920 3300046665 Bacteria 3871
281 Ga0495661_0025852 3300046665 Bacteria 3787
282 Ga0495661_0026909 3300046665 Bacteria 3698
283 Ga0495661_0028150 3300046665 Bacteria 3601
284 Ga0495588_0000139 3300046674 Bacteria 109955
285 Ga0495588_0013893 3300046674 Bacteria 3844
286 Ga0495623_0013663 3300046679 Bacteria 5263
287 Ga0495669_0003158 3300046684 Bacteria 6785
288 Ga0495669_0039558 3300046684 Bacteria 2088
289 Ga0495613_0115465 3300046689 Bacteria 1932
290 Ga0495670_0002838 3300046691 Bacteria 8565
291 Ga0495670_0007570 3300046691 Bacteria 5337
292 Ga0495670_0046773 3300046691 Bacteria 2162
293 Ga0495671_0001415 3300046692 Bacteria 16132
294 Ga0495671_0003874 3300046692 Bacteria 9095
295 Ga0495671_0006218 3300046692 Bacteria 6922
296 Ga0495671_0007902 3300046692 Bacteria 6015
297 Ga0495649_0000007 3300046694 Bacteria 518037
298 Ga0495649_0003054 3300046694 Bacteria 11469
299 Ga0495649_0040062 3300046694 Bacteria 2567
300 Ga0495589_0001110 3300046794 Bacteria 16053
301 Ga0495589_0002070 3300046794 Bacteria 11356
302 Ga0495589_0003016 3300046794 Bacteria 9256
303 Ga0495589_0006910 3300046794 Bacteria 5963
304 Ga0495589_0019224 3300046794 Bacteria 3504
305 Ga0495660_0006201 3300046810 Bacteria 7096
306 Ga0495660_0006724 3300046810 Bacteria 6790
307 Ga0495660_0017544 3300046810 Bacteria 4120
308 Ga0495660_0021845 3300046810 Bacteria 3660
309 Ga0495660_0039218 3300046810 Bacteria 2631
310 Ga0495660_0066668 3300046810 Bacteria 1919
311 Ga0495660_0090304 3300046810 Bacteria 1593
312 Ga0495672_0000195 3300047320 Bacteria 86608
313 Ga0495672_0000316 3300047320 Bacteria 64226
314 Ga0495672_0002048 3300047320 Bacteria 18938
315 Ga0495676_0113090 3300047321 Bacteria 1988
316 Ga0495683_0001600 3300047323 Bacteria 14579
317 Ga0495683_0021459 3300047323 Bacteria 3328
318 Ga0495687_000006 3300047443 Bacteria 571936
319 Ga0495687_000041 3300047443 Bacteria 229171
320 Ga0495687_000064 3300047443 Bacteria 163468
321 Ga0495677_0004860 3300047445 Bacteria 5124
322 Ga0495677_0021551 3300047445 Bacteria 2335
323 Ga0495677_0064382 3300047445 Bacteria 1362
324 Ga0495679_001737 3300047446 Bacteria 12015
325 Ga0495679_005406 3300047446 Bacteria 5663
326 Ga0495679_006696 3300047446 Bacteria 4920
327 Ga0495679_024398 3300047446 Bacteria 2038
328 Ga0495685_019036 3300047447 Bacteria 2357
329 Ga0495673_0021662 3300047469 Bacteria 3168
330 Ga0495681_0016738 3300047470 Bacteria 4096
331 Ga0495681_0044097 3300047470 Bacteria 2146
332 Ga0495681_0058783 3300047470 Bacteria 1780
333 Ga0495686_0000188 3300047472 Bacteria 115937
334 Ga0495686_0000402 3300047472 Bacteria 68501
335 Ga0495686_0004244 3300047472 Bacteria 11882
336 Ga0495686_0056698 3300047472 Bacteria 2447
337 Ga0495686_0063201 3300047472 Bacteria 2295
338 Ga0495626_0004460 3300048091 Bacteria 8583
339 Ga0495626_0007882 3300048091 Bacteria 5895
340 Ga0495626_0014143 3300048091 Bacteria 4128
341 Ga0495626_0021176 3300048091 Bacteria 3229
342 Ga0496102_0000645 3300048905 Bacteria 35369
343 Ga0496109_0029402 3300048912 Bacteria 4921
344 Ga0496113_0027201 3300048916 Bacteria 4097
345 Ga0496121_0019152 3300048924 Bacteria 6860
346 Ga0496122_0002012 3300048925 Bacteria 30229
347 Ga0496122_0003122 3300048925 Bacteria 22189
348 Ga0496122_0098185 3300048925 Bacteria 1968
349 Ga0496122_0110959 3300048925 Bacteria 1800
350 Ga0496123_0000122 3300048926 Bacteria 158966
351 Ga0496123_0004012 3300048926 Bacteria 15917
352 Ga0496123_0059848 3300048926 Bacteria 2459
353 Ga0496124_0009148 3300048927 Bacteria 10231
354 Ga0496124_0045402 3300048927 Bacteria 3766
355 Ga0496124_0054616 3300048927 Bacteria 3380
356 Ga0496125_0003227 3300048928 Bacteria 20112
357 Ga0496125_0063923 3300048928 Bacteria 2930
358 Ga0496125_0111071 3300048928 Bacteria 1985
359 Ga0495678_000315 3300049459 Bacteria 51749
360 Ga0495678_001277 3300049459 Bacteria 20425
361 Ga0495678_002374 3300049459 Bacteria 12907
362 Ga0495682_0010825 3300049460 Bacteria 3517
363 Ga0501047_0041051 3300049581 Bacteria 4472
364 Ga0501227_000832 3300049665 Bacteria 6723
365 Ga0501238_000218 3300049671 Bacteria 8234
366 Ga0501080_0467283 3300049742 Bacteria 1130
367 Ga0501280_000561 3300049776 Bacteria 8690
368 nmdc:mga0k408_229_c1 3300050493 Bacteria 30096
369 Ga0500643_001078 3300053087 Bacteria 16416
370 Ga0500642_0000354 3300053130 Bacteria 15462
371 Ga0500568_0004443 3300053139 Bacteria 7493
372 Ga0500622_0013424 3300053156 Bacteria 4419
373 Ga0500624_000949 3300053157 Bacteria 6001
374 Ga0500596_000291 3300053735 Bacteria 8857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0007570 Ga0495670_0007570_3787_4869 284
2 3300048905 Ga0496102_0000645 Ga0496102_0000645_10302_11357 284
3 3300049665 Ga0501227_000832 Ga0501227_000832_3635_4618 284
4 3300046452 Ga0495617_000008 Ga0495617_000008_106865_108001 286
5 3300046453 Ga0495627_000875 Ga0495627_000875_9285_10421 286
6 3300046474 Ga0495605_0000083 Ga0495605_0000083_33630_34766 286
7 3300046492 Ga0495585_0076598 Ga0495585_0076598_36_1172 286
8 3300046501 Ga0495607_0003020 Ga0495607_0003020_10637_11773 286
9 3300046513 Ga0495616_0076799 Ga0495616_0076799_129_1265 286
10 3300046518 Ga0495631_0013023 Ga0495631_0013023_952_2088 286
11 3300046523 Ga0495644_0017013 Ga0495644_0017013_530_1666 286
12 3300046524 Ga0495648_0002247 Ga0495648_0002247_7847_8983 286
13 3300046528 Ga0495642_0000666 Ga0495642_0000666_6503_7639 286
14 3300046538 Ga0495609_0009731 Ga0495609_0009731_3346_4482 286
15 3300046616 Ga0495668_0002470 Ga0495668_0002470_6938_8074 286
16 3300046665 Ga0495661_0026909 Ga0495661_0026909_1234_2370 286
17 3300046692 Ga0495671_0001415 Ga0495671_0001415_14218_15354 286
18 3300046794 Ga0495589_0003016 Ga0495589_0003016_1234_2370 286
19 3300046810 Ga0495660_0021845 Ga0495660_0021845_2266_3303 286
20 3300047445 Ga0495677_0004860 Ga0495677_0004860_946_2082 286
21 3300046542 Ga0495597_0001302 Ga0495597_0001302_16058_17125 294
22 3300046794 Ga0495589_0001110 Ga0495589_0001110_4465_5532 294
23 3300013104 Ga0157370_10000648 Ga0157370_100006482 295
24 3300014497 Ga0182008_10002168 Ga0182008_100021685 295
25 3300015261 Ga0182006_1000792 Ga0182006_100079210 295
26 3300017792 Ga0163161_10007749 Ga0163161_100077492 295
27 3300048925 Ga0496122_0002012 Ga0496122_0002012_12674_13609 295
28 3300048926 Ga0496123_0004012 Ga0496123_0004012_14165_15100 295
29 3300048928 Ga0496125_0111071 Ga0496125_0111071_188_1123 295
30 iso_pu_bacteria 2738541283 2738754761 295
31 3300046457 Ga0495590_0000017 Ga0495590_0000017_126262_127332 296
32 3300046458 Ga0495591_000422 Ga0495591_000422_8281_9351 296
33 3300046491 Ga0495584_0000705 Ga0495584_0000705_8225_9289 296
34 3300046501 Ga0495607_0007739 Ga0495607_0007739_3826_4896 296
35 3300046506 Ga0495583_0002165 Ga0495583_0002165_8539_9609 296
36 3300046512 Ga0495610_0002736 Ga0495610_0002736_5632_6702 296
37 3300046519 Ga0495632_0007490 Ga0495632_0007490_1755_2819 296
38 3300046520 Ga0495637_0000026 Ga0495637_0000026_58410_59480 296
39 3300046528 Ga0495642_0050913 Ga0495642_0050913_53_1123 296
40 3300046558 Ga0495633_0003096 Ga0495633_0003096_5480_6550 296
41 3300046648 Ga0495611_0000096 Ga0495611_0000096_25128_26192 296
42 3300046694 Ga0495649_0003054 Ga0495649_0003054_9284_10348 296
43 3300046794 Ga0495589_0002070 Ga0495589_0002070_1751_2815 296
44 3300047320 Ga0495672_0002048 Ga0495672_0002048_8642_9712 296
45 3300047323 Ga0495683_0001600 Ga0495683_0001600_4868_5938 296
46 3300047472 Ga0495686_0056698 Ga0495686_0056698_930_2000 296
47 3300048924 Ga0496121_0019152 Ga0496121_0019152_3352_4323 296
48 3300049459 Ga0495678_001277 Ga0495678_001277_11929_12999 296
49 3300046692 Ga0495671_0006218 Ga0495671_0006218_2459_3523 297
50 3300001990 JGI24737J22298_10002954 JGI24737J22298_100029542 298
51 3300003215 JGI25153J46596_10000011 JGI25153J46596_10000011142 298
52 3300003320 rootH2_10044912 rootH2_100449122 298
53 3300003759 Ga0055525_1000099 Ga0055525_100009943 298
54 3300003762 Ga0055542_1000226 Ga0055542_10002263 298
55 3300003763 Ga0055529_1000243 Ga0055529_10002433 298
56 3300005327 Ga0070658_10000517 Ga0070658_1000051714 298
57 3300005344 Ga0070661_100119937 Ga0070661_1001199371 298
58 3300005356 Ga0070674_100023057 Ga0070674_1000230572 298
59 3300005366 Ga0070659_100079091 Ga0070659_1000790911 298
60 3300005456 Ga0070678_100000110 Ga0070678_10000011022 298
61 3300005459 Ga0068867_100198466 Ga0068867_1001984662 298
62 3300009148 Ga0105243_10000236 Ga0105243_1000023637 298
63 3300009545 Ga0105237_10425050 Ga0105237_104250501 298
64 3300009551 Ga0105238_10306878 Ga0105238_103068782 298
65 3300011119 Ga0105246_10064869 Ga0105246_100648693 298
66 3300013102 Ga0157371_10000114 Ga0157371_1000011412 298
67 3300025226 Ga0209674_105281 Ga0209674_1052812 298
68 3300025230 Ga0209563_100081 Ga0209563_10008183 298
69 3300025250 Ga0209026_1014315 Ga0209026_10143152 298
70 3300025254 Ga0209148_1000008 Ga0209148_10000081199 298
71 3300025272 Ga0209455_1000002 Ga0209455_1000002227 298
72 3300025297 Ga0209758_1000007 Ga0209758_1000007173 298
73 3300025904 Ga0207647_10038913 Ga0207647_100389132 298
74 3300025909 Ga0207705_10000229 Ga0207705_1000022916 298
75 3300025926 Ga0207659_10027975 Ga0207659_100279752 298
76 3300025932 Ga0207690_10000890 Ga0207690_100008902 298
77 3300025935 Ga0207709_10000065 Ga0207709_1000006583 298
78 3300025937 Ga0207669_10000696 Ga0207669_100006962 298
79 3300025949 Ga0207667_10000001 Ga0207667_10000001385 298
80 3300026041 Ga0207639_10044383 Ga0207639_100443832 298
81 3300026089 Ga0207648_10119023 Ga0207648_101190232 298
82 3300026121 Ga0207683_10001008 Ga0207683_1000100816 298
83 3300028786 Ga0307517_10011803 Ga0307517_100118032 298
84 3300028786 Ga0307517_10034292 Ga0307517_100342922 298
85 3300033180 Ga0307510_10021023 Ga0307510_100210232 298
86 3300037312 Ga0395899_0020088 Ga0395899_0020088_438_1511 298
87 3300037471 Ga0395905_0051630 Ga0395905_0051630_362_1435 298
88 3300046453 Ga0495627_005133 Ga0495627_005133_3859_4923 298
89 3300046475 Ga0495639_0064449 Ga0495639_0064449_247_1317 298
90 3300046492 Ga0495585_0002269 Ga0495585_0002269_6593_7651 298
91 3300046500 Ga0495596_0007336 Ga0495596_0007336_3361_4416 298
92 3300046506 Ga0495583_0067654 Ga0495583_0067654_186_1241 298
93 3300046507 Ga0495606_0000273 Ga0495606_0000273_56608_57663 298
94 3300046507 Ga0495606_0081934 Ga0495606_0081934_258_1319 298
95 3300046507 Ga0495606_0109487 Ga0495606_0109487_131_1186 298
96 3300046513 Ga0495616_0036731 Ga0495616_0036731_921_1976 298
97 3300046522 Ga0495643_0000781 Ga0495643_0000781_154_1209 298
98 3300046522 Ga0495643_0001715 Ga0495643_0001715_138_1208 298
99 3300046522 Ga0495643_0052707 Ga0495643_0052707_115_1170 298
100 3300046523 Ga0495644_0017736 Ga0495644_0017736_645_1706 298
101 3300046524 Ga0495648_0058502 Ga0495648_0058502_533_1603 298
102 3300046528 Ga0495642_0034951 Ga0495642_0034951_13_1074 298
103 3300046542 Ga0495597_0000881 Ga0495597_0000881_5280_6290 298
104 3300046558 Ga0495633_0000462 Ga0495633_0000462_7893_8951 298
105 3300046616 Ga0495668_0000033 Ga0495668_0000033_169274_170332 298
106 3300046660 Ga0495625_0000126 Ga0495625_0000126_62679_63752 298
107 3300046660 Ga0495625_0083667 Ga0495625_0083667_1017_2075 298
108 3300046665 Ga0495661_0016226 Ga0495661_0016226_1309_2373 298
109 3300046689 Ga0495613_0115465 Ga0495613_0115465_16_1086 298
110 3300046691 Ga0495670_0046773 Ga0495670_0046773_493_1551 298
111 3300046810 Ga0495660_0039218 Ga0495660_0039218_622_1680 298
112 3300046810 Ga0495660_0090304 Ga0495660_0090304_473_1531 298
113 3300047443 Ga0495687_000041 Ga0495687_000041_93826_94896 298
114 3300047445 Ga0495677_0021551 Ga0495677_0021551_52_1122 298
115 3300047445 Ga0495677_0064382 Ga0495677_0064382_122_1186 298
116 3300047470 Ga0495681_0016738 Ga0495681_0016738_1169_2233 298
117 3300047470 Ga0495681_0044097 Ga0495681_0044097_106_1164 298
118 3300048928 Ga0496125_0063923 Ga0496125_0063923_20_1036 298
119 3300049581 Ga0501047_0041051 Ga0501047_0041051_2830_3897 298
120 3300053087 Ga0500643_001078 Ga0500643_001078_4837_5901 298
121 3300053130 Ga0500642_0000354 Ga0500642_0000354_8685_9743 298
122 3300053735 Ga0500596_000291 Ga0500596_000291_1454_2524 298
123 iso_pu_bacteria 2599185359 2600226763 298
124 iso_pu_bacteria 2775506987 2776612849 298
125 iso_pu_bacteria 2818991466 2819715790 298
126 iso_pu_bacteria 2904555929 2904560009 298
127 iso_pu_bacteria 2928526807 2928529804 298
128 iso_pu_bacteria 2928968154 2928970699 298
129 3300003354 JGI25160J50197_1004108 JGI25160J50197_10041088 299
130 3300005289 Ga0065704_10110786 Ga0065704_101107861 299
131 3300005347 Ga0070668_100074713 Ga0070668_1000747132 299
132 3300005354 Ga0070675_100041467 Ga0070675_1000414672 299
133 3300005459 Ga0068867_100053699 Ga0068867_1000536992 299
134 3300005539 Ga0068853_100116854 Ga0068853_1001168543 299
135 3300005543 Ga0070672_100121817 Ga0070672_1001218172 299
136 3300005840 Ga0068870_10057225 Ga0068870_100572252 299
137 3300009094 Ga0111539_10226583 Ga0111539_102265831 299
138 3300009545 Ga0105237_10670940 Ga0105237_106709401 299
139 3300013307 Ga0157372_10362122 Ga0157372_103621222 299
140 3300025302 Ga0207426_1000002 Ga0207426_100000246 299
141 3300025908 Ga0207643_10147959 Ga0207643_101479592 299
142 3300025911 Ga0207654_10002361 Ga0207654_100023615 299
143 3300025914 Ga0207671_10032410 Ga0207671_100324104 299
144 3300025924 Ga0207694_10089271 Ga0207694_100892712 299
145 3300025926 Ga0207659_10132296 Ga0207659_101322962 299
146 3300025940 Ga0207691_10008921 Ga0207691_100089213 299
147 3300026089 Ga0207648_10072763 Ga0207648_100727632 299
148 3300031251 Ga0265327_10000642 Ga0265327_1000064236 299
149 3300031456 Ga0307513_10022849 Ga0307513_100228492 299
150 3300031852 Ga0307410_10000092 Ga0307410_100000925 299
151 3300031901 Ga0307406_10000003 Ga0307406_1000000350 299
152 3300031903 Ga0307407_10066469 Ga0307407_100664692 299
153 3300032004 Ga0307414_10000001 Ga0307414_100000011038 299
154 3300032005 Ga0307411_10254737 Ga0307411_102547371 299
155 3300041411 Ga0439466_0014039 Ga0439466_0014039_1149_2129 299
156 3300041997 Ga0439431_0020762 Ga0439431_0020762_408_1394 299
157 3300042007 Ga0439449_0023824 Ga0439449_0023824_1014_2000 299
158 3300042435 Ga0439434_0002978 Ga0439434_0002978_3779_4765 299
159 3300045836 Ga0466958_0019560 Ga0466958_0019560_639_1694 299
160 3300046457 Ga0495590_0000351 Ga0495590_0000351_15179_16213 299
161 3300046474 Ga0495605_0021517 Ga0495605_0021517_487_1527 299
162 3300046492 Ga0495585_0006993 Ga0495585_0006993_395_1450 299
163 3300046492 Ga0495585_0030813 Ga0495585_0030813_409_1449 299
164 3300046500 Ga0495596_0003828 Ga0495596_0003828_5526_6587 299
165 3300046501 Ga0495607_0002851 Ga0495607_0002851_2571_3611 299
166 3300046506 Ga0495583_0006440 Ga0495583_0006440_164_1225 299
167 3300046506 Ga0495583_0021723 Ga0495583_0021723_1796_2836 299
168 3300046507 Ga0495606_0023538 Ga0495606_0023538_3137_4177 299
169 3300046513 Ga0495616_0026539 Ga0495616_0026539_1373_2413 299
170 3300046513 Ga0495616_0026672 Ga0495616_0026672_1365_2426 299
171 3300046518 Ga0495631_0022514 Ga0495631_0022514_998_2038 299
172 3300046523 Ga0495644_0015305 Ga0495644_0015305_669_1709 299
173 3300046524 Ga0495648_0011490 Ga0495648_0011490_1398_2432 299
174 3300046524 Ga0495648_0066239 Ga0495648_0066239_894_1934 299
175 3300046524 Ga0495648_0066290 Ga0495648_0066290_601_1662 299
176 3300046528 Ga0495642_0016136 Ga0495642_0016136_1407_2447 299
177 3300046538 Ga0495609_0018367 Ga0495609_0018367_1020_2060 299
178 3300046542 Ga0495597_0012324 Ga0495597_0012324_644_1705 299
179 3300046542 Ga0495597_0127758 Ga0495597_0127758_29_964 299
180 3300046616 Ga0495668_0025053 Ga0495668_0025053_964_2004 299
181 3300046616 Ga0495668_0076924 Ga0495668_0076924_189_1238 299
182 3300046648 Ga0495611_0022084 Ga0495611_0022084_693_1733 299
183 3300046648 Ga0495611_0032338 Ga0495611_0032338_502_1539 299
184 3300046665 Ga0495661_0028150 Ga0495661_0028150_296_1285 299
185 3300046674 Ga0495588_0000139 Ga0495588_0000139_61694_62740 299
186 3300046674 Ga0495588_0013893 Ga0495588_0013893_2306_3343 299
187 3300046679 Ga0495623_0013663 Ga0495623_0013663_1416_2480 299
188 3300046684 Ga0495669_0039558 Ga0495669_0039558_14_1075 299
189 3300046691 Ga0495670_0002838 Ga0495670_0002838_412_1452 299
190 3300046692 Ga0495671_0007902 Ga0495671_0007902_1242_2303 299
191 3300046694 Ga0495649_0040062 Ga0495649_0040062_739_1800 299
192 3300046794 Ga0495589_0019224 Ga0495589_0019224_1796_2836 299
193 3300046810 Ga0495660_0006201 Ga0495660_0006201_4597_5637 299
194 3300046810 Ga0495660_0017544 Ga0495660_0017544_1851_2888 299
195 3300047320 Ga0495672_0000195 Ga0495672_0000195_61983_63050 299
196 3300047446 Ga0495679_006696 Ga0495679_006696_411_1451 299
197 3300047447 Ga0495685_019036 Ga0495685_019036_1115_2155 299
198 3300047469 Ga0495673_0021662 Ga0495673_0021662_895_1950 299
199 3300048091 Ga0495626_0007882 Ga0495626_0007882_1421_2461 299
200 3300048091 Ga0495626_0021176 Ga0495626_0021176_918_1952 299
201 3300049671 Ga0501238_000218 Ga0501238_000218_622_1560 299
202 3300049776 Ga0501280_000561 Ga0501280_000561_1199_2137 299
203 3300053157 Ga0500624_000949 Ga0500624_000949_2047_3012 299
204 iso_pu_bacteria 2599185184 2599479868 299
205 iso_pu_bacteria 2643221716 2644640118 299
206 iso_pu_bacteria 2808606418 2809144865 299
207 iso_pu_bacteria 2852623160 2852626496 299
208 iso_pu_bacteria 2857613821 2857614766 299
209 iso_pu_bacteria 2884933994 2884934922 299
210 iso_pu_bacteria 2896344016 2896344483 299
211 iso_pu_bacteria 2904419702 2904420084 299
212 iso_pu_bacteria 2904780799 2904784853 299
213 iso_pu_bacteria 2919177583 2919178068 299
214 iso_pu_bacteria 2919191525 2919193764 299
215 iso_pu_bacteria 2928078545 2928080997 299
216 iso_pu_bacteria 2928147474 2928152586 299
217 iso_pu_bacteria 2932082852 2932087363 299
218 iso_pu_bacteria 8056440228 8056443882 299
219 3300003320 rootH2_10053064 rootH2_1005306411 300
220 3300005548 Ga0070665_100000063 Ga0070665_100000063154 300
221 3300005563 Ga0068855_100036513 Ga0068855_1000365132 300
222 3300005578 Ga0068854_100001702 Ga0068854_1000017023 300
223 3300005616 Ga0068852_100000321 Ga0068852_10000032111 300
224 3300005618 Ga0068864_100231724 Ga0068864_1002317242 300
225 3300005843 Ga0068860_100010556 Ga0068860_1000105564 300
226 3300009093 Ga0105240_10002005 Ga0105240_1000200528 300
227 3300009093 Ga0105240_10002522 Ga0105240_1000252211 300
228 3300009545 Ga0105237_10000902 Ga0105237_1000090219 300
229 3300009545 Ga0105237_10007917 Ga0105237_100079176 300
230 3300009551 Ga0105238_10142651 Ga0105238_101426511 300
231 3300010375 Ga0105239_10001148 Ga0105239_1000114814 300
232 3300010375 Ga0105239_10263184 Ga0105239_102631842 300
233 3300010375 Ga0105239_10447975 Ga0105239_104479752 300
234 3300013100 Ga0157373_10206423 Ga0157373_102064232 300
235 3300013102 Ga0157371_10001005 Ga0157371_1000100521 300
236 3300013104 Ga0157370_10001850 Ga0157370_1000185013 300
237 3300013104 Ga0157370_10017016 Ga0157370_100170168 300
238 3300013105 Ga0157369_10101342 Ga0157369_101013422 300
239 3300013306 Ga0163162_10000223 Ga0163162_1000022345 300
240 3300013306 Ga0163162_10063498 Ga0163162_100634984 300
241 3300013307 Ga0157372_10059053 Ga0157372_100590533 300
242 3300025911 Ga0207654_10088927 Ga0207654_100889273 300
243 3300025911 Ga0207654_10117828 Ga0207654_101178282 300
244 3300025913 Ga0207695_10005021 Ga0207695_1000502111 300
245 3300025914 Ga0207671_10002851 Ga0207671_1000285110 300
246 3300025914 Ga0207671_10009608 Ga0207671_100096081 300
247 3300025924 Ga0207694_10296997 Ga0207694_102969972 300
248 3300025949 Ga0207667_10006196 Ga0207667_1000619612 300
249 3300025949 Ga0207667_10204561 Ga0207667_102045612 300
250 3300025961 Ga0207712_10144360 Ga0207712_101443603 300
251 3300025981 Ga0207640_10001843 Ga0207640_100018436 300
252 3300026078 Ga0207702_10297243 Ga0207702_102972432 300
253 3300026095 Ga0207676_10216725 Ga0207676_102167252 300
254 3300026116 Ga0207674_10009101 Ga0207674_100091019 300
255 3300026116 Ga0207674_10024344 Ga0207674_100243442 300
256 3300028379 Ga0268266_10000057 Ga0268266_10000057210 300
257 3300028381 Ga0268264_10000098 Ga0268264_10000098115 300
258 3300031911 Ga0307412_10003311 Ga0307412_100033112 300
259 3300047443 Ga0495687_000006 Ga0495687_000006_398545_399510 300
260 3300048925 Ga0496122_0110959 Ga0496122_0110959_509_1564 300
261 3300048926 Ga0496123_0059848 Ga0496123_0059848_334_1386 300
262 3300049742 Ga0501080_0467283 Ga0501080_0467283_14_1015 300
263 3300053139 Ga0500568_0004443 Ga0500568_0004443_1530_2495 300
264 2162886007 SwRhRL2b_contig_778235 SwRhRL2b_0664.00004880 301
265 3300001990 JGI24737J22298_10000550 JGI24737J22298_100005504 301
266 3300002067 JGI24735J21928_10000007 JGI24735J21928_1000000794 301
267 3300002737 JGI25162J39368_1000097 JGI25162J39368_100009796 301
268 3300003316 rootH1_10018613 rootH1_1001861315 301
269 3300003320 rootH2_10074909 rootH2_100749092 301
270 3300003323 rootH1_10048119 rootH1_100481194 301
271 3300005262 Ga0065165_1003334 Ga0065165_10033349 301
272 3300005289 Ga0065704_10072016 Ga0065704_100720167 301
273 3300005539 Ga0068853_100235221 Ga0068853_1002352212 301
274 3300005578 Ga0068854_100069255 Ga0068854_1000692552 301
275 3300006195 Ga0075366_10000107 Ga0075366_100001072 301
276 3300006195 Ga0075366_10007709 Ga0075366_100077092 301
277 3300009093 Ga0105240_10000623 Ga0105240_100006237 301
278 3300009148 Ga0105243_10000007 Ga0105243_1000000787 301
279 3300009174 Ga0105241_10001608 Ga0105241_100016087 301
280 3300009174 Ga0105241_10005848 Ga0105241_100058483 301
281 3300009545 Ga0105237_10004303 Ga0105237_100043037 301
282 3300009545 Ga0105237_10019933 Ga0105237_100199331 301
283 3300009545 Ga0105237_10043799 Ga0105237_100437992 301
284 3300009545 Ga0105237_10050900 Ga0105237_100509003 301
285 3300009551 Ga0105238_10075741 Ga0105238_100757413 301
286 3300010375 Ga0105239_10003569 Ga0105239_1000356914 301
287 3300010375 Ga0105239_10004630 Ga0105239_1000463010 301
288 3300010375 Ga0105239_10058955 Ga0105239_100589552 301
289 3300013100 Ga0157373_10020709 Ga0157373_100207095 301
290 3300013102 Ga0157371_10119645 Ga0157371_101196452 301
291 3300013307 Ga0157372_10006333 Ga0157372_1000633310 301
292 3300013307 Ga0157372_10233139 Ga0157372_102331392 301
293 3300017792 Ga0163161_10004368 Ga0163161_100043685 301
294 3300025233 Ga0209437_100030 Ga0209437_1000309 301
295 3300025913 Ga0207695_10000197 Ga0207695_1000019751 301
296 3300025913 Ga0207695_10000993 Ga0207695_1000099315 301
297 3300025914 Ga0207671_10003362 Ga0207671_1000336216 301
298 3300025914 Ga0207671_10006318 Ga0207671_1000631812 301
299 3300025914 Ga0207671_10075230 Ga0207671_100752302 301
300 3300025924 Ga0207694_10133825 Ga0207694_101338252 301
301 3300025935 Ga0207709_10000033 Ga0207709_10000033186 301
302 3300026041 Ga0207639_10021759 Ga0207639_100217597 301
303 3300028794 Ga0307515_10000081 Ga0307515_10000081107 301
304 3300028794 Ga0307515_10000081 Ga0307515_10000081151 301
305 3300031911 Ga0307412_10055161 Ga0307412_100551612 301
306 3300032005 Ga0307411_10339103 Ga0307411_103391032 301
307 3300033179 Ga0307507_10000111 Ga0307507_10000111117 301
308 3300044658 Ga0466972_0015909 Ga0466972_0015909_305_1279 301
309 3300044735 Ga0466968_0121688 Ga0466968_0121688_103_1077 301
310 3300046453 Ga0495627_005900 Ga0495627_005900_2590_3666 301
311 3300046460 Ga0495638_0006752 Ga0495638_0006752_3636_4694 301
312 3300046471 Ga0495650_0000147 Ga0495650_0000147_127038_128099 301
313 3300046471 Ga0495650_0000268 Ga0495650_0000268_84563_85558 301
314 3300046471 Ga0495650_0065856 Ga0495650_0065856_291_1286 301
315 3300046474 Ga0495605_0048261 Ga0495605_0048261_988_2055 301
316 3300046492 Ga0495585_0000698 Ga0495585_0000698_17258_18334 301
317 3300046492 Ga0495585_0001887 Ga0495585_0001887_4981_5976 301
318 3300046492 Ga0495585_0002184 Ga0495585_0002184_2309_3310 301
319 3300046500 Ga0495596_0003776 Ga0495596_0003776_4217_5293 301
320 3300046500 Ga0495596_0018383 Ga0495596_0018383_870_1943 301
321 3300046501 Ga0495607_0029322 Ga0495607_0029322_2191_3258 301
322 3300046501 Ga0495607_0061537 Ga0495607_0061537_282_1349 301
323 3300046506 Ga0495583_0009396 Ga0495583_0009396_697_1752 301
324 3300046506 Ga0495583_0043390 Ga0495583_0043390_905_1957 301
325 3300046507 Ga0495606_0000531 Ga0495606_0000531_48460_49455 301
326 3300046507 Ga0495606_0013357 Ga0495606_0013357_2810_3877 301
327 3300046507 Ga0495606_0019315 Ga0495606_0019315_1942_2937 301
328 3300046507 Ga0495606_0024311 Ga0495606_0024311_1654_2721 301
329 3300046507 Ga0495606_0126700 Ga0495606_0126700_96_1094 301
330 3300046512 Ga0495610_0001291 Ga0495610_0001291_14079_15074 301
331 3300046513 Ga0495616_0002188 Ga0495616_0002188_3683_4678 301
332 3300046513 Ga0495616_0016609 Ga0495616_0016609_740_1798 301
333 3300046518 Ga0495631_0000987 Ga0495631_0000987_5746_6804 301
334 3300046518 Ga0495631_0015331 Ga0495631_0015331_920_1996 301
335 3300046519 Ga0495632_0000065 Ga0495632_0000065_5827_6918 301
336 3300046519 Ga0495632_0001943 Ga0495632_0001943_12780_13847 301
337 3300046520 Ga0495637_0015978 Ga0495637_0015978_259_1326 301
338 3300046520 Ga0495637_0060537 Ga0495637_0060537_103_1098 301
339 3300046522 Ga0495643_0049900 Ga0495643_0049900_1149_2207 301
340 3300046523 Ga0495644_0010063 Ga0495644_0010063_523_1599 301
341 3300046524 Ga0495648_0000807 Ga0495648_0000807_8513_9574 301
342 3300046524 Ga0495648_0006513 Ga0495648_0006513_2607_3608 301
343 3300046524 Ga0495648_0031286 Ga0495648_0031286_1214_2215 301
344 3300046524 Ga0495648_0083563 Ga0495648_0083563_444_1508 301
345 3300046529 Ga0495652_0123065 Ga0495652_0123065_695_1690 301
346 3300046530 Ga0495654_0006901 Ga0495654_0006901_324_1382 301
347 3300046538 Ga0495609_0000722 Ga0495609_0000722_13015_14076 301
348 3300046538 Ga0495609_0012481 Ga0495609_0012481_2756_3757 301
349 3300046538 Ga0495609_0030381 Ga0495609_0030381_129_1187 301
350 3300046538 Ga0495609_0041608 Ga0495609_0041608_81_1076 301
351 3300046542 Ga0495597_0014857 Ga0495597_0014857_1809_2867 301
352 3300046558 Ga0495633_0000042 Ga0495633_0000042_127553_128554 301
353 3300046558 Ga0495633_0002047 Ga0495633_0002047_4145_5140 301
354 3300046616 Ga0495668_0000011 Ga0495668_0000011_121939_122940 301
355 3300046616 Ga0495668_0004743 Ga0495668_0004743_977_2035 301
356 3300046648 Ga0495611_0004154 Ga0495611_0004154_2723_3799 301
357 3300046660 Ga0495625_0000007 Ga0495625_0000007_413887_414882 301
358 3300046660 Ga0495625_0000239 Ga0495625_0000239_4606_5607 301
359 3300046660 Ga0495625_0031871 Ga0495625_0031871_1788_2846 301
360 3300046665 Ga0495661_0001414 Ga0495661_0001414_2012_3073 301
361 3300046665 Ga0495661_0011780 Ga0495661_0011780_925_1920 301
362 3300046665 Ga0495661_0024920 Ga0495661_0024920_2087_3163 301
363 3300046665 Ga0495661_0025852 Ga0495661_0025852_852_1943 301
364 3300046684 Ga0495669_0003158 Ga0495669_0003158_3114_4190 301
365 3300046692 Ga0495671_0003874 Ga0495671_0003874_5730_6788 301
366 3300046694 Ga0495649_0000007 Ga0495649_0000007_22600_23595 301
367 3300046794 Ga0495589_0006910 Ga0495589_0006910_4584_5645 301
368 3300046810 Ga0495660_0006724 Ga0495660_0006724_1555_2550 301
369 3300046810 Ga0495660_0066668 Ga0495660_0066668_276_1343 301
370 3300047320 Ga0495672_0000316 Ga0495672_0000316_18982_20043 301
371 3300047321 Ga0495676_0113090 Ga0495676_0113090_21_1082 301
372 3300047323 Ga0495683_0021459 Ga0495683_0021459_1231_2292 301
373 3300047443 Ga0495687_000064 Ga0495687_000064_126095_127150 301
374 3300047446 Ga0495679_001737 Ga0495679_001737_5888_6946 301
375 3300047446 Ga0495679_005406 Ga0495679_005406_4004_5119 301
376 3300047446 Ga0495679_024398 Ga0495679_024398_985_1980 301
377 3300047470 Ga0495681_0058783 Ga0495681_0058783_465_1541 301
378 3300047472 Ga0495686_0000188 Ga0495686_0000188_108547_109656 301
379 3300047472 Ga0495686_0000402 Ga0495686_0000402_7299_8300 301
380 3300047472 Ga0495686_0004244 Ga0495686_0004244_9825_10889 301
381 3300047472 Ga0495686_0063201 Ga0495686_0063201_317_1375 301
382 3300048091 Ga0495626_0004460 Ga0495626_0004460_6549_7625 301
383 3300048091 Ga0495626_0014143 Ga0495626_0014143_544_1611 301
384 3300048912 Ga0496109_0029402 Ga0496109_0029402_2184_3245 301
385 3300048916 Ga0496113_0027201 Ga0496113_0027201_853_1914 301
386 3300048925 Ga0496122_0003122 Ga0496122_0003122_2518_3579 301
387 3300048925 Ga0496122_0098185 Ga0496122_0098185_434_1498 301
388 3300048926 Ga0496123_0000122 Ga0496123_0000122_148334_149395 301
389 3300048927 Ga0496124_0009148 Ga0496124_0009148_2903_3976 301
390 3300048927 Ga0496124_0045402 Ga0496124_0045402_1139_2209 301
391 3300048927 Ga0496124_0054616 Ga0496124_0054616_41_1111 301
392 3300048928 Ga0496125_0003227 Ga0496125_0003227_11679_12740 301
393 3300049459 Ga0495678_000315 Ga0495678_000315_46335_47402 301
394 3300049459 Ga0495678_002374 Ga0495678_002374_8125_9192 301
395 3300049460 Ga0495682_0010825 Ga0495682_0010825_1610_2674 301
396 3300050493 nmdc:mga0k408_229_c1 nmdc:mga0k408_229_c1_22785_23786 301
397 3300053156 Ga0500622_0013424 Ga0500622_0013424_1540_2550 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

41

352

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qz4-assembly2.cif.gz_B crystal structure of an endo-1,4-beta-xylanase d (bt_3675) from bacteroides thetaiotaomicron vpi-5482 at 1.74 a resolution 0.909 4 292
3qz4-assembly2.cif.gz_B crystal structure of an endo-1,4-beta-xylanase d (bt_3675) from bacteroides thetaiotaomicron vpi-5482 at 1.74 a resolution 0.8711 4 292
8hcj-assembly2.cif.gz_F structure of gh43 family enzyme, xylan 1, 4 beta- xylosidase from pseudopedobacter saltans 0.8567 6 301
4nov-assembly1.cif.gz_A xsa43e, a gh43 family enzyme from butyrivibrio proteoclasticus 0.8483 3 298
3qee-assembly2.cif.gz_B the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases 0.8482 3 301
ID Description Score Start End Superfamily
3qz4B00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8995 4 292 2.115.10.20
3qz4B00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.862 4 292 2.115.10.20
3qefB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8523 4 301 2.115.10.20
3qefB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8468 4 301 2.115.10.20
4novA00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8325 3 298 2.115.10.20
ID Description Score Start End GO Terms
AF-K1SMT7-F1-model_v4 Xylosidase/arabinosidase 0.9947 121 292 GO:0004553
GO:0005975
AF-A0A4Q3NZS6-F1-model_v4 deleted 0.9931 103 296
AF-A0A4U0H1X3-F1-model_v4 Arabinan endo-1,5-alpha-L-arabinosidase 0.9923 6 301 GO:0004553
GO:0005975
AF-A0A7T9Q596-F1-model_v4 deleted 0.9919 3 301
AF-A0A5R9KFP3-F1-model_v4 Arabinan endo-1,5-alpha-L-arabinosidase 0.9894 4 301 GO:0004553
GO:0005975

Feature Viewer

pLDDT pTM Quality
94.48 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map