F433883

General Info

Members Datasets Scaffolds Average Seq Length
397 242 794 152

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0897263|Ga0501071_0897263_75_557
Length 146
Sequence MARAARAPQKLIGKELTVGEVAERSGVAVSAIHFYESKGLIRSWRTSGNQRRYPRDVLRRVAVIEALKSLPASHTPTAKDWGLLSRRWRTELDKRISRLTKLRDGLTTCIGCGCLSLDACLLCNPGDRCAQDGPGPQLLDPDLINE

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
58 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
59 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
94 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
95 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
117 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
118 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
119 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
120 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
121 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
122 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
136 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
137 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
188 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
189 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
191 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
192 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
193 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
194 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
195 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
196 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
197 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
198 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
199 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
200 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
201 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
202 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
203 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
204 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
205 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
206 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
207 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
208 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
209 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
210 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
211 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
212 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
213 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
214 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
215 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
216 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
217 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
218 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
219 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
220 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
221 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
222 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
223 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
224 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
225 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
226 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
227 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
228 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
229 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
230 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
231 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
232 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
233 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
234 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
235 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
236 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
237 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
238 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
239 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
240 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
241 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
242 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.65
Metatranscriptomes 0.25
Isolates 13.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.31
Nodule 2.02
Rhizoplane 3.27
Rhizosphere 66.75
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0897263 3300049587 Bacteria 684
2 JGI24740J21852_10000066 3300001979 Bacteria 34178
3 JGI25156J39149_1000033 3300002705 Bacteria 114688
4 JGI25162J39368_1002132 3300002737 Bacteria 8355
5 JGI25154J39366_1000058 3300002738 Bacteria 107363
6 JGI25154J39366_1001551 3300002738 Bacteria 7965
7 JGI25157J39369_1000009 3300002741 Bacteria 207868
8 JGI25406J46586_10020623 3300003203 Bacteria 2661
9 JGI25165J46597_1000949 3300003214 Bacteria 19837
10 Ga0055538_1000213 3300003751 Bacteria 33710
11 Ga0055539_1000257 3300003752 Bacteria 33710
12 Ga0055533_1000249 3300003756 Bacteria 33710
13 Ga0055532_1000273 3300003758 Bacteria 33706
14 Ga0055525_1000344 3300003759 Bacteria 33710
15 Ga0055535_1005730 3300003761 Bacteria 2657
16 Ga0055540_1000014 3300003792 Bacteria 234171
17 Ga0055531_10012241 3300003794 Bacteria 4052
18 Ga0055541_1000155 3300003841 Bacteria 33710
19 Ga0058692_1027188 3300003856 Bacteria 1117
20 Ga0065714_10002505 3300005288 Bacteria 22372
21 Ga0065714_10067698 3300005288 Bacteria 5246
22 Ga0065704_10092709 3300005289 Bacteria 2630
23 Ga0065704_10343378 3300005289 Bacteria 820
24 Ga0065712_10082889 3300005290 Bacteria 2877
25 Ga0070658_10546442 3300005327 Bacteria 1002
26 Ga0070670_100001032 3300005331 Bacteria 22056
27 Ga0070670_100007654 3300005331 Bacteria 9179
28 Ga0070661_100002287 3300005344 Bacteria 13159
29 Ga0070661_100359977 3300005344 Bacteria 1143
30 Ga0070669_100006394 3300005353 Bacteria 8482
31 Ga0070714_100001026 3300005435 Bacteria 19915
32 Ga0070662_100019335 3300005457 Bacteria 4623
33 Ga0070679_100099898 3300005530 Bacteria 2889
34 Ga0068853_100190232 3300005539 Bacteria 1864
35 Ga0070665_101061971 3300005548 Bacteria 822
36 Ga0070664_100003234 3300005564 Bacteria 13166
37 Ga0068854_100378698 3300005578 Bacteria 1165
38 Ga0068856_100014036 3300005614 Bacteria 7746
39 Ga0068851_10000251 3300005834 Bacteria 25318
40 Ga0081539_10000753 3300005985 Bacteria 64323
41 Ga0070717_10428079 3300006028 Bacteria 1191
42 Ga0075364_10231539 3300006051 Bacteria 1255
43 Ga0079104_1000013 3300006946 Bacteria 349477
44 Ga0105251_10001024 3300009011 Bacteria 24532
45 Ga0105251_10007444 3300009011 Bacteria 6744
46 Ga0105251_10009580 3300009011 Bacteria 5707
47 Ga0105244_10002693 3300009036 Bacteria 13288
48 Ga0105244_10002737 3300009036 Bacteria 13163
49 Ga0105244_10128590 3300009036 Bacteria 1223
50 Ga0105250_10000232 3300009092 Bacteria 46504
51 Ga0105250_10013342 3300009092 Bacteria 3384
52 Ga0105250_10053610 3300009092 Bacteria 1618
53 Ga0105242_10005974 3300009176 Bacteria 9389
54 Ga0105237_10006374 3300009545 Bacteria 13100
55 Ga0105237_10804029 3300009545 Bacteria 947
56 Ga0105246_10000304 3300011119 Bacteria 25989
57 Ga0105246_10017181 3300011119 Bacteria 4595
58 Ga0157373_10005442 3300013100 Bacteria 9563
59 Ga0157373_10006919 3300013100 Bacteria 8442
60 Ga0157373_10011552 3300013100 Bacteria 6490
61 Ga0157373_10032497 3300013100 Bacteria 3756
62 Ga0157373_10081493 3300013100 Bacteria 2281
63 Ga0157373_10176694 3300013100 Bacteria 1503
64 Ga0157373_10438454 3300013100 Bacteria 939
65 Ga0157373_11168941 3300013100 Bacteria 579
66 Ga0157371_10104720 3300013102 Bacteria 2008
67 Ga0157370_10013547 3300013104 Bacteria 8393
68 Ga0157370_10196421 3300013104 Bacteria 1872
69 Ga0157369_10002940 3300013105 Bacteria 20374
70 Ga0157369_10017481 3300013105 Bacteria 8058
71 Ga0157369_10333134 3300013105 Bacteria 1577
72 Ga0157369_10439001 3300013105 Bacteria 1352
73 Ga0163162_10115389 3300013306 Bacteria 2785
74 Ga0163162_10185292 3300013306 Bacteria 2208
75 Ga0163162_10512884 3300013306 Bacteria 1329
76 Ga0157375_10001580 3300013308 Bacteria 19586
77 Ga0157375_10010777 3300013308 Bacteria 8053
78 Ga0157375_10117388 3300013308 Bacteria 2766
79 Ga0182008_10006061 3300014497 Bacteria 6800
80 Ga0182008_10042053 3300014497 Bacteria 2277
81 Ga0182008_10134902 3300014497 Bacteria 1232
82 Ga0182008_10329975 3300014497 Bacteria 805
83 Ga0182006_1002014 3300015261 Bacteria 11433
84 Ga0182007_10003193 3300015262 Bacteria 7827
85 Ga0182005_1003871 3300015265 Bacteria 4965
86 Ga0163161_10005654 3300017792 Bacteria 8670
87 Ga0163161_10009883 3300017792 Bacteria 6609
88 Ga0163161_10013036 3300017792 Bacteria 5776
89 Ga0163161_10063152 3300017792 Bacteria 2699
90 Ga0163161_10771061 3300017792 Bacteria 806
91 Ga0163161_10909407 3300017792 Bacteria 746
92 Ga0163161_11143939 3300017792 Bacteria 671
93 Ga0206354_10972168 3300020081 Bacteria 568
94 Ga0213873_10025847 3300021358 Bacteria 1421
95 Ga0209435_100009 3300025206 Bacteria 476614
96 Ga0209784_100040 3300025224 Bacteria 231812
97 Ga0209566_100051 3300025225 Bacteria 231920
98 Ga0209674_100072 3300025226 Bacteria 231812
99 Ga0209672_113040 3300025228 Bacteria 1011
100 Ga0209147_100067 3300025229 Bacteria 231812
101 Ga0209563_100073 3300025230 Bacteria 231920
102 Ga0209437_100057 3300025233 Bacteria 362922
103 Ga0209258_100549 3300025242 Bacteria 33794
104 Ga0209646_1000018 3300025246 Bacteria 476716
105 Ga0209646_1000536 3300025246 Bacteria 16520
106 Ga0209026_1000068 3300025250 Bacteria 207601
107 Ga0209677_100063 3300025253 Bacteria 151440
108 Ga0209148_1005181 3300025254 Bacteria 3041
109 Ga0209759_1000007 3300025256 Bacteria 476614
110 Ga0209759_1003916 3300025256 Bacteria 5742
111 Ga0209233_1000134 3300025261 Bacteria 202535
112 Ga0209565_1026412 3300025263 Bacteria 1164
113 Ga0209455_1041517 3300025272 Bacteria 696
114 Ga0209675_1014756 3300025291 Bacteria 2361
115 Ga0209050_1000142 3300025298 Bacteria 172356
116 Ga0209050_1003324 3300025298 Bacteria 12007
117 Ga0209256_1000130 3300025299 Bacteria 163227
118 Ga0209051_1000035 3300025303 Bacteria 346999
119 Ga0209257_1000212 3300025304 Bacteria 138478
120 Ga0207656_10000094 3300025321 Bacteria 33269
121 Ga0207696_1000399 3300025711 Bacteria 40570
122 Ga0207696_1010826 3300025711 Bacteria 3323
123 Ga0207655_1000269 3300025728 Bacteria 81483
124 Ga0207655_1005395 3300025728 Bacteria 8704
125 Ga0207655_1090350 3300025728 Bacteria 1079
126 Ga0207713_1002183 3300025735 Bacteria 14508
127 Ga0207713_1003030 3300025735 Bacteria 11720
128 Ga0207705_10289865 3300025909 Bacteria 1254
129 Ga0207671_10004586 3300025914 Bacteria 13128
130 Ga0207649_10001596 3300025920 Bacteria 13186
131 Ga0207681_10002725 3300025923 Bacteria 11187
132 Ga0207650_10000419 3300025925 Bacteria 37719
133 Ga0207650_10001093 3300025925 Bacteria 20031
134 Ga0207664_10104040 3300025929 Bacteria 2350
135 Ga0207706_10000668 3300025933 Bacteria 36073
136 Ga0207679_10000018 3300025945 Bacteria 238375
137 Ga0207639_10076669 3300026041 Bacteria 2633
138 Ga0209281_1000182 3300027111 Bacteria 145698
139 Ga0209371_1008135 3300027312 Bacteria 3533
140 Ga0268256_1008418 3300030500 Bacteria 3533
141 Ga0307509_10126683 3300031507 Bacteria 2518
142 Ga0307405_10000437 3300031731 Bacteria 15616
143 Ga0307413_10136227 3300031824 Bacteria 1689
144 Ga0307413_10917551 3300031824 Bacteria 745
145 Ga0307410_10309230 3300031852 Bacteria 1250
146 Ga0307410_11638346 3300031852 Bacteria 569
147 Ga0307406_10338754 3300031901 Bacteria 1171
148 Ga0307409_100293219 3300031995 Bacteria 1509
149 Ga0307409_100487206 3300031995 Bacteria 1198
150 Ga0307409_100935309 3300031995 Bacteria 882
151 Ga0307416_100165456 3300032002 Bacteria 2051
152 Ga0307416_100770549 3300032002 Bacteria 1056
153 Ga0307414_10054365 3300032004 Bacteria 2798
154 Ga0307415_100119796 3300032126 Bacteria 1971
155 Ga0373923_0361000 3300035111 Bacteria 695
156 Ga0373937_0030595 3300036401 Bacteria 4875
157 Ga0395899_0392576 3300037312 Bacteria 920
158 Ga0395900_0448165 3300037418 Bacteria 1247
159 Ga0395898_1654367 3300037466 Bacteria 564
160 Ga0395905_1003961 3300037471 Bacteria 738
161 Ga0395901_0031753 3300038443 Bacteria 5445
162 Ga0395901_0468731 3300038443 Bacteria 1286
163 Ga0237819_00059 3300038705 Bacteria 38407
164 Ga0436360_0112997 3300039438 Unclassified 747
165 Ga0436361_0571302 3300039447 Bacteria 101663
166 Ga0436361_0598291 3300039447 Bacteria 1438
167 Ga0436361_1153888 3300039447 Bacteria 1507
168 Ga0436362_0424983 3300039453 Bacteria 1724
169 Ga0439447_015204 3300041407 Bacteria 2140
170 Ga0451833_0976501 3300041491 Bacteria 1345
171 Ga0439432_000155 3300042006 Bacteria 23280
172 Ga0439463_015527 3300042016 Bacteria 1883
173 Ga0450911_008142 3300042115 Bacteria 1499
174 Ga0450898_009353 3300042134 Bacteria 1566
175 Ga0439464_0003291 3300042439 Bacteria 4064
176 Ga0466969_0244513 3300044656 Bacteria 814
177 Ga0466969_0275699 3300044656 Bacteria 762
178 Ga0466965_0078223 3300044683 Bacteria 1671
179 Ga0466965_0155263 3300044683 Bacteria 1198
180 Ga0466965_0368195 3300044683 Bacteria 790
181 Ga0466966_0143477 3300044684 Bacteria 1458
182 Ga0466966_0186295 3300044684 Bacteria 1258
183 Ga0466966_0407189 3300044684 Bacteria 817
184 Ga0466961_0159855 3300044693 Bacteria 1404
185 Ga0466961_0245049 3300044693 Bacteria 1101
186 Ga0466961_0325471 3300044693 Bacteria 937
187 Ga0466963_0128964 3300044694 Bacteria 1746
188 Ga0466963_0177671 3300044694 Bacteria 1486
189 Ga0466963_0508466 3300044694 Bacteria 851
190 Ga0466963_0510169 3300044694 Bacteria 849
191 Ga0466963_0565576 3300044694 Bacteria 803
192 Ga0466964_0204142 3300044706 Bacteria 951
193 Ga0466964_0611930 3300044706 Bacteria 599
194 Ga0466970_0174462 3300044765 Bacteria 1192
195 Ga0466970_0381983 3300044765 Bacteria 802
196 Ga0466957_0010880 3300044842 Bacteria 5233
197 Ga0466957_0198292 3300044842 Bacteria 1317
198 Ga0466957_0326269 3300044842 Bacteria 1037
199 Ga0466957_0363777 3300044842 Bacteria 984
200 Ga0466957_0652833 3300044842 Bacteria 740
201 Ga0466957_0773667 3300044842 Bacteria 681
202 Ga0466960_0069136 3300044901 Bacteria 1754
203 Ga0466959_0167923 3300045049 Bacteria 1540
204 Ga0466959_0592429 3300045049 Bacteria 746
205 Ga0466958_0038841 3300045836 Bacteria 2857
206 Ga0466958_0077511 3300045836 Bacteria 2041
207 Ga0466958_0382816 3300045836 Bacteria 907
208 Ga0466958_0673894 3300045836 Bacteria 673
209 Ga0466958_1112440 3300045836 Bacteria 516
210 Ga0466967_0008817 3300045976 Bacteria 7433
211 Ga0466967_0034519 3300045976 Bacteria 4294
212 Ga0466967_0231552 3300045976 Bacteria 1759
213 Ga0466967_0336117 3300045976 Bacteria 1460
214 Ga0466967_0402650 3300045976 Bacteria 1332
215 Ga0466967_0420330 3300045976 Bacteria 1303
216 Ga0466967_1411712 3300045976 Bacteria 693
217 Ga0466967_1909643 3300045976 Bacteria 591
218 Ga0495627_002540 3300046453 Bacteria 8672
219 Ga0495627_036430 3300046453 Bacteria 1529
220 Ga0495591_006134 3300046458 Bacteria 5387
221 Ga0495591_032588 3300046458 Bacteria 1549
222 Ga0495605_0000090 3300046474 Bacteria 116120
223 Ga0495605_0000124 3300046474 Bacteria 101623
224 Ga0495607_0000284 3300046501 Bacteria 54384
225 Ga0495607_0007597 3300046501 Bacteria 7476
226 Ga0495607_0042450 3300046501 Bacteria 2695
227 Ga0495583_0001138 3300046506 Bacteria 29014
228 Ga0495583_0005174 3300046506 Bacteria 8983
229 Ga0495583_0012138 3300046506 Bacteria 4899
230 Ga0495606_0002509 3300046507 Bacteria 21176
231 Ga0495606_0549882 3300046507 Bacteria 574
232 Ga0495610_0004282 3300046512 Bacteria 10618
233 Ga0495610_0014339 3300046512 Bacteria 4661
234 Ga0495610_0087561 3300046512 Bacteria 1417
235 Ga0495610_0140956 3300046512 Bacteria 1037
236 Ga0495610_0181325 3300046512 Bacteria 876
237 Ga0495610_0376117 3300046512 Bacteria 529
238 Ga0495620_0000589 3300046515 Bacteria 22745
239 Ga0495620_0001505 3300046515 Bacteria 13874
240 Ga0495620_0010740 3300046515 Bacteria 4816
241 Ga0495620_0013303 3300046515 Bacteria 4219
242 Ga0495620_0116561 3300046515 Bacteria 1055
243 Ga0495632_0010829 3300046519 Bacteria 5364
244 Ga0495637_0013932 3300046520 Bacteria 3806
245 Ga0495637_0102862 3300046520 Bacteria 1114
246 Ga0495648_0093461 3300046524 Bacteria 1677
247 Ga0495663_0002968 3300046525 Bacteria 4989
248 Ga0495654_0000478 3300046530 Bacteria 33081
249 Ga0495654_0015214 3300046530 Bacteria 4089
250 Ga0495654_0017705 3300046530 Bacteria 3739
251 Ga0495654_0022235 3300046530 Bacteria 3294
252 Ga0495654_0105846 3300046530 Bacteria 1289
253 Ga0495654_0125763 3300046530 Bacteria 1155
254 Ga0495609_0026950 3300046538 Bacteria 2628
255 Ga0495633_0000328 3300046558 Bacteria 53654
256 Ga0495668_0014580 3300046616 Bacteria 4603
257 Ga0495668_0339772 3300046616 Bacteria 824
258 Ga0495611_0263068 3300046648 Bacteria 798
259 Ga0495661_0000288 3300046665 Bacteria 57108
260 Ga0495661_0006430 3300046665 Bacteria 8262
261 Ga0495661_0011031 3300046665 Bacteria 6138
262 Ga0495649_0100957 3300046694 Bacteria 1533
263 Ga0495589_0177358 3300046794 Bacteria 1011
264 Ga0495660_0007452 3300046810 Bacteria 6423
265 Ga0495660_0240017 3300046810 Bacteria 845
266 Ga0495660_0329346 3300046810 Bacteria 684
267 Ga0495672_0098297 3300047320 Bacteria 1592
268 Ga0495680_0178900 3300047322 Bacteria 1532
269 Ga0495679_003360 3300047446 Bacteria 7727
270 Ga0495679_027783 3300047446 Bacteria 1861
271 Ga0495679_072299 3300047446 Bacteria 991
272 Ga0495673_0002313 3300047469 Bacteria 13627
273 Ga0495673_0005769 3300047469 Bacteria 7419
274 Ga0495673_0138799 3300047469 Bacteria 949
275 Ga0495681_0013711 3300047470 Bacteria 4688
276 Ga0495681_0140353 3300047470 Bacteria 1021
277 Ga0496102_0157657 3300048905 Bacteria 2134
278 Ga0496114_0005455 3300048917 Bacteria 9947
279 Ga0496116_0106907 3300048919 Bacteria 1655
280 Ga0496116_0257490 3300048919 Bacteria 863
281 Ga0496117_0003912 3300048920 Bacteria 16865
282 Ga0496117_0014979 3300048920 Bacteria 6643
283 Ga0496117_0034545 3300048920 Bacteria 3807
284 Ga0496117_0064346 3300048920 Bacteria 2501
285 Ga0496117_0112795 3300048920 Bacteria 1689
286 Ga0496118_0015308 3300048921 Bacteria 7109
287 Ga0496118_0034815 3300048921 Bacteria 4101
288 Ga0496118_0074562 3300048921 Bacteria 2424
289 Ga0496118_0087164 3300048921 Bacteria 2166
290 Ga0496118_0111630 3300048921 Bacteria 1812
291 Ga0496119_0011624 3300048922 Bacteria 7257
292 Ga0496119_0084456 3300048922 Bacteria 1820
293 Ga0496120_0024888 3300048923 Bacteria 3724
294 Ga0496120_0034510 3300048923 Bacteria 3029
295 Ga0496121_0035262 3300048924 Bacteria 4487
296 Ga0496121_0068090 3300048924 Bacteria 2882
297 Ga0496121_0129494 3300048924 Bacteria 1891
298 Ga0496121_0351123 3300048924 Bacteria 982
299 Ga0496122_0010344 3300048925 Bacteria 9644
300 Ga0496122_0038065 3300048925 Bacteria 3860
301 Ga0496122_0118984 3300048925 Bacteria 1709
302 Ga0496122_0120083 3300048925 Bacteria 1697
303 Ga0496123_0031931 3300048926 Bacteria 3822
304 Ga0496123_0094150 3300048926 Bacteria 1766
305 Ga0496123_0119386 3300048926 Bacteria 1487
306 Ga0496123_0146383 3300048926 Bacteria 1282
307 Ga0496124_0000004 3300048927 Bacteria 976131
308 Ga0496124_0000292 3300048927 Bacteria 94018
309 Ga0496124_0004218 3300048927 Bacteria 16920
310 Ga0496124_0013631 3300048927 Bacteria 7925
311 Ga0496124_0089075 3300048927 Bacteria 2520
312 Ga0496124_0224836 3300048927 Bacteria 1408
313 Ga0496124_0256325 3300048927 Bacteria 1290
314 Ga0496124_0292056 3300048927 Bacteria 1182
315 Ga0496124_0482481 3300048927 Bacteria 836
316 Ga0496125_0003931 3300048928 Bacteria 17527
317 Ga0496125_0004542 3300048928 Bacteria 15930
318 Ga0496125_0018130 3300048928 Bacteria 6691
319 Ga0496125_0124155 3300048928 Bacteria 1834
320 Ga0496125_0164472 3300048928 Bacteria 1501
321 Ga0496126_0067384 3300048929 Bacteria 3198
322 Ga0496126_0092977 3300048929 Bacteria 2648
323 Ga0496126_0140700 3300048929 Bacteria 2077
324 Ga0496126_0564140 3300048929 Bacteria 901
325 Ga0501034_0496404 3300049571 Bacteria 1134
326 Ga0501036_0051228 3300049572 Bacteria 3495
327 Ga0501036_0698625 3300049572 Bacteria 838
328 Ga0501037_0053274 3300049573 Bacteria 2959
329 Ga0501038_0019004 3300049574 Bacteria 6201
330 Ga0501038_0397670 3300049574 Bacteria 1066
331 Ga0501039_0074181 3300049575 Bacteria 2644
332 Ga0501042_0018771 3300049578 Bacteria 4793
333 Ga0501043_0002108 3300049579 Bacteria 16979
334 Ga0501047_0008380 3300049581 Bacteria 9758
335 Ga0501048_0005805 3300049582 Bacteria 9389
336 Ga0501073_0027664 3300049589 Bacteria 4053
337 Ga0501074_0002820 3300049590 Bacteria 12163
338 Ga0501044_0149731 3300049823 Bacteria 2316
339 Ga0501044_0334957 3300049823 Bacteria 1435
340 Ga0501045_0923845 3300049824 Bacteria 641
341 Ga0501226_000006 3300049853 Bacteria 259153
342 Ga0500624_051811 3300053157 Bacteria 765
343 Ga0500634_0010006 3300053161 Bacteria 4828
344 Ga0466962_0245214 3300061719 Bacteria 880
345 Ga0466962_0562721 3300061719 Bacteria 579
346 2510839844 2510461069 Bacteria 5505000
347 2597868980 2597489889 Bacteria 6297495
348 2599101926 2597490356 Bacteria 7030811
349 2599401772 2599185167 Bacteria 6353609
350 2599451583 2599185179 Bacteria 6611171
351 2599509466 2599185189 Bacteria 5862825
352 2599515016 2599185190 Bacteria 6285678
353 2599521117 2599185191 Bacteria 6297582
354 2599882339 2599185288 Bacteria 6666191
355 2599894183 2599185290 Bacteria 6289611
356 2599952286 2599185303 Bacteria 6512725
357 2601694097 2600255296 Bacteria 5784754
358 2616557683 2615840698 Bacteria 7319877
359 2643870729 2643221571 Bacteria 6228673
360 2644243817 2643221644 Bacteria 6865017
361 2644622989 2643221713 Bacteria 6554480
362 2671113577 2667528174 Bacteria 6435400
363 2677900952 2675903420 Bacteria 6247433
364 2723248017 2721755607 Bacteria 5841722
365 2738688639 2738541271 Bacteria 5657310
366 2738812241 2738541294 Bacteria 6925949
367 2738899601 2738541309 Bacteria 6926455
368 2739265049 2738543016 Bacteria 5657564
369 2819611144 2818991448 Bacteria 6772224
370 2823424739 2823421272 Bacteria 5372474
371 2834029841 2834028612 Bacteria 6354979
372 2838030833 2838029111 Bacteria 6603031
373 2842477565 2842475841 Bacteria 6603183
374 2842504562 2842502639 Bacteria 6604161
375 2842831104 2842826826 Bacteria 5974129
376 2842843328 2842837860 Bacteria 6066181
377 2842875315 2842871566 Bacteria 4827117
378 2846958072 2846952575 Bacteria 6587527
379 2848864865 2848858292 Bacteria 7391279
380 2908448795 2908446538 Bacteria 6829095
381 2908671602 2908669403 Bacteria 5740494
382 2919410966 2919408235 Bacteria 6149349
383 2929191807 2929189879 Bacteria 5930554
384 2931392911 2931390751 Bacteria 6273349
385 2945928750 2945928738 Bacteria 6053221
386 2945964962 2945961074 Bacteria 7342064
387 2946010933 2946006987 Bacteria 6705746
388 2947236667 2947233263 Bacteria 6439278
389 3005421732 3005416602 Bacteria 7064308
390 8005319568 8005314921 Bacteria 7072929
391 8005490196 8005484373 Bacteria 6297373
392 8005646854 8005645114 Bacteria 6950293
393 8054287586 8054285046 Bacteria 6919322
394 8054349069 8054347763 Bacteria 5901107
395 8055819982 8055817908 Bacteria 6609162
396 8056151035 8056148874 Bacteria 6479865
397 8056165163 8056161164 Bacteria 6106669
398 Ga0501071_0897263
399 JGI24740J21852_10000066
400 JGI25156J39149_1000033
401 JGI25162J39368_1002132
402 JGI25154J39366_1000058
403 JGI25154J39366_1001551
404 JGI25157J39369_1000009
405 JGI25406J46586_10020623
406 JGI25165J46597_1000949
407 Ga0055538_1000213
408 Ga0055539_1000257
409 Ga0055533_1000249
410 Ga0055532_1000273
411 Ga0055525_1000344
412 Ga0055535_1005730
413 Ga0055540_1000014
414 Ga0055531_10012241
415 Ga0055541_1000155
416 Ga0058692_1027188
417 Ga0065714_10002505
418 Ga0065714_10067698
419 Ga0065704_10092709
420 Ga0065704_10343378
421 Ga0065712_10082889
422 Ga0070658_10546442
423 Ga0070670_100001032
424 Ga0070670_100007654
425 Ga0070661_100002287
426 Ga0070661_100359977
427 Ga0070669_100006394
428 Ga0070714_100001026
429 Ga0070662_100019335
430 Ga0070679_100099898
431 Ga0068853_100190232
432 Ga0070665_101061971
433 Ga0070664_100003234
434 Ga0068854_100378698
435 Ga0068856_100014036
436 Ga0068851_10000251
437 Ga0081539_10000753
438 Ga0070717_10428079
439 Ga0075364_10231539
440 Ga0079104_1000013
441 Ga0105251_10001024
442 Ga0105251_10007444
443 Ga0105251_10009580
444 Ga0105244_10002693
445 Ga0105244_10002737
446 Ga0105244_10128590
447 Ga0105250_10000232
448 Ga0105250_10013342
449 Ga0105250_10053610
450 Ga0105242_10005974
451 Ga0105237_10006374
452 Ga0105237_10804029
453 Ga0105246_10000304
454 Ga0105246_10017181
455 Ga0157373_10005442
456 Ga0157373_10006919
457 Ga0157373_10011552
458 Ga0157373_10032497
459 Ga0157373_10081493
460 Ga0157373_10176694
461 Ga0157373_10438454
462 Ga0157373_11168941
463 Ga0157371_10104720
464 Ga0157370_10013547
465 Ga0157370_10196421
466 Ga0157369_10002940
467 Ga0157369_10017481
468 Ga0157369_10333134
469 Ga0157369_10439001
470 Ga0163162_10115389
471 Ga0163162_10185292
472 Ga0163162_10512884
473 Ga0157375_10001580
474 Ga0157375_10010777
475 Ga0157375_10117388
476 Ga0182008_10006061
477 Ga0182008_10042053
478 Ga0182008_10134902
479 Ga0182008_10329975
480 Ga0182006_1002014
481 Ga0182007_10003193
482 Ga0182005_1003871
483 Ga0163161_10005654
484 Ga0163161_10009883
485 Ga0163161_10013036
486 Ga0163161_10063152
487 Ga0163161_10771061
488 Ga0163161_10909407
489 Ga0163161_11143939
490 Ga0206354_10972168
491 Ga0213873_10025847
492 Ga0209435_100009
493 Ga0209784_100040
494 Ga0209566_100051
495 Ga0209674_100072
496 Ga0209672_113040
497 Ga0209147_100067
498 Ga0209563_100073
499 Ga0209437_100057
500 Ga0209258_100549
501 Ga0209646_1000018
502 Ga0209646_1000536
503 Ga0209026_1000068
504 Ga0209677_100063
505 Ga0209148_1005181
506 Ga0209759_1000007
507 Ga0209759_1003916
508 Ga0209233_1000134
509 Ga0209565_1026412
510 Ga0209455_1041517
511 Ga0209675_1014756
512 Ga0209050_1000142
513 Ga0209050_1003324
514 Ga0209256_1000130
515 Ga0209051_1000035
516 Ga0209257_1000212
517 Ga0207656_10000094
518 Ga0207696_1000399
519 Ga0207696_1010826
520 Ga0207655_1000269
521 Ga0207655_1005395
522 Ga0207655_1090350
523 Ga0207713_1002183
524 Ga0207713_1003030
525 Ga0207705_10289865
526 Ga0207671_10004586
527 Ga0207649_10001596
528 Ga0207681_10002725
529 Ga0207650_10000419
530 Ga0207650_10001093
531 Ga0207664_10104040
532 Ga0207706_10000668
533 Ga0207679_10000018
534 Ga0207639_10076669
535 Ga0209281_1000182
536 Ga0209371_1008135
537 Ga0268256_1008418
538 Ga0307509_10126683
539 Ga0307405_10000437
540 Ga0307413_10136227
541 Ga0307413_10917551
542 Ga0307410_10309230
543 Ga0307410_11638346
544 Ga0307406_10338754
545 Ga0307409_100293219
546 Ga0307409_100487206
547 Ga0307409_100935309
548 Ga0307416_100165456
549 Ga0307416_100770549
550 Ga0307414_10054365
551 Ga0307415_100119796
552 Ga0373923_0361000
553 Ga0373937_0030595
554 Ga0395899_0392576
555 Ga0395900_0448165
556 Ga0395898_1654367
557 Ga0395905_1003961
558 Ga0395901_0031753
559 Ga0395901_0468731
560 Ga0237819_00059
561 Ga0436360_0112997
562 Ga0436361_0571302
563 Ga0436361_0598291
564 Ga0436361_1153888
565 Ga0436362_0424983
566 Ga0439447_015204
567 Ga0451833_0976501
568 Ga0439432_000155
569 Ga0439463_015527
570 Ga0450911_008142
571 Ga0450898_009353
572 Ga0439464_0003291
573 Ga0466969_0244513
574 Ga0466969_0275699
575 Ga0466965_0078223
576 Ga0466965_0155263
577 Ga0466965_0368195
578 Ga0466966_0143477
579 Ga0466966_0186295
580 Ga0466966_0407189
581 Ga0466961_0159855
582 Ga0466961_0245049
583 Ga0466961_0325471
584 Ga0466963_0128964
585 Ga0466963_0177671
586 Ga0466963_0508466
587 Ga0466963_0510169
588 Ga0466963_0565576
589 Ga0466964_0204142
590 Ga0466964_0611930
591 Ga0466970_0174462
592 Ga0466970_0381983
593 Ga0466957_0010880
594 Ga0466957_0198292
595 Ga0466957_0326269
596 Ga0466957_0363777
597 Ga0466957_0652833
598 Ga0466957_0773667
599 Ga0466960_0069136
600 Ga0466959_0167923
601 Ga0466959_0592429
602 Ga0466958_0038841
603 Ga0466958_0077511
604 Ga0466958_0382816
605 Ga0466958_0673894
606 Ga0466958_1112440
607 Ga0466967_0008817
608 Ga0466967_0034519
609 Ga0466967_0231552
610 Ga0466967_0336117
611 Ga0466967_0402650
612 Ga0466967_0420330
613 Ga0466967_1411712
614 Ga0466967_1909643
615 Ga0495627_002540
616 Ga0495627_036430
617 Ga0495591_006134
618 Ga0495591_032588
619 Ga0495605_0000090
620 Ga0495605_0000124
621 Ga0495607_0000284
622 Ga0495607_0007597
623 Ga0495607_0042450
624 Ga0495583_0001138
625 Ga0495583_0005174
626 Ga0495583_0012138
627 Ga0495606_0002509
628 Ga0495606_0549882
629 Ga0495610_0004282
630 Ga0495610_0014339
631 Ga0495610_0087561
632 Ga0495610_0140956
633 Ga0495610_0181325
634 Ga0495610_0376117
635 Ga0495620_0000589
636 Ga0495620_0001505
637 Ga0495620_0010740
638 Ga0495620_0013303
639 Ga0495620_0116561
640 Ga0495632_0010829
641 Ga0495637_0013932
642 Ga0495637_0102862
643 Ga0495648_0093461
644 Ga0495663_0002968
645 Ga0495654_0000478
646 Ga0495654_0015214
647 Ga0495654_0017705
648 Ga0495654_0022235
649 Ga0495654_0105846
650 Ga0495654_0125763
651 Ga0495609_0026950
652 Ga0495633_0000328
653 Ga0495668_0014580
654 Ga0495668_0339772
655 Ga0495611_0263068
656 Ga0495661_0000288
657 Ga0495661_0006430
658 Ga0495661_0011031
659 Ga0495649_0100957
660 Ga0495589_0177358
661 Ga0495660_0007452
662 Ga0495660_0240017
663 Ga0495660_0329346
664 Ga0495672_0098297
665 Ga0495680_0178900
666 Ga0495679_003360
667 Ga0495679_027783
668 Ga0495679_072299
669 Ga0495673_0002313
670 Ga0495673_0005769
671 Ga0495673_0138799
672 Ga0495681_0013711
673 Ga0495681_0140353
674 Ga0496102_0157657
675 Ga0496114_0005455
676 Ga0496116_0106907
677 Ga0496116_0257490
678 Ga0496117_0003912
679 Ga0496117_0014979
680 Ga0496117_0034545
681 Ga0496117_0064346
682 Ga0496117_0112795
683 Ga0496118_0015308
684 Ga0496118_0034815
685 Ga0496118_0074562
686 Ga0496118_0087164
687 Ga0496118_0111630
688 Ga0496119_0011624
689 Ga0496119_0084456
690 Ga0496120_0024888
691 Ga0496120_0034510
692 Ga0496121_0035262
693 Ga0496121_0068090
694 Ga0496121_0129494
695 Ga0496121_0351123
696 Ga0496122_0010344
697 Ga0496122_0038065
698 Ga0496122_0118984
699 Ga0496122_0120083
700 Ga0496123_0031931
701 Ga0496123_0094150
702 Ga0496123_0119386
703 Ga0496123_0146383
704 Ga0496124_0000004
705 Ga0496124_0000292
706 Ga0496124_0004218
707 Ga0496124_0013631
708 Ga0496124_0089075
709 Ga0496124_0224836
710 Ga0496124_0256325
711 Ga0496124_0292056
712 Ga0496124_0482481
713 Ga0496125_0003931
714 Ga0496125_0004542
715 Ga0496125_0018130
716 Ga0496125_0124155
717 Ga0496125_0164472
718 Ga0496126_0067384
719 Ga0496126_0092977
720 Ga0496126_0140700
721 Ga0496126_0564140
722 Ga0501034_0496404
723 Ga0501036_0051228
724 Ga0501036_0698625
725 Ga0501037_0053274
726 Ga0501038_0019004
727 Ga0501038_0397670
728 Ga0501039_0074181
729 Ga0501042_0018771
730 Ga0501043_0002108
731 Ga0501047_0008380
732 Ga0501048_0005805
733 Ga0501073_0027664
734 Ga0501074_0002820
735 Ga0501044_0149731
736 Ga0501044_0334957
737 Ga0501045_0923845
738 Ga0501226_000006
739 Ga0500624_051811
740 Ga0500634_0010006
741 Ga0466962_0245214
742 Ga0466962_0562721
743 2510839844
744 2597868980
745 2599101926
746 2599401772
747 2599451583
748 2599509466
749 2599515016
750 2599521117
751 2599882339
752 2599894183
753 2599952286
754 2601694097
755 2616557683
756 2643870729
757 2644243817
758 2644622989
759 2671113577
760 2677900952
761 2723248017
762 2738688639
763 2738812241
764 2738899601
765 2739265049
766 2819611144
767 2823424739
768 2834029841
769 2838030833
770 2842477565
771 2842504562
772 2842831104
773 2842843328
774 2842875315
775 2846958072
776 2848864865
777 2908448795
778 2908671602
779 2919410966
780 2929191807
781 2931392911
782 2945928750
783 2945964962
784 2946010933
785 2947236667
786 3005421732
787 8005319568
788 8005490196
789 8005646854
790 8054287586
791 8054349069
792 8055819982
793 8056151035
794 8056165163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

17

53

0.99

PF13411

MerR_1

MerR HTH family regulatory protein

16

73

0.97

PF09278

MerR-DNA-bind

MerR, DNA binding

60

109

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v9p-assembly1.cif.gz_A crystal structure of the transposition protein tniq 0.9488 12 40
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.9347 11 76
4r4e-assembly1.cif.gz_B structure of glnr-dna complex 0.92 11 80
4r4e-assembly1.cif.gz_A structure of glnr-dna complex 0.9161 11 80
5c8d-assembly2.cif.gz_E crystal structure of full-length thermus thermophilus carh bound to adenosylcobalamin (dark state) 0.9145 13 81
ID Description Score Start End Superfamily
4r22B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.944 11 80 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9189 12 81 1.10.1660.10
4r4eA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9161 11 80 1.10.1660.10
5i41B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.898 12 72 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8979 12 81 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A526UPY2-F1-model_v4 Redox-sensitive transcriptional activator SoxR 0.9852 29 110 GO:0003677
GO:0003700
GO:0006979
GO:0051537
AF-A0A528CR43-F1-model_v4 Redox-sensitive transcriptional activator SoxR 0.9757 12 87 GO:0003677
GO:0003700
GO:0006979
GO:0051537
AF-A0A4R3MLN0-F1-model_v4 DNA-binding transcriptional MerR regulator 0.9722 11 80 GO:0003677
GO:0003700
GO:0016020
AF-A0A1G8TM52-F1-model_v4 deleted 0.9721 13 115
AF-K7A7C1-F1-model_v4 Transcriptional Regulator, MerR family protein 0.9701 11 90 GO:0003677
GO:0003700

Map