F433879

General Info

Members Datasets Scaffolds Average Seq Length
397 243 794 149

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0203010|Ga0501038_0203010_147_659
Length 170
Sequence LRPNRALAISLYLEIIQSEPAVPEYRKTAEAVANLTPEQYRVTQQSGTEHPGTGPLLHNKEPGIYVDIVSGEPLFASSDKFDSHCGWPSFTKPIEPANVAELNDTSHGMVRTEVRSKHGDSHLGHVFEDGPRDRGGLRYCINSASLRFVHRDRMEAEGYGAYLNQVEDVR

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
159 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
198 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
199 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
200 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
222 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
223 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
227 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
228 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 2509276019 Ensifer aridi TW10 Isolate Nodule
231 2516143018 Ensifer sp. BR816 Isolate Nodule
232 2534681786 Brucella suis 92/29 Isolate Unclassified
233 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
234 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
235 2643221695 Lysobacter sp. Root494 Isolate Unclassified
236 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
237 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
238 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
239 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
240 2854911287 Brucella lupini LUP21 Isolate Unclassified
241 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
242 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
243 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 0
Isolates 3.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.83
Nodule 0.76
Rhizoplane 0.76
Rhizosphere 83.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0203010 3300049574 Bacteria 1590
2 Ga0065715_10317057 3300005293 Bacteria 999
3 Ga0070658_10011401 3300005327 Bacteria 7128
4 Ga0070658_10024757 3300005327 Bacteria 4814
5 Ga0070658_10244816 3300005327 Bacteria 1520
6 Ga0070658_10534926 3300005327 Bacteria 1014
7 Ga0070676_10018115 3300005328 Bacteria 3899
8 Ga0070676_10033704 3300005328 Bacteria 2938
9 Ga0070683_100006958 3300005329 Bacteria 9512
10 Ga0070683_100019877 3300005329 Bacteria 5970
11 Ga0070683_101046726 3300005329 Bacteria 784
12 Ga0070677_10082420 3300005333 Bacteria 1379
13 Ga0068869_100019096 3300005334 Bacteria 4677
14 Ga0068869_100966958 3300005334 Bacteria 740
15 Ga0070666_10000243 3300005335 Bacteria 37033
16 Ga0070666_10313337 3300005335 Bacteria 1118
17 Ga0068868_100035298 3300005338 Bacteria 3865
18 Ga0068868_101878952 3300005338 Bacteria 567
19 Ga0070660_100042469 3300005339 Bacteria 3470
20 Ga0070660_100097821 3300005339 Bacteria 2322
21 Ga0070689_100862013 3300005340 Bacteria 799
22 Ga0070692_10588214 3300005345 Bacteria 735
23 Ga0070668_100006717 3300005347 Bacteria 8525
24 Ga0070668_100037276 3300005347 Bacteria 3712
25 Ga0070668_100067335 3300005347 Bacteria 2781
26 Ga0070669_100002302 3300005353 Bacteria 13841
27 Ga0070669_100443797 3300005353 Bacteria 1068
28 Ga0070675_100001255 3300005354 Bacteria 18546
29 Ga0070675_100212390 3300005354 Bacteria 1682
30 Ga0070675_100240581 3300005354 Bacteria 1581
31 Ga0070675_100716704 3300005354 Bacteria 912
32 Ga0070671_100145771 3300005355 Bacteria 1998
33 Ga0070671_100225109 3300005355 Bacteria 1591
34 Ga0070674_100152441 3300005356 Bacteria 1745
35 Ga0070673_100347566 3300005364 Bacteria 1315
36 Ga0070659_100322020 3300005366 Bacteria 1292
37 Ga0070667_100049104 3300005367 Bacteria 3553
38 Ga0070667_100159777 3300005367 Bacteria 1984
39 Ga0070667_101140923 3300005367 Bacteria 729
40 Ga0070701_10557525 3300005438 Bacteria 753
41 Ga0070700_100212264 3300005441 Bacteria 1366
42 Ga0070663_100648380 3300005455 Bacteria 893
43 Ga0070678_100004458 3300005456 Bacteria 7944
44 Ga0070678_100109602 3300005456 Bacteria 2157
45 Ga0070678_100878836 3300005456 Bacteria 818
46 Ga0070662_100010459 3300005457 Bacteria 6090
47 Ga0070662_100485787 3300005457 Bacteria 1029
48 Ga0070681_10088801 3300005458 Bacteria 3042
49 Ga0068867_100025107 3300005459 Bacteria 4275
50 Ga0068867_100059695 3300005459 Bacteria 2827
51 Ga0068867_101184442 3300005459 Bacteria 701
52 Ga0070685_10263200 3300005466 Bacteria 1148
53 Ga0070685_11420480 3300005466 Bacteria 533
54 Ga0070679_100365792 3300005530 Bacteria 1389
55 Ga0070684_100029622 3300005535 Bacteria 4641
56 Ga0070684_100137197 3300005535 Bacteria 2210
57 Ga0068853_100052131 3300005539 Bacteria 3524
58 Ga0070672_100001929 3300005543 Bacteria 13022
59 Ga0070672_100197999 3300005543 Bacteria 1679
60 Ga0070672_100319716 3300005543 Bacteria 1319
61 Ga0070693_100063215 3300005547 Bacteria 2157
62 Ga0070693_100178062 3300005547 Bacteria 1367
63 Ga0070665_100060237 3300005548 Bacteria 3805
64 Ga0070665_100246255 3300005548 Bacteria 1788
65 Ga0070665_100334667 3300005548 Bacteria 1519
66 Ga0068855_100835960 3300005563 Bacteria 977
67 Ga0068855_101397182 3300005563 Bacteria 722
68 Ga0070664_100006880 3300005564 Bacteria 9168
69 Ga0070664_100217628 3300005564 Bacteria 1708
70 Ga0068857_100392176 3300005577 Bacteria 1291
71 Ga0068857_100786470 3300005577 Bacteria 908
72 Ga0068856_100008313 3300005614 Bacteria 10112
73 Ga0068856_100031548 3300005614 Bacteria 5185
74 Ga0068852_100010624 3300005616 Bacteria 6889
75 Ga0068859_101995630 3300005617 Bacteria 641
76 Ga0068864_100038465 3300005618 Bacteria 4086
77 Ga0068861_100244573 3300005719 Bacteria 1528
78 Ga0068861_100518527 3300005719 Bacteria 1080
79 Ga0068851_10051994 3300005834 Bacteria 2083
80 Ga0068870_10044108 3300005840 Bacteria 2329
81 Ga0068863_100140080 3300005841 Bacteria 2312
82 Ga0068863_100217684 3300005841 Bacteria 1839
83 Ga0068863_100238025 3300005841 Bacteria 1757
84 Ga0068858_100752576 3300005842 Bacteria 949
85 Ga0068858_101778596 3300005842 Bacteria 609
86 Ga0068860_100063283 3300005843 Bacteria 3514
87 Ga0068860_100896090 3300005843 Bacteria 903
88 Ga0068862_100012210 3300005844 Bacteria 7100
89 Ga0068862_100022705 3300005844 Bacteria 5250
90 Ga0068862_100052915 3300005844 Bacteria 3475
91 Ga0081539_10077322 3300005985 Bacteria 1760
92 Ga0075368_10009916 3300006042 Bacteria 3435
93 Ga0075368_10182423 3300006042 Bacteria 885
94 Ga0075363_100008312 3300006048 Bacteria 4827
95 Ga0075364_10040579 3300006051 Bacteria 3019
96 Ga0075432_10391882 3300006058 Bacteria 598
97 Ga0075362_10016535 3300006177 Bacteria 3022
98 Ga0075362_10028148 3300006177 Bacteria 2412
99 Ga0075367_10060075 3300006178 Bacteria 2265
100 Ga0075369_10345057 3300006186 Bacteria 698
101 Ga0075366_10075634 3300006195 Bacteria 2009
102 Ga0075366_10307133 3300006195 Bacteria 971
103 Ga0097621_100066075 3300006237 Bacteria 2978
104 Ga0097621_100067271 3300006237 Bacteria 2953
105 Ga0097621_100941372 3300006237 Bacteria 806
106 Ga0075370_10034954 3300006353 Bacteria 2819
107 Ga0075370_10116236 3300006353 Bacteria 1555
108 Ga0068871_100004294 3300006358 Bacteria 9893
109 Ga0068871_100004598 3300006358 Bacteria 9629
110 Ga0068871_100267769 3300006358 Bacteria 1492
111 Ga0068871_100560094 3300006358 Bacteria 1036
112 Ga0075428_100292327 3300006844 Bacteria 1752
113 Ga0075431_100325966 3300006847 Bacteria 1548
114 Ga0075429_100132590 3300006880 Bacteria 2180
115 Ga0068865_100029455 3300006881 Bacteria 3643
116 Ga0068865_100094822 3300006881 Bacteria 2173
117 Ga0068865_100352608 3300006881 Bacteria 1193
118 Ga0068865_100844515 3300006881 Bacteria 793
119 Ga0097620_101995669 3300006931 Bacteria 641
120 Ga0099795_10215497 3300007788 Bacteria 815
121 Ga0105240_10094185 3300009093 Bacteria 3654
122 Ga0105245_10576269 3300009098 Bacteria 1150
123 Ga0105245_11823275 3300009098 Bacteria 661
124 Ga0105243_10081823 3300009148 Bacteria 2637
125 Ga0105243_10482740 3300009148 Bacteria 1170
126 Ga0105242_10344480 3300009176 Bacteria 1374
127 Ga0105248_10645837 3300009177 Bacteria 1194
128 Ga0105248_11430001 3300009177 Bacteria 782
129 Ga0105238_10003886 3300009551 Bacteria 14832
130 Ga0105238_10010886 3300009551 Bacteria 9141
131 Ga0105238_11439866 3300009551 Bacteria 717
132 Ga0105249_10961037 3300009553 Bacteria 922
133 Ga0157373_10020376 3300013100 Bacteria 4819
134 Ga0157371_10033930 3300013102 Bacteria 3665
135 Ga0157371_10225633 3300013102 Bacteria 1346
136 Ga0157370_11436672 3300013104 Bacteria 620
137 Ga0157369_10015766 3300013105 Bacteria 8516
138 Ga0157369_10238907 3300013105 Bacteria 1898
139 Ga0157369_10517442 3300013105 Bacteria 1234
140 Ga0157374_10374401 3300013296 Bacteria 1418
141 Ga0157378_11976834 3300013297 Bacteria 633
142 Ga0163162_10245211 3300013306 Bacteria 1923
143 Ga0157372_10006066 3300013307 Bacteria 12839
144 Ga0157372_10012754 3300013307 Bacteria 8953
145 Ga0157375_10142796 3300013308 Bacteria 2522
146 Ga0157375_10588601 3300013308 Bacteria 1272
147 Ga0157375_11063845 3300013308 Bacteria 946
148 Ga0157375_11919989 3300013308 Bacteria 703
149 Ga0163163_10000117 3300014325 Bacteria 84938
150 Ga0163163_10669159 3300014325 Bacteria 1102
151 Ga0157380_10045344 3300014326 Bacteria 3450
152 Ga0157380_10196381 3300014326 Bacteria 1786
153 Ga0157380_12217769 3300014326 Bacteria 613
154 Ga0157377_10882598 3300014745 Bacteria 667
155 Ga0157379_10134858 3300014968 Bacteria 2224
156 Ga0157379_10269721 3300014968 Bacteria 1547
157 Ga0157376_10010471 3300014969 Bacteria 6784
158 Ga0157376_10188755 3300014969 Bacteria 1889
159 Ga0209759_1002500 3300025256 Bacteria 8023
160 Ga0209758_1006149 3300025297 Bacteria 8798
161 Ga0209050_1000176 3300025298 Bacteria 146700
162 Ga0207656_10036316 3300025321 Bacteria 2067
163 Ga0207682_10012294 3300025893 Bacteria 3342
164 Ga0207680_10000114 3300025903 Bacteria 37044
165 Ga0207680_10859277 3300025903 Bacteria 650
166 Ga0207645_10010758 3300025907 Bacteria 6272
167 Ga0207645_10015345 3300025907 Bacteria 5092
168 Ga0207643_10260346 3300025908 Bacteria 1071
169 Ga0207705_10019087 3300025909 Bacteria 4904
170 Ga0207705_10148958 3300025909 Bacteria 1752
171 Ga0207705_10289240 3300025909 Bacteria 1255
172 Ga0207707_10199588 3300025912 Bacteria 1744
173 Ga0207707_10807458 3300025912 Bacteria 781
174 Ga0207695_10211684 3300025913 Bacteria 1849
175 Ga0207657_10042428 3300025919 Bacteria 4014
176 Ga0207657_10094556 3300025919 Bacteria 2488
177 Ga0207649_10020086 3300025920 Bacteria 3825
178 Ga0207681_10009677 3300025923 Bacteria 5897
179 Ga0207694_10025483 3300025924 Bacteria 4496
180 Ga0207694_10032277 3300025924 Bacteria 4007
181 Ga0207650_10001001 3300025925 Bacteria 21241
182 Ga0207659_10002865 3300025926 Bacteria 10275
183 Ga0207659_10170056 3300025926 Bacteria 1719
184 Ga0207687_10670294 3300025927 Bacteria 878
185 Ga0207687_10961740 3300025927 Bacteria 732
186 Ga0207690_10024464 3300025932 Bacteria 3783
187 Ga0207690_10327760 3300025932 Bacteria 1205
188 Ga0207686_10568752 3300025934 Bacteria 888
189 Ga0207709_10106146 3300025935 Bacteria 1868
190 Ga0207704_10038481 3300025938 Bacteria 2774
191 Ga0207704_10376331 3300025938 Bacteria 1113
192 Ga0207704_10699666 3300025938 Bacteria 839
193 Ga0207665_10478314 3300025939 Bacteria 959
194 Ga0207691_10000822 3300025940 Bacteria 30938
195 Ga0207691_10024955 3300025940 Bacteria 5617
196 Ga0207689_10023985 3300025942 Bacteria 5118
197 Ga0207689_10448735 3300025942 Bacteria 1078
198 Ga0207661_10051632 3300025944 Bacteria 3281
199 Ga0207661_10548049 3300025944 Bacteria 1059
200 Ga0207661_11216481 3300025944 Bacteria 693
201 Ga0207661_11665086 3300025944 Bacteria 583
202 Ga0207679_10049079 3300025945 Bacteria 3077
203 Ga0207667_10061916 3300025949 Bacteria 3914
204 Ga0207667_10200359 3300025949 Bacteria 2048
205 Ga0207667_10466194 3300025949 Bacteria 1283
206 Ga0207667_11091583 3300025949 Bacteria 782
207 Ga0207667_11621021 3300025949 Bacteria 615
208 Ga0207651_10011633 3300025960 Bacteria 4934
209 Ga0207651_10146626 3300025960 Bacteria 1831
210 Ga0207651_10263437 3300025960 Bacteria 1416
211 Ga0207712_10087056 3300025961 Bacteria 2290
212 Ga0207668_10001951 3300025972 Bacteria 12085
213 Ga0207668_10089741 3300025972 Bacteria 2254
214 Ga0207668_10744046 3300025972 Bacteria 864
215 Ga0207658_10022795 3300025986 Bacteria 4361
216 Ga0207658_10043004 3300025986 Bacteria 3282
217 Ga0207658_10205544 3300025986 Bacteria 1647
218 Ga0207677_10040766 3300026023 Bacteria 3064
219 Ga0207703_10033131 3300026035 Bacteria 4093
220 Ga0207639_10025263 3300026041 Bacteria 4307
221 Ga0207708_10127311 3300026075 Bacteria 1989
222 Ga0207702_10016894 3300026078 Bacteria 6039
223 Ga0207702_10836957 3300026078 Bacteria 910
224 Ga0207641_10006400 3300026088 Bacteria 9927
225 Ga0207641_10138758 3300026088 Bacteria 2191
226 Ga0207648_10044355 3300026089 Bacteria 3901
227 Ga0207676_10017012 3300026095 Bacteria 5267
228 Ga0207676_10611163 3300026095 Bacteria 1048
229 Ga0207674_10008744 3300026116 Bacteria 11658
230 Ga0207674_10647686 3300026116 Bacteria 1020
231 Ga0207674_10665693 3300026116 Bacteria 1005
232 Ga0207675_100236307 3300026118 Bacteria 1765
233 Ga0207683_10189418 3300026121 Bacteria 1867
234 Ga0207683_10883133 3300026121 Bacteria 830
235 Ga0207698_10034468 3300026142 Bacteria 3690
236 Ga0207698_10305233 3300026142 Bacteria 1484
237 Ga0209813_10000837 3300027866 Bacteria 6947
238 Ga0268266_10073336 3300028379 Bacteria 2970
239 Ga0268266_10733469 3300028379 Bacteria 953
240 Ga0268265_10012600 3300028380 Bacteria 5733
241 Ga0268265_10020899 3300028380 Bacteria 4575
242 Ga0268265_10137276 3300028380 Bacteria 2042
243 Ga0268265_10778685 3300028380 Bacteria 931
244 Ga0268264_10048821 3300028381 Bacteria 3520
245 Ga0307509_10616221 3300031507 Bacteria 757
246 Ga0307509_10802470 3300031507 Bacteria 606
247 Ga0307408_100678230 3300031548 Bacteria 924
248 Ga0265314_10212904 3300031711 Bacteria 1134
249 Ga0307405_10541720 3300031731 Bacteria 940
250 Ga0307413_10689201 3300031824 Bacteria 847
251 Ga0307412_10050739 3300031911 Bacteria 2739
252 Ga0307416_100839668 3300032002 Bacteria 1016
253 Ga0307414_10239265 3300032004 Bacteria 1502
254 Ga0307411_10158955 3300032005 Bacteria 1689
255 Ga0307415_100273578 3300032126 Bacteria 1385
256 Ga0373923_0063969 3300035111 Bacteria 1568
257 Ga0373957_0116989 3300035120 Bacteria 1077
258 Ga0373943_0125974 3300035170 Bacteria 1366
259 Ga0373946_0092925 3300035171 Bacteria 1340
260 Ga0373955_0013200 3300035172 Bacteria 3986
261 Ga0373927_0075634 3300035695 Bacteria 2181
262 Ga0373933_0189704 3300035724 Bacteria 1313
263 Ga0373947_0091193 3300035725 Bacteria 1901
264 Ga0373937_0286468 3300036401 Bacteria 1556
265 Ga0373937_1284001 3300036401 Bacteria 680
266 Ga0395898_0014351 3300037466 Bacteria 8142
267 Ga0395898_0853236 3300037466 Bacteria 850
268 Ga0395901_0174444 3300038443 Bacteria 2255
269 Ga0395901_0197387 3300038443 Bacteria 2110
270 Ga0439465_0163575 3300041413 Bacteria 799
271 Ga0451804_0814885 3300041463 Bacteria 584
272 Ga0451833_1030971 3300041491 Bacteria 581
273 Ga0439431_0124486 3300041997 Bacteria 721
274 Ga0439432_018216 3300042006 Bacteria 2349
275 Ga0466966_0340166 3300044684 Bacteria 902
276 Ga0495641_0234668 3300046461 Bacteria 824
277 Ga0495596_0000326 3300046500 Bacteria 31041
278 Ga0495610_0200809 3300046512 Bacteria 817
279 Ga0495643_0134221 3300046522 Bacteria 1240
280 Ga0495644_0092382 3300046523 Bacteria 1143
281 Ga0495659_0101060 3300046664 Bacteria 1117
282 Ga0495588_0309945 3300046674 Bacteria 831
283 Ga0495599_0356815 3300046678 Bacteria 876
284 Ga0495658_0014686 3300046683 Bacteria 4005
285 Ga0495670_0036102 3300046691 Bacteria 2463
286 Ga0495600_0675463 3300046809 Bacteria 623
287 Ga0495636_0201644 3300047318 Bacteria 908
288 Ga0495672_0010590 3300047320 Bacteria 6555
289 Ga0495686_0000886 3300047472 Bacteria 37940
290 Ga0495686_0039390 3300047472 Bacteria 3018
291 Ga0496101_1376125 3300048904 Bacteria 551
292 Ga0496117_0040664 3300048920 Bacteria 3416
293 Ga0496118_0001279 3300048921 Bacteria 38491
294 Ga0496121_0095570 3300048924 Bacteria 2309
295 Ga0496124_0016896 3300048927 Bacteria 6915
296 Ga0496126_0003887 3300048929 Bacteria 18388
297 Ga0496126_0489318 3300048929 Bacteria 985
298 Ga0501032_0049863 3300049569 Bacteria 2824
299 Ga0501033_0066609 3300049570 Bacteria 2648
300 Ga0501034_0262239 3300049571 Bacteria 1670
301 Ga0501036_0162167 3300049572 Bacteria 1884
302 Ga0501036_0237803 3300049572 Bacteria 1528
303 Ga0501036_0399004 3300049572 Bacteria 1147
304 Ga0501036_0576585 3300049572 Bacteria 934
305 Ga0501037_0290092 3300049573 Bacteria 1138
306 Ga0501037_0474284 3300049573 Bacteria 851
307 Ga0501038_0025254 3300049574 Bacteria 5297
308 Ga0501038_0047600 3300049574 Bacteria 3714
309 Ga0501038_0408940 3300049574 Bacteria 1049
310 Ga0501039_0540642 3300049575 Bacteria 914
311 Ga0501043_0087930 3300049579 Bacteria 2442
312 Ga0501043_0229333 3300049579 Bacteria 1435
313 Ga0501043_0498608 3300049579 Bacteria 910
314 Ga0501047_0009856 3300049581 Bacteria 9027
315 Ga0501047_0025524 3300049581 Bacteria 5681
316 Ga0501047_0203627 3300049581 Bacteria 1839
317 Ga0501047_0458055 3300049581 Bacteria 1104
318 Ga0501067_0187607 3300049583 Bacteria 1151
319 Ga0501067_0585808 3300049583 Bacteria 625
320 Ga0501068_0022545 3300049584 Bacteria 3683
321 Ga0501068_0043815 3300049584 Bacteria 2693
322 Ga0501068_0095235 3300049584 Bacteria 1841
323 Ga0501070_0083533 3300049586 Bacteria 2644
324 Ga0501073_0040379 3300049589 Bacteria 3302
325 Ga0501073_0156797 3300049589 Bacteria 1577
326 Ga0501073_1096868 3300049589 Bacteria 547
327 Ga0501074_0601255 3300049590 Bacteria 778
328 Ga0501076_0464482 3300049592 Bacteria 1042
329 Ga0501223_034381 3300049663 Bacteria 986
330 Ga0501223_112121 3300049663 Bacteria 570
331 Ga0501239_010931 3300049672 Bacteria 1007
332 Ga0501249_011054 3300049679 Bacteria 1892
333 Ga0501257_132011 3300049686 Bacteria 676
334 Ga0501079_0163048 3300049741 Bacteria 1739
335 Ga0501080_0009836 3300049742 Bacteria 8739
336 Ga0501080_0047624 3300049742 Bacteria 3991
337 Ga0501080_0071569 3300049742 Bacteria 3225
338 Ga0501080_0148755 3300049742 Bacteria 2165
339 Ga0501080_0597945 3300049742 Bacteria 979
340 Ga0501081_0104788 3300049743 Bacteria 2003
341 Ga0501083_0003695 3300049744 Bacteria 10753
342 Ga0501083_0283617 3300049744 Bacteria 1077
343 Ga0501035_0472399 3300049822 Bacteria 1035
344 Ga0501044_0003373 3300049823 Bacteria 18009
345 Ga0501044_0031575 3300049823 Bacteria 5574
346 Ga0501044_0212338 3300049823 Bacteria 1889
347 Ga0501044_0338323 3300049823 Bacteria 1426
348 Ga0501044_0559232 3300049823 Bacteria 1040
349 Ga0501044_0653284 3300049823 Bacteria 940
350 Ga0501044_0740974 3300049823 Bacteria 865
351 nmdc:mga03683_25165_c1 3300050489 Bacteria 2335
352 nmdc:mga03683_440_c1 3300050489 Bacteria 11977
353 nmdc:mga00v17_13448_c1 3300050491 Bacteria 4545
354 nmdc:mga00v17_32548_c1 3300050491 Bacteria 3083
355 nmdc:mga0yw44_112145_c1 3300050492 Bacteria 1749
356 nmdc:mga0k408_240474_c1 3300050493 Bacteria 1081
357 nmdc:mga0k408_492677_c1 3300050493 Bacteria 727
358 nmdc:mga06z11_588_c1 3300050494 Bacteria 13299
359 nmdc:mga04h51_80_c1 3300050495 Bacteria 31181
360 nmdc:mga07m45_100113_c1 3300050496 Bacteria 1664
361 nmdc:mga07m45_15416_c1 3300050496 Bacteria 4081
362 nmdc:mga07m45_252051_c1 3300050496 Bacteria 1027
363 nmdc:mga07m45_40299_c1 3300050496 Bacteria 2613
364 nmdc:mga07m45_411616_c1 3300050496 Bacteria 785
365 nmdc:mga09592_126228_c1 3300050508 Bacteria 2199
366 nmdc:mga0sz30_62096_c2 3300050516 Bacteria 721
367 nmdc:mga0sz30_669_c1 3300050516 Bacteria 12638
368 Ga0495601_0061155 3300053077 Bacteria 2391
369 Ga0495612_0054691 3300053078 Bacteria 1645
370 Ga0495619_0500793 3300053085 Bacteria 835
371 Ga0500643_000922 3300053087 Bacteria 18497
372 Ga0500651_0475645 3300053093 Bacteria 692
373 Ga0500562_114413 3300053108 Bacteria 735
374 Ga0500607_001611 3300053121 Bacteria 19933
375 Ga0500559_0000747 3300053136 Bacteria 21331
376 Ga0500559_0003876 3300053136 Bacteria 7232
377 Ga0500568_0019714 3300053139 Bacteria 2925
378 Ga0500568_0056162 3300053139 Bacteria 1535
379 Ga0500616_0006255 3300053153 Bacteria 7843
380 Ga0500645_006678 3300053730 Bacteria 4090
381 Ga0500609_000259 3300053731 Bacteria 7676
382 Ga0500661_000178 3300055283 Bacteria 11100
383 Ga0501082_0002256 3300060353 Bacteria 16881
384 2509374943 2509276019 Bacteria 6802256
385 2516205949 2516143018 Bacteria 6951533
386 2535486421 2534681786 Bacteria 3308809
387 2585258811 2582581304 Bacteria 5831370
388 2600200932 2599185354 Bacteria 4398675
389 2644530273 2643221695 Bacteria 3441323
390 2753765256 2751185897 Bacteria 5322941
391 2819554366 2818991438 Bacteria 5793701
392 2830075978 2830075706 Bacteria 3855215
393 2852388797 2852387548 Bacteria 8025568
394 2854913393 2854911287 Bacteria 5582813
395 2858438831 2858438669 Bacteria 2058402
396 8046773014 8046767195 Bacteria 7547379
397 8057582060 8057575449 Bacteria 7367519
398 Ga0501038_0203010
399 Ga0065715_10317057
400 Ga0070658_10011401
401 Ga0070658_10024757
402 Ga0070658_10244816
403 Ga0070658_10534926
404 Ga0070676_10018115
405 Ga0070676_10033704
406 Ga0070683_100006958
407 Ga0070683_100019877
408 Ga0070683_101046726
409 Ga0070677_10082420
410 Ga0068869_100019096
411 Ga0068869_100966958
412 Ga0070666_10000243
413 Ga0070666_10313337
414 Ga0068868_100035298
415 Ga0068868_101878952
416 Ga0070660_100042469
417 Ga0070660_100097821
418 Ga0070689_100862013
419 Ga0070692_10588214
420 Ga0070668_100006717
421 Ga0070668_100037276
422 Ga0070668_100067335
423 Ga0070669_100002302
424 Ga0070669_100443797
425 Ga0070675_100001255
426 Ga0070675_100212390
427 Ga0070675_100240581
428 Ga0070675_100716704
429 Ga0070671_100145771
430 Ga0070671_100225109
431 Ga0070674_100152441
432 Ga0070673_100347566
433 Ga0070659_100322020
434 Ga0070667_100049104
435 Ga0070667_100159777
436 Ga0070667_101140923
437 Ga0070701_10557525
438 Ga0070700_100212264
439 Ga0070663_100648380
440 Ga0070678_100004458
441 Ga0070678_100109602
442 Ga0070678_100878836
443 Ga0070662_100010459
444 Ga0070662_100485787
445 Ga0070681_10088801
446 Ga0068867_100025107
447 Ga0068867_100059695
448 Ga0068867_101184442
449 Ga0070685_10263200
450 Ga0070685_11420480
451 Ga0070679_100365792
452 Ga0070684_100029622
453 Ga0070684_100137197
454 Ga0068853_100052131
455 Ga0070672_100001929
456 Ga0070672_100197999
457 Ga0070672_100319716
458 Ga0070693_100063215
459 Ga0070693_100178062
460 Ga0070665_100060237
461 Ga0070665_100246255
462 Ga0070665_100334667
463 Ga0068855_100835960
464 Ga0068855_101397182
465 Ga0070664_100006880
466 Ga0070664_100217628
467 Ga0068857_100392176
468 Ga0068857_100786470
469 Ga0068856_100008313
470 Ga0068856_100031548
471 Ga0068852_100010624
472 Ga0068859_101995630
473 Ga0068864_100038465
474 Ga0068861_100244573
475 Ga0068861_100518527
476 Ga0068851_10051994
477 Ga0068870_10044108
478 Ga0068863_100140080
479 Ga0068863_100217684
480 Ga0068863_100238025
481 Ga0068858_100752576
482 Ga0068858_101778596
483 Ga0068860_100063283
484 Ga0068860_100896090
485 Ga0068862_100012210
486 Ga0068862_100022705
487 Ga0068862_100052915
488 Ga0081539_10077322
489 Ga0075368_10009916
490 Ga0075368_10182423
491 Ga0075363_100008312
492 Ga0075364_10040579
493 Ga0075432_10391882
494 Ga0075362_10016535
495 Ga0075362_10028148
496 Ga0075367_10060075
497 Ga0075369_10345057
498 Ga0075366_10075634
499 Ga0075366_10307133
500 Ga0097621_100066075
501 Ga0097621_100067271
502 Ga0097621_100941372
503 Ga0075370_10034954
504 Ga0075370_10116236
505 Ga0068871_100004294
506 Ga0068871_100004598
507 Ga0068871_100267769
508 Ga0068871_100560094
509 Ga0075428_100292327
510 Ga0075431_100325966
511 Ga0075429_100132590
512 Ga0068865_100029455
513 Ga0068865_100094822
514 Ga0068865_100352608
515 Ga0068865_100844515
516 Ga0097620_101995669
517 Ga0099795_10215497
518 Ga0105240_10094185
519 Ga0105245_10576269
520 Ga0105245_11823275
521 Ga0105243_10081823
522 Ga0105243_10482740
523 Ga0105242_10344480
524 Ga0105248_10645837
525 Ga0105248_11430001
526 Ga0105238_10003886
527 Ga0105238_10010886
528 Ga0105238_11439866
529 Ga0105249_10961037
530 Ga0157373_10020376
531 Ga0157371_10033930
532 Ga0157371_10225633
533 Ga0157370_11436672
534 Ga0157369_10015766
535 Ga0157369_10238907
536 Ga0157369_10517442
537 Ga0157374_10374401
538 Ga0157378_11976834
539 Ga0163162_10245211
540 Ga0157372_10006066
541 Ga0157372_10012754
542 Ga0157375_10142796
543 Ga0157375_10588601
544 Ga0157375_11063845
545 Ga0157375_11919989
546 Ga0163163_10000117
547 Ga0163163_10669159
548 Ga0157380_10045344
549 Ga0157380_10196381
550 Ga0157380_12217769
551 Ga0157377_10882598
552 Ga0157379_10134858
553 Ga0157379_10269721
554 Ga0157376_10010471
555 Ga0157376_10188755
556 Ga0209759_1002500
557 Ga0209758_1006149
558 Ga0209050_1000176
559 Ga0207656_10036316
560 Ga0207682_10012294
561 Ga0207680_10000114
562 Ga0207680_10859277
563 Ga0207645_10010758
564 Ga0207645_10015345
565 Ga0207643_10260346
566 Ga0207705_10019087
567 Ga0207705_10148958
568 Ga0207705_10289240
569 Ga0207707_10199588
570 Ga0207707_10807458
571 Ga0207695_10211684
572 Ga0207657_10042428
573 Ga0207657_10094556
574 Ga0207649_10020086
575 Ga0207681_10009677
576 Ga0207694_10025483
577 Ga0207694_10032277
578 Ga0207650_10001001
579 Ga0207659_10002865
580 Ga0207659_10170056
581 Ga0207687_10670294
582 Ga0207687_10961740
583 Ga0207690_10024464
584 Ga0207690_10327760
585 Ga0207686_10568752
586 Ga0207709_10106146
587 Ga0207704_10038481
588 Ga0207704_10376331
589 Ga0207704_10699666
590 Ga0207665_10478314
591 Ga0207691_10000822
592 Ga0207691_10024955
593 Ga0207689_10023985
594 Ga0207689_10448735
595 Ga0207661_10051632
596 Ga0207661_10548049
597 Ga0207661_11216481
598 Ga0207661_11665086
599 Ga0207679_10049079
600 Ga0207667_10061916
601 Ga0207667_10200359
602 Ga0207667_10466194
603 Ga0207667_11091583
604 Ga0207667_11621021
605 Ga0207651_10011633
606 Ga0207651_10146626
607 Ga0207651_10263437
608 Ga0207712_10087056
609 Ga0207668_10001951
610 Ga0207668_10089741
611 Ga0207668_10744046
612 Ga0207658_10022795
613 Ga0207658_10043004
614 Ga0207658_10205544
615 Ga0207677_10040766
616 Ga0207703_10033131
617 Ga0207639_10025263
618 Ga0207708_10127311
619 Ga0207702_10016894
620 Ga0207702_10836957
621 Ga0207641_10006400
622 Ga0207641_10138758
623 Ga0207648_10044355
624 Ga0207676_10017012
625 Ga0207676_10611163
626 Ga0207674_10008744
627 Ga0207674_10647686
628 Ga0207674_10665693
629 Ga0207675_100236307
630 Ga0207683_10189418
631 Ga0207683_10883133
632 Ga0207698_10034468
633 Ga0207698_10305233
634 Ga0209813_10000837
635 Ga0268266_10073336
636 Ga0268266_10733469
637 Ga0268265_10012600
638 Ga0268265_10020899
639 Ga0268265_10137276
640 Ga0268265_10778685
641 Ga0268264_10048821
642 Ga0307509_10616221
643 Ga0307509_10802470
644 Ga0307408_100678230
645 Ga0265314_10212904
646 Ga0307405_10541720
647 Ga0307413_10689201
648 Ga0307412_10050739
649 Ga0307416_100839668
650 Ga0307414_10239265
651 Ga0307411_10158955
652 Ga0307415_100273578
653 Ga0373923_0063969
654 Ga0373957_0116989
655 Ga0373943_0125974
656 Ga0373946_0092925
657 Ga0373955_0013200
658 Ga0373927_0075634
659 Ga0373933_0189704
660 Ga0373947_0091193
661 Ga0373937_0286468
662 Ga0373937_1284001
663 Ga0395898_0014351
664 Ga0395898_0853236
665 Ga0395901_0174444
666 Ga0395901_0197387
667 Ga0439465_0163575
668 Ga0451804_0814885
669 Ga0451833_1030971
670 Ga0439431_0124486
671 Ga0439432_018216
672 Ga0466966_0340166
673 Ga0495641_0234668
674 Ga0495596_0000326
675 Ga0495610_0200809
676 Ga0495643_0134221
677 Ga0495644_0092382
678 Ga0495659_0101060
679 Ga0495588_0309945
680 Ga0495599_0356815
681 Ga0495658_0014686
682 Ga0495670_0036102
683 Ga0495600_0675463
684 Ga0495636_0201644
685 Ga0495672_0010590
686 Ga0495686_0000886
687 Ga0495686_0039390
688 Ga0496101_1376125
689 Ga0496117_0040664
690 Ga0496118_0001279
691 Ga0496121_0095570
692 Ga0496124_0016896
693 Ga0496126_0003887
694 Ga0496126_0489318
695 Ga0501032_0049863
696 Ga0501033_0066609
697 Ga0501034_0262239
698 Ga0501036_0162167
699 Ga0501036_0237803
700 Ga0501036_0399004
701 Ga0501036_0576585
702 Ga0501037_0290092
703 Ga0501037_0474284
704 Ga0501038_0025254
705 Ga0501038_0047600
706 Ga0501038_0408940
707 Ga0501039_0540642
708 Ga0501043_0087930
709 Ga0501043_0229333
710 Ga0501043_0498608
711 Ga0501047_0009856
712 Ga0501047_0025524
713 Ga0501047_0203627
714 Ga0501047_0458055
715 Ga0501067_0187607
716 Ga0501067_0585808
717 Ga0501068_0022545
718 Ga0501068_0043815
719 Ga0501068_0095235
720 Ga0501070_0083533
721 Ga0501073_0040379
722 Ga0501073_0156797
723 Ga0501073_1096868
724 Ga0501074_0601255
725 Ga0501076_0464482
726 Ga0501223_034381
727 Ga0501223_112121
728 Ga0501239_010931
729 Ga0501249_011054
730 Ga0501257_132011
731 Ga0501079_0163048
732 Ga0501080_0009836
733 Ga0501080_0047624
734 Ga0501080_0071569
735 Ga0501080_0148755
736 Ga0501080_0597945
737 Ga0501081_0104788
738 Ga0501083_0003695
739 Ga0501083_0283617
740 Ga0501035_0472399
741 Ga0501044_0003373
742 Ga0501044_0031575
743 Ga0501044_0212338
744 Ga0501044_0338323
745 Ga0501044_0559232
746 Ga0501044_0653284
747 Ga0501044_0740974
748 nmdc:mga03683_25165_c1
749 nmdc:mga03683_440_c1
750 nmdc:mga00v17_13448_c1
751 nmdc:mga00v17_32548_c1
752 nmdc:mga0yw44_112145_c1
753 nmdc:mga0k408_240474_c1
754 nmdc:mga0k408_492677_c1
755 nmdc:mga06z11_588_c1
756 nmdc:mga04h51_80_c1
757 nmdc:mga07m45_100113_c1
758 nmdc:mga07m45_15416_c1
759 nmdc:mga07m45_252051_c1
760 nmdc:mga07m45_40299_c1
761 nmdc:mga07m45_411616_c1
762 nmdc:mga09592_126228_c1
763 nmdc:mga0sz30_62096_c2
764 nmdc:mga0sz30_669_c1
765 Ga0495601_0061155
766 Ga0495612_0054691
767 Ga0495619_0500793
768 Ga0500643_000922
769 Ga0500651_0475645
770 Ga0500562_114413
771 Ga0500607_001611
772 Ga0500559_0000747
773 Ga0500559_0003876
774 Ga0500568_0019714
775 Ga0500568_0056162
776 Ga0500616_0006255
777 Ga0500645_006678
778 Ga0500609_000259
779 Ga0500661_000178
780 Ga0501082_0002256
781 2509374943
782 2516205949
783 2535486421
784 2585258811
785 2600200932
786 2644530273
787 2753765256
788 2819554366
789 2830075978
790 2852388797
791 2854913393
792 2858438831
793 8046773014
794 8057582060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01641

SelR

SelR domain

30

150

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cto-assembly1.cif.gz_A staphylococcus aureus msrb 0.9727 12 140
7cto-assembly5.cif.gz_E staphylococcus aureus msrb 0.9705 12 139
6q9v-assembly1.cif.gz_A msrb3 0.9632 9 129
3e0o-assembly2.cif.gz_A crystal structure of msrb 0.9615 9 144
5fa9-assembly1.cif.gz_A bifunctional methionine sulfoxide reductase ab (msrab) from treponema denticola 0.9597 2 146
ID Description Score Start End Superfamily
af_P34436_5_152_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9831 14 129 2.170.150.20
3e0oC00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9538 9 144 2.170.150.20
af_I6YA00_1_135_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9475 9 129 2.170.150.20
3cezB00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.937 3 129 2.170.150.20
af_Q8BU85_97_242_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9361 5 137 2.170.150.20
ID Description Score Start End GO Terms
AF-I3X3Q3-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9886 3 147 GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-A0A0Q4JUB7-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9872 1 147 GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-A0A4P8ELG7-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9867 2 145 GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-A0A537P0G7-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 0.9867 22 144 GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-A0A2D7ZEL2-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 0.9859 18 147 GO:0005737
GO:0006979
GO:0030091
GO:0033743

Map