F433889
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 397 | 273 | 388 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_187269_c1|nmdc:mga0k408_187269_c1_271_1002 |
| Length | 215 |
| Sequence | MIFSENRRPLFRIMLWPKACELAKLVASATILNPLAPPASTKIGEILANAVAKPAKGNARLDLFKFVPFRLNRLAAEVSSALSAEYQVRYGLDIPEWRVLATLGFRDHACSAQYIAHCTRTHKSTISRAVTTLMKRQMIERVENADDRREFRLRMTTKGKALYEELIPNLLRREQEILSCLSAQERKNLAALFGKIEASLDLVQTSAEADAKEAY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 3 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 4 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 5 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 6 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 122 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 123 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 126 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 132 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 134 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 135 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 136 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 142 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 143 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 144 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 145 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 146 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 150 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 157 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 161 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 163 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 168 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 169 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 172 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 246 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 254 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 255 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 259 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 262 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 263 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 264 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 265 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 266 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 267 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 268 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 269 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 270 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 271 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 272 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 273 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.73 |
| Metatranscriptomes | 0 |
| Isolates | 2.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.05 |
| Nodule | 2.02 |
| Rhizoplane | 6.3 |
| Rhizosphere | 81.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10081871 | 3300002075 | Bacteria | 676 |
| 2 | JGI25404J52841_10022235 | 3300003659 | Bacteria | 1370 |
| 3 | Ga0065715_10410964 | 3300005293 | Bacteria | 870 |
| 4 | Ga0070670_100592927 | 3300005331 | Bacteria | 991 |
| 5 | Ga0070680_100052242 | 3300005336 | Bacteria | 3336 |
| 6 | Ga0070682_100284369 | 3300005337 | Bacteria | 1207 |
| 7 | Ga0068868_100436140 | 3300005338 | Bacteria | 1137 |
| 8 | Ga0070660_100009783 | 3300005339 | Bacteria | 6755 |
| 9 | Ga0070691_10037778 | 3300005341 | Bacteria | 2279 |
| 10 | Ga0070661_100366139 | 3300005344 | Bacteria | 1134 |
| 11 | Ga0070675_100142286 | 3300005354 | Bacteria | 2051 |
| 12 | Ga0070671_100274233 | 3300005355 | Bacteria | 1434 |
| 13 | Ga0070674_100084727 | 3300005356 | Bacteria | 2273 |
| 14 | Ga0070673_100964629 | 3300005364 | Bacteria | 793 |
| 15 | Ga0070659_100666801 | 3300005366 | Bacteria | 898 |
| 16 | Ga0070714_100313687 | 3300005435 | Bacteria | 1465 |
| 17 | Ga0070713_100038244 | 3300005436 | Bacteria | 3886 |
| 18 | Ga0070713_100351960 | 3300005436 | Bacteria | 1367 |
| 19 | Ga0070700_100073138 | 3300005441 | Bacteria | 2193 |
| 20 | Ga0070700_101049794 | 3300005441 | Bacteria | 673 |
| 21 | Ga0070708_100779930 | 3300005445 | Bacteria | 899 |
| 22 | Ga0070663_100022315 | 3300005455 | Bacteria | 4230 |
| 23 | Ga0070663_100045675 | 3300005455 | Bacteria | 3096 |
| 24 | Ga0070663_100077282 | 3300005455 | Bacteria | 2436 |
| 25 | Ga0070663_100107908 | 3300005455 | Bacteria | 2088 |
| 26 | Ga0070663_100247518 | 3300005455 | Bacteria | 1410 |
| 27 | Ga0070663_100356163 | 3300005455 | Bacteria | 1186 |
| 28 | Ga0070678_100027180 | 3300005456 | Bacteria | 3882 |
| 29 | Ga0070678_100130340 | 3300005456 | Bacteria | 1997 |
| 30 | Ga0070662_100070598 | 3300005457 | Bacteria | 2574 |
| 31 | Ga0070681_10020406 | 3300005458 | Bacteria | 6641 |
| 32 | Ga0070681_10024092 | 3300005458 | Bacteria | 6127 |
| 33 | Ga0068867_100281966 | 3300005459 | Bacteria | 1363 |
| 34 | Ga0068867_100443147 | 3300005459 | Bacteria | 1105 |
| 35 | Ga0070698_100249502 | 3300005471 | Bacteria | 1708 |
| 36 | Ga0070679_100140520 | 3300005530 | Bacteria | 2394 |
| 37 | Ga0070684_100048558 | 3300005535 | Bacteria | 3682 |
| 38 | Ga0070697_101180672 | 3300005536 | Bacteria | 682 |
| 39 | Ga0068853_100007556 | 3300005539 | Bacteria | 8700 |
| 40 | Ga0068853_100252531 | 3300005539 | Bacteria | 1618 |
| 41 | Ga0068853_100406096 | 3300005539 | Bacteria | 1276 |
| 42 | Ga0068853_100467990 | 3300005539 | Bacteria | 1187 |
| 43 | Ga0068853_101003069 | 3300005539 | Bacteria | 804 |
| 44 | Ga0070665_100011218 | 3300005548 | Bacteria | 9061 |
| 45 | Ga0070665_100082768 | 3300005548 | Bacteria | 3214 |
| 46 | Ga0070665_100155855 | 3300005548 | Bacteria | 2286 |
| 47 | Ga0070665_100163739 | 3300005548 | Bacteria | 2226 |
| 48 | Ga0070665_100603409 | 3300005548 | Bacteria | 1111 |
| 49 | Ga0070664_100582413 | 3300005564 | Bacteria | 1037 |
| 50 | Ga0070664_100851413 | 3300005564 | Bacteria | 854 |
| 51 | Ga0068857_100012153 | 3300005577 | Bacteria | 7490 |
| 52 | Ga0068854_100522597 | 3300005578 | Bacteria | 1003 |
| 53 | Ga0068856_101008444 | 3300005614 | Bacteria | 851 |
| 54 | Ga0070702_100109992 | 3300005615 | Bacteria | 1707 |
| 55 | Ga0068852_100049008 | 3300005616 | Bacteria | 3612 |
| 56 | Ga0068852_100243559 | 3300005616 | Bacteria | 1720 |
| 57 | Ga0068852_100453038 | 3300005616 | Bacteria | 1270 |
| 58 | Ga0068859_100052455 | 3300005617 | Bacteria | 4100 |
| 59 | Ga0068859_100194158 | 3300005617 | Bacteria | 2114 |
| 60 | Ga0068864_100665624 | 3300005618 | Bacteria | 1015 |
| 61 | Ga0068861_100085153 | 3300005719 | Bacteria | 2482 |
| 62 | Ga0068861_100689300 | 3300005719 | Bacteria | 948 |
| 63 | Ga0068851_10012271 | 3300005834 | Bacteria | 4035 |
| 64 | Ga0068851_10304449 | 3300005834 | Bacteria | 917 |
| 65 | Ga0068863_100460623 | 3300005841 | Bacteria | 1249 |
| 66 | Ga0068863_101067052 | 3300005841 | Bacteria | 812 |
| 67 | Ga0068858_100171532 | 3300005842 | Bacteria | 2045 |
| 68 | Ga0068858_100279545 | 3300005842 | Bacteria | 1589 |
| 69 | Ga0068858_100708057 | 3300005842 | Bacteria | 980 |
| 70 | Ga0068858_100827283 | 3300005842 | Bacteria | 904 |
| 71 | Ga0068862_100243746 | 3300005844 | Bacteria | 1635 |
| 72 | Ga0068862_100465977 | 3300005844 | Bacteria | 1193 |
| 73 | Ga0081538_10048665 | 3300005981 | Bacteria | 2581 |
| 74 | Ga0081538_10056728 | 3300005981 | Bacteria | 2291 |
| 75 | Ga0081540_1003142 | 3300005983 | Bacteria | 13197 |
| 76 | Ga0081540_1006347 | 3300005983 | Bacteria | 8636 |
| 77 | Ga0081540_1032727 | 3300005983 | Bacteria | 2834 |
| 78 | Ga0081540_1047121 | 3300005983 | Bacteria | 2170 |
| 79 | Ga0075365_10281454 | 3300006038 | Bacteria | 1170 |
| 80 | Ga0075363_100003491 | 3300006048 | Bacteria | 6694 |
| 81 | Ga0075364_10091336 | 3300006051 | Bacteria | 2020 |
| 82 | Ga0075432_10238181 | 3300006058 | Bacteria | 734 |
| 83 | Ga0070716_100262730 | 3300006173 | Bacteria | 1182 |
| 84 | Ga0075362_10141874 | 3300006177 | Bacteria | 1148 |
| 85 | Ga0075367_10002314 | 3300006178 | Bacteria | 8656 |
| 86 | Ga0075367_10089310 | 3300006178 | Bacteria | 1873 |
| 87 | Ga0075367_10190850 | 3300006178 | Bacteria | 1278 |
| 88 | Ga0075369_10036501 | 3300006186 | Bacteria | 2091 |
| 89 | Ga0075369_10060624 | 3300006186 | Bacteria | 1650 |
| 90 | Ga0075366_10025892 | 3300006195 | Bacteria | 3431 |
| 91 | Ga0075366_10114107 | 3300006195 | Bacteria | 1627 |
| 92 | Ga0075370_10015254 | 3300006353 | Bacteria | 4109 |
| 93 | Ga0075370_10179793 | 3300006353 | Bacteria | 1244 |
| 94 | Ga0068871_100166607 | 3300006358 | Bacteria | 1887 |
| 95 | Ga0075428_100154775 | 3300006844 | Bacteria | 2491 |
| 96 | Ga0068865_100017682 | 3300006881 | Bacteria | 4589 |
| 97 | Ga0097620_100052457 | 3300006931 | Bacteria | 4100 |
| 98 | Ga0097620_100137735 | 3300006931 | Bacteria | 2515 |
| 99 | Ga0097620_100194183 | 3300006931 | Bacteria | 2114 |
| 100 | Ga0111539_10095400 | 3300009094 | Bacteria | 3493 |
| 101 | Ga0114129_11217745 | 3300009147 | Bacteria | 937 |
| 102 | Ga0105243_10035721 | 3300009148 | Bacteria | 3853 |
| 103 | Ga0105243_10893310 | 3300009148 | Bacteria | 883 |
| 104 | Ga0105241_10303134 | 3300009174 | Bacteria | 1372 |
| 105 | Ga0105242_10187680 | 3300009176 | Bacteria | 1828 |
| 106 | Ga0105242_11430565 | 3300009176 | Bacteria | 720 |
| 107 | Ga0105248_10233854 | 3300009177 | Bacteria | 2069 |
| 108 | Ga0105237_10149559 | 3300009545 | Bacteria | 2331 |
| 109 | Ga0105237_10168697 | 3300009545 | Bacteria | 2188 |
| 110 | Ga0105238_10086651 | 3300009551 | Bacteria | 3119 |
| 111 | Ga0105239_10019844 | 3300010375 | Bacteria | 7417 |
| 112 | Ga0105239_10165739 | 3300010375 | Bacteria | 2470 |
| 113 | Ga0105246_10340721 | 3300011119 | Bacteria | 1225 |
| 114 | Ga0105246_10426592 | 3300011119 | Bacteria | 1108 |
| 115 | Ga0157370_10216068 | 3300013104 | Bacteria | 1776 |
| 116 | Ga0157369_10071598 | 3300013105 | Bacteria | 3721 |
| 117 | Ga0157378_10289454 | 3300013297 | Bacteria | 1582 |
| 118 | Ga0157375_10644913 | 3300013308 | Bacteria | 1215 |
| 119 | Ga0157375_10939641 | 3300013308 | Bacteria | 1007 |
| 120 | Ga0157375_11421004 | 3300013308 | Bacteria | 818 |
| 121 | Ga0157380_10245118 | 3300014326 | Bacteria | 1618 |
| 122 | Ga0157379_10142098 | 3300014968 | Bacteria | 2164 |
| 123 | Ga0163161_10838422 | 3300017792 | Bacteria | 775 |
| 124 | Ga0207656_10009540 | 3300025321 | Bacteria | 3606 |
| 125 | Ga0207645_10248388 | 3300025907 | Bacteria | 1177 |
| 126 | Ga0207705_10339689 | 3300025909 | Bacteria | 1156 |
| 127 | Ga0207707_10001050 | 3300025912 | Bacteria | 26502 |
| 128 | Ga0207671_10017229 | 3300025914 | Bacteria | 5580 |
| 129 | Ga0207671_10120698 | 3300025914 | Bacteria | 2003 |
| 130 | Ga0207693_10042933 | 3300025915 | Bacteria | 3559 |
| 131 | Ga0207660_10008627 | 3300025917 | Bacteria | 6593 |
| 132 | Ga0207649_10271431 | 3300025920 | Bacteria | 1229 |
| 133 | Ga0207652_10089128 | 3300025921 | Bacteria | 2708 |
| 134 | Ga0207646_10420902 | 3300025922 | Bacteria | 1206 |
| 135 | Ga0207681_10307526 | 3300025923 | Bacteria | 1256 |
| 136 | Ga0207687_10024723 | 3300025927 | Bacteria | 4015 |
| 137 | Ga0207687_10169337 | 3300025927 | Bacteria | 1683 |
| 138 | Ga0207700_10004470 | 3300025928 | Bacteria | 8250 |
| 139 | Ga0207700_10024372 | 3300025928 | Bacteria | 4187 |
| 140 | Ga0207664_10198828 | 3300025929 | Bacteria | 1729 |
| 141 | Ga0207664_10229781 | 3300025929 | Bacteria | 1612 |
| 142 | Ga0207664_10443991 | 3300025929 | Bacteria | 1157 |
| 143 | Ga0207706_10075238 | 3300025933 | Bacteria | 2969 |
| 144 | Ga0207706_10475095 | 3300025933 | Bacteria | 1080 |
| 145 | Ga0207686_10132684 | 3300025934 | Bacteria | 1710 |
| 146 | Ga0207686_10716299 | 3300025934 | Bacteria | 796 |
| 147 | Ga0207709_10011375 | 3300025935 | Bacteria | 4909 |
| 148 | Ga0207709_10118646 | 3300025935 | Bacteria | 1782 |
| 149 | Ga0207669_10008753 | 3300025937 | Bacteria | 4772 |
| 150 | Ga0207704_10014566 | 3300025938 | Bacteria | 3974 |
| 151 | Ga0207711_10873507 | 3300025941 | Bacteria | 836 |
| 152 | Ga0207689_10046303 | 3300025942 | Bacteria | 3595 |
| 153 | Ga0207661_10766209 | 3300025944 | Bacteria | 888 |
| 154 | Ga0207679_10226208 | 3300025945 | Bacteria | 1577 |
| 155 | Ga0207679_11186801 | 3300025945 | Bacteria | 700 |
| 156 | Ga0207712_10033048 | 3300025961 | Bacteria | 3495 |
| 157 | Ga0207668_10390102 | 3300025972 | Bacteria | 1174 |
| 158 | Ga0207640_10216320 | 3300025981 | Bacteria | 1464 |
| 159 | Ga0207640_10926028 | 3300025981 | Bacteria | 763 |
| 160 | Ga0207677_10286338 | 3300026023 | Bacteria | 1355 |
| 161 | Ga0207703_10060703 | 3300026035 | Bacteria | 3092 |
| 162 | Ga0207639_10088791 | 3300026041 | Bacteria | 2468 |
| 163 | Ga0207639_10166038 | 3300026041 | Bacteria | 1865 |
| 164 | Ga0207639_10571828 | 3300026041 | Bacteria | 1040 |
| 165 | Ga0207678_10031422 | 3300026067 | Bacteria | 4632 |
| 166 | Ga0207678_10048031 | 3300026067 | Bacteria | 3690 |
| 167 | Ga0207678_10171594 | 3300026067 | Bacteria | 1852 |
| 168 | Ga0207678_10178225 | 3300026067 | Bacteria | 1815 |
| 169 | Ga0207678_10494415 | 3300026067 | Bacteria | 1066 |
| 170 | Ga0207678_10545993 | 3300026067 | Bacteria | 1013 |
| 171 | Ga0207702_11234502 | 3300026078 | Bacteria | 742 |
| 172 | Ga0207676_10703607 | 3300026095 | Bacteria | 979 |
| 173 | Ga0207674_10016517 | 3300026116 | Bacteria | 8077 |
| 174 | Ga0207675_100104446 | 3300026118 | Bacteria | 2670 |
| 175 | Ga0207683_10422406 | 3300026121 | Bacteria | 1228 |
| 176 | Ga0207698_10081852 | 3300026142 | Bacteria | 2608 |
| 177 | Ga0207698_10082098 | 3300026142 | Bacteria | 2604 |
| 178 | Ga0207698_10514272 | 3300026142 | Bacteria | 1167 |
| 179 | Ga0268266_10002006 | 3300028379 | Bacteria | 22754 |
| 180 | Ga0268266_10002738 | 3300028379 | Bacteria | 18434 |
| 181 | Ga0268266_10425305 | 3300028379 | Bacteria | 1259 |
| 182 | Ga0268266_10482106 | 3300028379 | Bacteria | 1182 |
| 183 | Ga0268265_10205861 | 3300028380 | Bacteria | 1710 |
| 184 | Ga0268265_10250093 | 3300028380 | Bacteria | 1569 |
| 185 | Ga0268265_10773774 | 3300028380 | Bacteria | 933 |
| 186 | Ga0268265_11337056 | 3300028380 | Bacteria | 717 |
| 187 | Ga0265326_10008483 | 3300028558 | Bacteria | 3098 |
| 188 | Ga0265319_1001409 | 3300028563 | Bacteria | 14410 |
| 189 | Ga0265334_10006596 | 3300028573 | Bacteria | 4995 |
| 190 | Ga0265318_10002397 | 3300028577 | Bacteria | 10036 |
| 191 | Ga0265323_10001183 | 3300028653 | Bacteria | 13288 |
| 192 | Ga0265336_10000459 | 3300028666 | Bacteria | 24631 |
| 193 | Ga0307517_10002574 | 3300028786 | Bacteria | 28885 |
| 194 | Ga0307517_10115520 | 3300028786 | Bacteria | 2014 |
| 195 | Ga0265338_10002741 | 3300028800 | Bacteria | 25847 |
| 196 | Ga0265324_10085558 | 3300029957 | Bacteria | 1072 |
| 197 | Ga0265330_10015957 | 3300031235 | Bacteria | 3471 |
| 198 | Ga0265328_10178813 | 3300031239 | Bacteria | 802 |
| 199 | Ga0265331_10018556 | 3300031250 | Bacteria | 3605 |
| 200 | Ga0265316_10454402 | 3300031344 | Bacteria | 918 |
| 201 | Ga0307513_10240214 | 3300031456 | Bacteria | 1617 |
| 202 | Ga0307513_10296388 | 3300031456 | Bacteria | 1386 |
| 203 | Ga0307408_100116061 | 3300031548 | Bacteria | 2066 |
| 204 | Ga0265314_10056061 | 3300031711 | Bacteria | 2715 |
| 205 | Ga0265342_10020456 | 3300031712 | Bacteria | 4244 |
| 206 | Ga0307410_10160018 | 3300031852 | Bacteria | 1686 |
| 207 | Ga0307409_100786527 | 3300031995 | Bacteria | 958 |
| 208 | Ga0307416_100872145 | 3300032002 | Bacteria | 999 |
| 209 | Ga0307414_11031013 | 3300032004 | Bacteria | 758 |
| 210 | Ga0307411_10079809 | 3300032005 | Bacteria | 2248 |
| 211 | Ga0307510_10010125 | 3300033180 | Bacteria | 11211 |
| 212 | Ga0373930_0011290 | 3300034816 | Bacteria | 1611 |
| 213 | Ga0373929_0018975 | 3300035085 | Bacteria | 1372 |
| 214 | Ga0373936_0003033 | 3300035113 | Bacteria | 6278 |
| 215 | Ga0373936_0161980 | 3300035113 | Bacteria | 975 |
| 216 | Ga0373941_0035725 | 3300035115 | Bacteria | 1507 |
| 217 | Ga0373953_0018839 | 3300035117 | Bacteria | 2560 |
| 218 | Ga0373953_0147794 | 3300035117 | Bacteria | 1006 |
| 219 | Ga0373954_0000308 | 3300035118 | Bacteria | 17778 |
| 220 | Ga0373954_0066522 | 3300035118 | Bacteria | 1706 |
| 221 | Ga0373956_0060455 | 3300035119 | Bacteria | 1715 |
| 222 | Ga0373957_0004737 | 3300035120 | Bacteria | 4163 |
| 223 | Ga0373943_0032413 | 3300035170 | Bacteria | 2484 |
| 224 | Ga0373946_0051299 | 3300035171 | Bacteria | 1726 |
| 225 | Ga0373955_0000625 | 3300035172 | Bacteria | 15149 |
| 226 | Ga0373955_0052688 | 3300035172 | Bacteria | 2220 |
| 227 | Ga0373942_0018588 | 3300035207 | Bacteria | 1727 |
| 228 | Ga0373962_0142707 | 3300035242 | Bacteria | 779 |
| 229 | Ga0373924_0001037 | 3300035410 | Bacteria | 8827 |
| 230 | Ga0373931_0020458 | 3300035691 | Bacteria | 3312 |
| 231 | Ga0373935_0000119 | 3300035692 | Bacteria | 35716 |
| 232 | Ga0373927_0000641 | 3300035695 | Bacteria | 26496 |
| 233 | Ga0373927_0228228 | 3300035695 | Bacteria | 1223 |
| 234 | Ga0373933_0003162 | 3300035724 | Bacteria | 9197 |
| 235 | Ga0373947_0001785 | 3300035725 | Bacteria | 13162 |
| 236 | Ga0373937_0013852 | 3300036401 | Bacteria | 7107 |
| 237 | Ga0373937_0014783 | 3300036401 | Bacteria | 6892 |
| 238 | Ga0373925_0002584 | 3300037068 | Bacteria | 14399 |
| 239 | Ga0373925_0053921 | 3300037068 | Bacteria | 3007 |
| 240 | Ga0373925_0483448 | 3300037068 | Bacteria | 1016 |
| 241 | Ga0373925_1361569 | 3300037068 | Bacteria | 582 |
| 242 | Ga0395905_0253741 | 3300037471 | Bacteria | 1643 |
| 243 | Ga0436365_1340371 | 3300039437 | Bacteria | 899 |
| 244 | Ga0451853_3034735 | 3300041512 | Bacteria | 845 |
| 245 | Ga0466966_0403070 | 3300044684 | Bacteria | 822 |
| 246 | Ga0466964_0252429 | 3300044706 | Bacteria | 870 |
| 247 | Ga0466959_0054677 | 3300045049 | Bacteria | 2916 |
| 248 | Ga0466958_0077722 | 3300045836 | Bacteria | 2039 |
| 249 | Ga0495617_019921 | 3300046452 | Bacteria | 2267 |
| 250 | Ga0495592_0001710 | 3300046454 | Bacteria | 15422 |
| 251 | Ga0495592_0009597 | 3300046454 | Bacteria | 7283 |
| 252 | Ga0495603_0045203 | 3300046455 | Bacteria | 2626 |
| 253 | Ga0495629_0000348 | 3300046459 | Bacteria | 39364 |
| 254 | Ga0495629_0000353 | 3300046459 | Bacteria | 39092 |
| 255 | Ga0495641_0000972 | 3300046461 | Bacteria | 24598 |
| 256 | Ga0495651_0003574 | 3300046462 | Bacteria | 11925 |
| 257 | Ga0495653_0002076 | 3300046463 | Bacteria | 15760 |
| 258 | Ga0495653_0704165 | 3300046463 | Bacteria | 613 |
| 259 | Ga0495580_0004944 | 3300046472 | Bacteria | 11142 |
| 260 | Ga0495580_0296820 | 3300046472 | Bacteria | 1101 |
| 261 | Ga0495582_0080328 | 3300046473 | Bacteria | 1810 |
| 262 | Ga0495639_0000177 | 3300046475 | Bacteria | 33573 |
| 263 | Ga0495662_0000461 | 3300046476 | Bacteria | 18377 |
| 264 | Ga0495664_0006586 | 3300046477 | Bacteria | 6419 |
| 265 | Ga0495594_0000079 | 3300046499 | Bacteria | 42880 |
| 266 | Ga0495594_0023235 | 3300046499 | Bacteria | 3321 |
| 267 | Ga0495607_0122695 | 3300046501 | Bacteria | 1362 |
| 268 | Ga0495608_0000368 | 3300046511 | Bacteria | 31510 |
| 269 | Ga0495616_0115685 | 3300046513 | Bacteria | 1242 |
| 270 | Ga0495618_0018215 | 3300046514 | Bacteria | 4312 |
| 271 | Ga0495618_0250039 | 3300046514 | Bacteria | 1112 |
| 272 | Ga0495630_0001616 | 3300046517 | Bacteria | 15677 |
| 273 | Ga0495630_0717232 | 3300046517 | Bacteria | 765 |
| 274 | Ga0495663_0134484 | 3300046525 | Bacteria | 836 |
| 275 | Ga0495666_0384790 | 3300046526 | Bacteria | 631 |
| 276 | Ga0495652_0081837 | 3300046529 | Bacteria | 2662 |
| 277 | Ga0495652_0158696 | 3300046529 | Bacteria | 1758 |
| 278 | Ga0495665_0000570 | 3300046531 | Bacteria | 18750 |
| 279 | Ga0495665_0288038 | 3300046531 | Bacteria | 842 |
| 280 | Ga0495640_0001386 | 3300046533 | Bacteria | 19082 |
| 281 | Ga0495586_0076568 | 3300046535 | Bacteria | 1833 |
| 282 | Ga0495587_0001529 | 3300046536 | Bacteria | 15391 |
| 283 | Ga0495621_0063101 | 3300046539 | Bacteria | 1349 |
| 284 | Ga0495645_0008041 | 3300046543 | Bacteria | 7344 |
| 285 | Ga0495645_0493123 | 3300046543 | Bacteria | 767 |
| 286 | Ga0495622_0002449 | 3300046557 | Bacteria | 8997 |
| 287 | Ga0495667_0000778 | 3300046559 | Bacteria | 20484 |
| 288 | Ga0495667_0015301 | 3300046559 | Bacteria | 5181 |
| 289 | Ga0495656_0004904 | 3300046615 | Bacteria | 4606 |
| 290 | Ga0495656_0017632 | 3300046615 | Bacteria | 2727 |
| 291 | Ga0495656_0018685 | 3300046615 | Bacteria | 2667 |
| 292 | Ga0495668_0035000 | 3300046616 | Bacteria | 2815 |
| 293 | Ga0495634_0000334 | 3300046642 | Bacteria | 45432 |
| 294 | Ga0495634_0014193 | 3300046642 | Bacteria | 5747 |
| 295 | Ga0495611_0024765 | 3300046648 | Bacteria | 2612 |
| 296 | Ga0495625_0188894 | 3300046660 | Bacteria | 1366 |
| 297 | Ga0495625_0495523 | 3300046660 | Bacteria | 748 |
| 298 | Ga0495635_0000372 | 3300046663 | Bacteria | 28497 |
| 299 | Ga0495635_0000477 | 3300046663 | Bacteria | 25298 |
| 300 | Ga0495659_0060726 | 3300046664 | Bacteria | 1395 |
| 301 | Ga0495599_0003226 | 3300046678 | Bacteria | 9493 |
| 302 | Ga0495599_0233312 | 3300046678 | Bacteria | 1123 |
| 303 | Ga0495623_0043995 | 3300046679 | Bacteria | 2838 |
| 304 | Ga0495646_0002558 | 3300046680 | Bacteria | 11178 |
| 305 | Ga0495647_0003566 | 3300046681 | Bacteria | 4989 |
| 306 | Ga0495658_0000416 | 3300046683 | Bacteria | 23941 |
| 307 | Ga0495669_0013307 | 3300046684 | Bacteria | 3504 |
| 308 | Ga0495669_0030494 | 3300046684 | Bacteria | 2367 |
| 309 | Ga0495613_0005732 | 3300046689 | Bacteria | 9304 |
| 310 | Ga0495624_0001221 | 3300046690 | Bacteria | 20262 |
| 311 | Ga0495670_0145764 | 3300046691 | Bacteria | 1240 |
| 312 | Ga0495589_0221158 | 3300046794 | Bacteria | 889 |
| 313 | Ga0495581_0000477 | 3300047315 | Bacteria | 20433 |
| 314 | Ga0495581_0153686 | 3300047315 | Bacteria | 1344 |
| 315 | Ga0495604_0014529 | 3300047317 | Bacteria | 6279 |
| 316 | Ga0495604_0367477 | 3300047317 | Bacteria | 953 |
| 317 | Ga0495636_0060704 | 3300047318 | Bacteria | 1598 |
| 318 | Ga0495636_0172139 | 3300047318 | Bacteria | 979 |
| 319 | Ga0495636_0196690 | 3300047318 | Bacteria | 919 |
| 320 | Ga0495674_0000533 | 3300047319 | Bacteria | 35160 |
| 321 | Ga0495674_0226505 | 3300047319 | Bacteria | 1544 |
| 322 | Ga0495680_0002581 | 3300047322 | Bacteria | 18442 |
| 323 | Ga0495680_0474926 | 3300047322 | Bacteria | 852 |
| 324 | Ga0495675_0044173 | 3300047444 | Bacteria | 2838 |
| 325 | Ga0495673_0174997 | 3300047469 | Bacteria | 816 |
| 326 | Ga0495684_0001014 | 3300047471 | Bacteria | 22867 |
| 327 | Ga0495593_0001154 | 3300047673 | Bacteria | 15412 |
| 328 | Ga0495593_0004444 | 3300047673 | Bacteria | 8330 |
| 329 | Ga0495602_0002140 | 3300048088 | Bacteria | 19931 |
| 330 | Ga0495602_0181142 | 3300048088 | Bacteria | 1625 |
| 331 | Ga0495614_0005404 | 3300048089 | Bacteria | 5764 |
| 332 | Ga0495614_0274160 | 3300048089 | Bacteria | 776 |
| 333 | Ga0495615_0003787 | 3300048090 | Bacteria | 2571 |
| 334 | Ga0496100_0182447 | 3300048903 | Bacteria | 1518 |
| 335 | Ga0496101_0075445 | 3300048904 | Bacteria | 2482 |
| 336 | Ga0496101_0497205 | 3300048904 | Bacteria | 963 |
| 337 | Ga0496102_0096464 | 3300048905 | Bacteria | 2741 |
| 338 | Ga0496102_0131752 | 3300048905 | Bacteria | 2341 |
| 339 | Ga0496103_0011840 | 3300048906 | Bacteria | 5177 |
| 340 | Ga0496103_0735234 | 3300048906 | Bacteria | 624 |
| 341 | Ga0496104_0063943 | 3300048907 | Bacteria | 3490 |
| 342 | Ga0496105_0023168 | 3300048908 | Bacteria | 5034 |
| 343 | Ga0496106_0172617 | 3300048909 | Bacteria | 1714 |
| 344 | Ga0496108_0052485 | 3300048911 | Bacteria | 3417 |
| 345 | Ga0496108_0488544 | 3300048911 | Bacteria | 1075 |
| 346 | Ga0496109_0095294 | 3300048912 | Bacteria | 2755 |
| 347 | Ga0496109_0151874 | 3300048912 | Bacteria | 2168 |
| 348 | Ga0496110_0319369 | 3300048913 | Bacteria | 1414 |
| 349 | Ga0496110_1166490 | 3300048913 | Bacteria | 679 |
| 350 | Ga0496111_0069157 | 3300048914 | Bacteria | 2567 |
| 351 | Ga0496112_0026725 | 3300048915 | Bacteria | 5560 |
| 352 | Ga0496112_0267929 | 3300048915 | Bacteria | 1656 |
| 353 | Ga0496113_0179428 | 3300048916 | Bacteria | 1678 |
| 354 | Ga0496114_0092048 | 3300048917 | Bacteria | 2576 |
| 355 | Ga0496114_0218270 | 3300048917 | Bacteria | 1673 |
| 356 | Ga0496114_1237815 | 3300048917 | Bacteria | 633 |
| 357 | Ga0496115_0061669 | 3300048918 | Bacteria | 3023 |
| 358 | Ga0496115_0756406 | 3300048918 | Bacteria | 759 |
| 359 | Ga0496119_0106311 | 3300048922 | Bacteria | 1566 |
| 360 | Ga0496119_0150832 | 3300048922 | Bacteria | 1246 |
| 361 | Ga0496121_0362399 | 3300048924 | Bacteria | 962 |
| 362 | Ga0496125_0068442 | 3300048928 | Bacteria | 2793 |
| 363 | Ga0496126_0984848 | 3300048929 | Bacteria | 634 |
| 364 | Ga0501038_0214211 | 3300049574 | Bacteria | 1540 |
| 365 | Ga0501042_0447434 | 3300049578 | Bacteria | 937 |
| 366 | Ga0501067_0133458 | 3300049583 | Bacteria | 1382 |
| 367 | Ga0501076_0180664 | 3300049592 | Bacteria | 1720 |
| 368 | nmdc:mga0yw44_272192_c1 | 3300050492 | Bacteria | 1131 |
| 369 | nmdc:mga0k408_187269_c1 | 3300050493 | Bacteria | 1234 |
| 370 | nmdc:mga08y16_425849_c1 | 3300050511 | Bacteria | 1356 |
| 371 | Ga0495601_0063470 | 3300053077 | Bacteria | 2348 |
| 372 | Ga0495601_0082883 | 3300053077 | Bacteria | 2059 |
| 373 | Ga0495612_0093142 | 3300053078 | Bacteria | 1278 |
| 374 | Ga0500635_0034855 | 3300053080 | Bacteria | 1651 |
| 375 | Ga0495595_0001247 | 3300053084 | Bacteria | 9910 |
| 376 | Ga0495619_0000563 | 3300053085 | Bacteria | 24565 |
| 377 | Ga0500641_0006410 | 3300053096 | Bacteria | 4177 |
| 378 | Ga0500572_000057 | 3300053111 | Bacteria | 33904 |
| 379 | Ga0500559_0000219 | 3300053136 | Bacteria | 45843 |
| 380 | Ga0500603_006249 | 3300053150 | Bacteria | 2585 |
| 381 | Ga0500620_033906 | 3300053155 | Bacteria | 1636 |
| 382 | Ga0500638_001732 | 3300053162 | Bacteria | 7123 |
| 383 | Ga0500638_081847 | 3300053162 | Bacteria | 1532 |
| 384 | Ga0500637_0000168 | 3300053178 | Bacteria | 24363 |
| 385 | Ga0500576_026268 | 3300053725 | Bacteria | 2656 |
| 386 | Ga0500596_001061 | 3300053735 | Bacteria | 5538 |
| 387 | Ga0500661_000293 | 3300055283 | Bacteria | 9112 |
| 388 | Ga0500661_050014 | 3300055283 | Bacteria | 746 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100313687 | Ga0070714_1003136871 | 167 |
| 2 | 3300006186 | Ga0075369_10060624 | Ga0075369_100606242 | 167 |
| 3 | 3300006353 | Ga0075370_10179793 | Ga0075370_101797932 | 167 |
| 4 | 3300025928 | Ga0207700_10024372 | Ga0207700_100243722 | 167 |
| 5 | 3300025929 | Ga0207664_10229781 | Ga0207664_102297812 | 167 |
| 6 | 3300031235 | Ga0265330_10015957 | Ga0265330_100159573 | 167 |
| 7 | 3300031239 | Ga0265328_10178813 | Ga0265328_101788131 | 167 |
| 8 | 3300031250 | Ga0265331_10018556 | Ga0265331_100185564 | 167 |
| 9 | 3300031344 | Ga0265316_10454402 | Ga0265316_104544022 | 167 |
| 10 | 3300031712 | Ga0265342_10020456 | Ga0265342_100204566 | 167 |
| 11 | 3300032002 | Ga0307416_100872145 | Ga0307416_1008721452 | 167 |
| 12 | 3300041512 | Ga0451853_3034735 | Ga0451853_3034735_90_671 | 167 |
| 13 | 3300048088 | Ga0495602_0181142 | Ga0495602_0181142_544_1077 | 167 |
| 14 | 3300048917 | Ga0496114_0092048 | Ga0496114_0092048_177_758 | 167 |
| 15 | 3300050492 | nmdc:mga0yw44_272192_c1 | nmdc:mga0yw44_272192_c1_242_829 | 167 |
| 16 | 3300005293 | Ga0065715_10410964 | Ga0065715_104109641 | 172 |
| 17 | 3300005338 | Ga0068868_100436140 | Ga0068868_1004361401 | 172 |
| 18 | 3300005539 | Ga0068853_100252531 | Ga0068853_1002525312 | 172 |
| 19 | 3300009174 | Ga0105241_10303134 | Ga0105241_103031341 | 172 |
| 20 | 3300009545 | Ga0105237_10149559 | Ga0105237_101495592 | 172 |
| 21 | 3300010375 | Ga0105239_10165739 | Ga0105239_101657392 | 172 |
| 22 | 3300011119 | Ga0105246_10426592 | Ga0105246_104265922 | 172 |
| 23 | 3300013308 | Ga0157375_10939641 | Ga0157375_109396412 | 172 |
| 24 | 3300025915 | Ga0207693_10042933 | Ga0207693_100429333 | 172 |
| 25 | 3300025929 | Ga0207664_10443991 | Ga0207664_104439912 | 172 |
| 26 | 3300025934 | Ga0207686_10132684 | Ga0207686_101326842 | 172 |
| 27 | 3300026041 | Ga0207639_10571828 | Ga0207639_105718282 | 172 |
| 28 | 3300034816 | Ga0373930_0011290 | Ga0373930_0011290_107_661 | 172 |
| 29 | 3300035085 | Ga0373929_0018975 | Ga0373929_0018975_226_780 | 172 |
| 30 | 3300035113 | Ga0373936_0003033 | Ga0373936_0003033_1356_1892 | 172 |
| 31 | 3300035115 | Ga0373941_0035725 | Ga0373941_0035725_102_656 | 172 |
| 32 | 3300035117 | Ga0373953_0147794 | Ga0373953_0147794_117_653 | 172 |
| 33 | 3300035118 | Ga0373954_0066522 | Ga0373954_0066522_145_681 | 172 |
| 34 | 3300035170 | Ga0373943_0032413 | Ga0373943_0032413_98_634 | 172 |
| 35 | 3300035171 | Ga0373946_0051299 | Ga0373946_0051299_735_1271 | 172 |
| 36 | 3300035172 | Ga0373955_0052688 | Ga0373955_0052688_322_858 | 172 |
| 37 | 3300035242 | Ga0373962_0142707 | Ga0373962_0142707_139_693 | 172 |
| 38 | 3300035691 | Ga0373931_0020458 | Ga0373931_0020458_773_1327 | 172 |
| 39 | 3300035692 | Ga0373935_0000119 | Ga0373935_0000119_28214_28750 | 172 |
| 40 | 3300035695 | Ga0373927_0000641 | Ga0373927_0000641_7254_7790 | 172 |
| 41 | 3300035695 | Ga0373927_0228228 | Ga0373927_0228228_523_1077 | 172 |
| 42 | 3300035725 | Ga0373947_0001785 | Ga0373947_0001785_12233_12769 | 172 |
| 43 | 3300036401 | Ga0373937_0014783 | Ga0373937_0014783_424_960 | 172 |
| 44 | 3300037068 | Ga0373925_0002584 | Ga0373925_0002584_7957_8493 | 172 |
| 45 | 3300037471 | Ga0395905_0253741 | Ga0395905_0253741_877_1401 | 172 |
| 46 | 3300046454 | Ga0495592_0009597 | Ga0495592_0009597_374_910 | 172 |
| 47 | 3300046459 | Ga0495629_0000353 | Ga0495629_0000353_24179_24715 | 172 |
| 48 | 3300046461 | Ga0495641_0000972 | Ga0495641_0000972_17686_18222 | 172 |
| 49 | 3300046463 | Ga0495653_0704165 | Ga0495653_0704165_18_554 | 172 |
| 50 | 3300046472 | Ga0495580_0004944 | Ga0495580_0004944_10212_10748 | 172 |
| 51 | 3300046473 | Ga0495582_0080328 | Ga0495582_0080328_881_1417 | 172 |
| 52 | 3300046475 | Ga0495639_0000177 | Ga0495639_0000177_14378_14914 | 172 |
| 53 | 3300046476 | Ga0495662_0000461 | Ga0495662_0000461_6056_6592 | 172 |
| 54 | 3300046477 | Ga0495664_0006586 | Ga0495664_0006586_1379_1915 | 172 |
| 55 | 3300046499 | Ga0495594_0000079 | Ga0495594_0000079_23597_24133 | 172 |
| 56 | 3300046514 | Ga0495618_0250039 | Ga0495618_0250039_290_826 | 172 |
| 57 | 3300046517 | Ga0495630_0001616 | Ga0495630_0001616_13598_14134 | 172 |
| 58 | 3300046526 | Ga0495666_0384790 | Ga0495666_0384790_44_580 | 172 |
| 59 | 3300046529 | Ga0495652_0158696 | Ga0495652_0158696_74_610 | 172 |
| 60 | 3300046531 | Ga0495665_0000570 | Ga0495665_0000570_11889_12425 | 172 |
| 61 | 3300046533 | Ga0495640_0001386 | Ga0495640_0001386_3018_3554 | 172 |
| 62 | 3300046535 | Ga0495586_0076568 | Ga0495586_0076568_707_1243 | 172 |
| 63 | 3300046543 | Ga0495645_0493123 | Ga0495645_0493123_29_583 | 172 |
| 64 | 3300046557 | Ga0495622_0002449 | Ga0495622_0002449_5928_6464 | 172 |
| 65 | 3300046559 | Ga0495667_0015301 | Ga0495667_0015301_3431_3967 | 172 |
| 66 | 3300046642 | Ga0495634_0000334 | Ga0495634_0000334_29529_30065 | 172 |
| 67 | 3300046663 | Ga0495635_0000477 | Ga0495635_0000477_19206_19742 | 172 |
| 68 | 3300046678 | Ga0495599_0233312 | Ga0495599_0233312_458_994 | 172 |
| 69 | 3300046681 | Ga0495647_0003566 | Ga0495647_0003566_111_647 | 172 |
| 70 | 3300046683 | Ga0495658_0000416 | Ga0495658_0000416_12891_13427 | 172 |
| 71 | 3300046689 | Ga0495613_0005732 | Ga0495613_0005732_127_663 | 172 |
| 72 | 3300046690 | Ga0495624_0001221 | Ga0495624_0001221_954_1490 | 172 |
| 73 | 3300047315 | Ga0495581_0000477 | Ga0495581_0000477_881_1417 | 172 |
| 74 | 3300047317 | Ga0495604_0367477 | Ga0495604_0367477_101_637 | 172 |
| 75 | 3300047319 | Ga0495674_0000533 | Ga0495674_0000533_28590_29126 | 172 |
| 76 | 3300047322 | Ga0495680_0474926 | Ga0495680_0474926_207_743 | 172 |
| 77 | 3300047673 | Ga0495593_0001154 | Ga0495593_0001154_5907_6443 | 172 |
| 78 | 3300048089 | Ga0495614_0005404 | Ga0495614_0005404_5093_5629 | 172 |
| 79 | 3300048904 | Ga0496101_0497205 | Ga0496101_0497205_79_633 | 172 |
| 80 | 3300048905 | Ga0496102_0096464 | Ga0496102_0096464_208_762 | 172 |
| 81 | 3300048906 | Ga0496103_0011840 | Ga0496103_0011840_2790_3344 | 172 |
| 82 | 3300048907 | Ga0496104_0063943 | Ga0496104_0063943_959_1513 | 172 |
| 83 | 3300048908 | Ga0496105_0023168 | Ga0496105_0023168_3986_4540 | 172 |
| 84 | 3300048909 | Ga0496106_0172617 | Ga0496106_0172617_754_1308 | 172 |
| 85 | 3300048911 | Ga0496108_0052485 | Ga0496108_0052485_936_1490 | 172 |
| 86 | 3300048912 | Ga0496109_0095294 | Ga0496109_0095294_1971_2525 | 172 |
| 87 | 3300048913 | Ga0496110_0319369 | Ga0496110_0319369_104_658 | 172 |
| 88 | 3300048913 | Ga0496110_1166490 | Ga0496110_1166490_61_603 | 172 |
| 89 | 3300048914 | Ga0496111_0069157 | Ga0496111_0069157_756_1310 | 172 |
| 90 | 3300048915 | Ga0496112_0267929 | Ga0496112_0267929_178_732 | 172 |
| 91 | 3300048916 | Ga0496113_0179428 | Ga0496113_0179428_1053_1607 | 172 |
| 92 | 3300048917 | Ga0496114_0218270 | Ga0496114_0218270_712_1266 | 172 |
| 93 | 3300048918 | Ga0496115_0061669 | Ga0496115_0061669_472_1026 | 172 |
| 94 | 3300053077 | Ga0495601_0063470 | Ga0495601_0063470_521_1057 | 172 |
| 95 | 3300005719 | Ga0068861_100689300 | Ga0068861_1006893002 | 173 |
| 96 | 3300006178 | Ga0075367_10190850 | Ga0075367_101908502 | 173 |
| 97 | 3300009176 | Ga0105242_11430565 | Ga0105242_114305652 | 173 |
| 98 | 3300013308 | Ga0157375_11421004 | Ga0157375_114210042 | 173 |
| 99 | 3300031711 | Ga0265314_10056061 | Ga0265314_100560612 | 173 |
| 100 | 3300044684 | Ga0466966_0403070 | Ga0466966_0403070_16_540 | 173 |
| 101 | 3300046517 | Ga0495630_0717232 | Ga0495630_0717232_175_735 | 173 |
| 102 | 3300046531 | Ga0495665_0288038 | Ga0495665_0288038_26_586 | 173 |
| 103 | 3300046660 | Ga0495625_0495523 | Ga0495625_0495523_109_687 | 173 |
| 104 | 3300047315 | Ga0495581_0153686 | Ga0495581_0153686_301_861 | 173 |
| 105 | 3300048922 | Ga0496119_0106311 | Ga0496119_0106311_407_949 | 173 |
| 106 | 3300005436 | Ga0070713_100038244 | Ga0070713_1000382442 | 175 |
| 107 | 3300005436 | Ga0070713_100351960 | Ga0070713_1003519602 | 175 |
| 108 | 3300005458 | Ga0070681_10024092 | Ga0070681_100240925 | 175 |
| 109 | 3300005539 | Ga0068853_100406096 | Ga0068853_1004060962 | 175 |
| 110 | 3300005981 | Ga0081538_10056728 | Ga0081538_100567282 | 175 |
| 111 | 3300006173 | Ga0070716_100262730 | Ga0070716_1002627302 | 175 |
| 112 | 3300009545 | Ga0105237_10168697 | Ga0105237_101686971 | 175 |
| 113 | 3300013104 | Ga0157370_10216068 | Ga0157370_102160682 | 175 |
| 114 | 3300013105 | Ga0157369_10071598 | Ga0157369_100715984 | 175 |
| 115 | 3300025922 | Ga0207646_10420902 | Ga0207646_104209022 | 175 |
| 116 | 3300025928 | Ga0207700_10004470 | Ga0207700_100044706 | 175 |
| 117 | 3300025929 | Ga0207664_10198828 | Ga0207664_101988282 | 175 |
| 118 | 3300026041 | Ga0207639_10166038 | Ga0207639_101660382 | 175 |
| 119 | 3300037068 | Ga0373925_0053921 | Ga0373925_0053921_2245_2775 | 175 |
| 120 | 3300039437 | Ga0436365_1340371 | Ga0436365_1340371_39_569 | 175 |
| 121 | 3300044706 | Ga0466964_0252429 | Ga0466964_0252429_129_659 | 175 |
| 122 | 3300045049 | Ga0466959_0054677 | Ga0466959_0054677_157_687 | 175 |
| 123 | 3300045836 | Ga0466958_0077722 | Ga0466958_0077722_107_637 | 175 |
| 124 | 3300047319 | Ga0495674_0226505 | Ga0495674_0226505_225_755 | 175 |
| 125 | 3300048089 | Ga0495614_0274160 | Ga0495614_0274160_61_603 | 175 |
| 126 | 3300049578 | Ga0501042_0447434 | Ga0501042_0447434_387_917 | 175 |
| 127 | 3300049583 | Ga0501067_0133458 | Ga0501067_0133458_142_675 | 175 |
| 128 | 3300053078 | Ga0495612_0093142 | Ga0495612_0093142_543_1073 | 175 |
| 129 | 3300053080 | Ga0500635_0034855 | Ga0500635_0034855_162_731 | 175 |
| 130 | 3300055283 | Ga0500661_050014 | Ga0500661_050014_110_679 | 175 |
| 131 | iso_pu_bacteria | 2513237101 | 2513695020 | 175 |
| 132 | iso_pu_bacteria | 2721755755 | 2723841917 | 175 |
| 133 | iso_pu_bacteria | 2874604998 | 2874610484 | 175 |
| 134 | iso_pu_bacteria | 2876808645 | 2876817417 | 175 |
| 135 | iso_pu_bacteria | 2879110137 | 2879115126 | 175 |
| 136 | iso_pu_bacteria | 2922386360 | 2922388772 | 175 |
| 137 | iso_pu_bacteria | 8006964411 | 8006969385 | 175 |
| 138 | iso_pu_bacteria | 8006994254 | 8007000678 | 175 |
| 139 | iso_pu_bacteria | 8056673599 | 8056678571 | 175 |
| 140 | 3300037068 | Ga0373925_1361569 | Ga0373925_1361569_40_570 | 176 |
| 141 | 3300053155 | Ga0500620_033906 | Ga0500620_033906_52_630 | 176 |
| 142 | 3300005331 | Ga0070670_100592927 | Ga0070670_1005929272 | 177 |
| 143 | 3300005455 | Ga0070663_100022315 | Ga0070663_1000223152 | 177 |
| 144 | 3300005459 | Ga0068867_100443147 | Ga0068867_1004431471 | 177 |
| 145 | 3300005471 | Ga0070698_100249502 | Ga0070698_1002495022 | 177 |
| 146 | 3300005536 | Ga0070697_101180672 | Ga0070697_1011806721 | 177 |
| 147 | 3300005548 | Ga0070665_100155855 | Ga0070665_1001558552 | 177 |
| 148 | 3300005618 | Ga0068864_100665624 | Ga0068864_1006656242 | 177 |
| 149 | 3300006358 | Ga0068871_100166607 | Ga0068871_1001666072 | 177 |
| 150 | 3300025914 | Ga0207671_10120698 | Ga0207671_101206982 | 177 |
| 151 | 3300025927 | Ga0207687_10024723 | Ga0207687_100247235 | 177 |
| 152 | 3300025941 | Ga0207711_10873507 | Ga0207711_108735071 | 177 |
| 153 | 3300025944 | Ga0207661_10766209 | Ga0207661_107662092 | 177 |
| 154 | 3300026041 | Ga0207639_10088791 | Ga0207639_100887911 | 177 |
| 155 | 3300026067 | Ga0207678_10494415 | Ga0207678_104944152 | 177 |
| 156 | 3300026067 | Ga0207678_10545993 | Ga0207678_105459932 | 177 |
| 157 | 3300026078 | Ga0207702_11234502 | Ga0207702_112345021 | 177 |
| 158 | 3300026095 | Ga0207676_10703607 | Ga0207676_107036071 | 177 |
| 159 | 3300026142 | Ga0207698_10082098 | Ga0207698_100820982 | 177 |
| 160 | 3300028379 | Ga0268266_10425305 | Ga0268266_104253052 | 177 |
| 161 | 3300031456 | Ga0307513_10240214 | Ga0307513_102402142 | 177 |
| 162 | 3300046660 | Ga0495625_0188894 | Ga0495625_0188894_24_605 | 177 |
| 163 | 3300053111 | Ga0500572_000057 | Ga0500572_000057_8524_9066 | 177 |
| 164 | 3300053136 | Ga0500559_0000219 | Ga0500559_0000219_21134_21676 | 177 |
| 165 | 3300053725 | Ga0500576_026268 | Ga0500576_026268_470_1012 | 177 |
| 166 | 3300053735 | Ga0500596_001061 | Ga0500596_001061_3800_4342 | 177 |
| 167 | 3300005841 | Ga0068863_100460623 | Ga0068863_1004606232 | 178 |
| 168 | 3300005842 | Ga0068858_100279545 | Ga0068858_1002795452 | 178 |
| 169 | 3300025914 | Ga0207671_10017229 | Ga0207671_100172295 | 178 |
| 170 | 3300026142 | Ga0207698_10514272 | Ga0207698_105142721 | 178 |
| 171 | 3300048915 | Ga0496112_0026725 | Ga0496112_0026725_4111_4659 | 178 |
| 172 | 3300002075 | JGI24738J21930_10081871 | JGI24738J21930_100818711 | 179 |
| 173 | 3300003659 | JGI25404J52841_10022235 | JGI25404J52841_100222352 | 179 |
| 174 | 3300005336 | Ga0070680_100052242 | Ga0070680_1000522422 | 179 |
| 175 | 3300005337 | Ga0070682_100284369 | Ga0070682_1002843692 | 179 |
| 176 | 3300005339 | Ga0070660_100009783 | Ga0070660_1000097832 | 179 |
| 177 | 3300005341 | Ga0070691_10037778 | Ga0070691_100377782 | 179 |
| 178 | 3300005344 | Ga0070661_100366139 | Ga0070661_1003661391 | 179 |
| 179 | 3300005354 | Ga0070675_100142286 | Ga0070675_1001422863 | 179 |
| 180 | 3300005355 | Ga0070671_100274233 | Ga0070671_1002742332 | 179 |
| 181 | 3300005356 | Ga0070674_100084727 | Ga0070674_1000847273 | 179 |
| 182 | 3300005364 | Ga0070673_100964629 | Ga0070673_1009646291 | 179 |
| 183 | 3300005366 | Ga0070659_100666801 | Ga0070659_1006668011 | 179 |
| 184 | 3300005441 | Ga0070700_100073138 | Ga0070700_1000731382 | 179 |
| 185 | 3300005441 | Ga0070700_101049794 | Ga0070700_1010497941 | 179 |
| 186 | 3300005445 | Ga0070708_100779930 | Ga0070708_1007799301 | 179 |
| 187 | 3300005455 | Ga0070663_100045675 | Ga0070663_1000456754 | 179 |
| 188 | 3300005455 | Ga0070663_100077282 | Ga0070663_1000772821 | 179 |
| 189 | 3300005455 | Ga0070663_100107908 | Ga0070663_1001079082 | 179 |
| 190 | 3300005455 | Ga0070663_100247518 | Ga0070663_1002475181 | 179 |
| 191 | 3300005455 | Ga0070663_100356163 | Ga0070663_1003561631 | 179 |
| 192 | 3300005456 | Ga0070678_100027180 | Ga0070678_1000271804 | 179 |
| 193 | 3300005456 | Ga0070678_100130340 | Ga0070678_1001303402 | 179 |
| 194 | 3300005457 | Ga0070662_100070598 | Ga0070662_1000705983 | 179 |
| 195 | 3300005458 | Ga0070681_10020406 | Ga0070681_100204064 | 179 |
| 196 | 3300005459 | Ga0068867_100281966 | Ga0068867_1002819661 | 179 |
| 197 | 3300005530 | Ga0070679_100140520 | Ga0070679_1001405202 | 179 |
| 198 | 3300005535 | Ga0070684_100048558 | Ga0070684_1000485583 | 179 |
| 199 | 3300005539 | Ga0068853_100007556 | Ga0068853_1000075563 | 179 |
| 200 | 3300005539 | Ga0068853_100467990 | Ga0068853_1004679902 | 179 |
| 201 | 3300005539 | Ga0068853_101003069 | Ga0068853_1010030691 | 179 |
| 202 | 3300005548 | Ga0070665_100011218 | Ga0070665_1000112187 | 179 |
| 203 | 3300005548 | Ga0070665_100082768 | Ga0070665_1000827682 | 179 |
| 204 | 3300005548 | Ga0070665_100163739 | Ga0070665_1001637392 | 179 |
| 205 | 3300005548 | Ga0070665_100603409 | Ga0070665_1006034091 | 179 |
| 206 | 3300005564 | Ga0070664_100582413 | Ga0070664_1005824132 | 179 |
| 207 | 3300005564 | Ga0070664_100851413 | Ga0070664_1008514132 | 179 |
| 208 | 3300005577 | Ga0068857_100012153 | Ga0068857_1000121536 | 179 |
| 209 | 3300005578 | Ga0068854_100522597 | Ga0068854_1005225972 | 179 |
| 210 | 3300005614 | Ga0068856_101008444 | Ga0068856_1010084442 | 179 |
| 211 | 3300005615 | Ga0070702_100109992 | Ga0070702_1001099922 | 179 |
| 212 | 3300005616 | Ga0068852_100049008 | Ga0068852_1000490082 | 179 |
| 213 | 3300005616 | Ga0068852_100243559 | Ga0068852_1002435592 | 179 |
| 214 | 3300005616 | Ga0068852_100453038 | Ga0068852_1004530382 | 179 |
| 215 | 3300005617 | Ga0068859_100052455 | Ga0068859_1000524554 | 179 |
| 216 | 3300005617 | Ga0068859_100194158 | Ga0068859_1001941581 | 179 |
| 217 | 3300005719 | Ga0068861_100085153 | Ga0068861_1000851532 | 179 |
| 218 | 3300005834 | Ga0068851_10012271 | Ga0068851_100122713 | 179 |
| 219 | 3300005834 | Ga0068851_10304449 | Ga0068851_103044491 | 179 |
| 220 | 3300005841 | Ga0068863_101067052 | Ga0068863_1010670521 | 179 |
| 221 | 3300005842 | Ga0068858_100171532 | Ga0068858_1001715322 | 179 |
| 222 | 3300005842 | Ga0068858_100708057 | Ga0068858_1007080572 | 179 |
| 223 | 3300005842 | Ga0068858_100827283 | Ga0068858_1008272831 | 179 |
| 224 | 3300005844 | Ga0068862_100243746 | Ga0068862_1002437461 | 179 |
| 225 | 3300005844 | Ga0068862_100465977 | Ga0068862_1004659772 | 179 |
| 226 | 3300005981 | Ga0081538_10048665 | Ga0081538_100486652 | 179 |
| 227 | 3300005983 | Ga0081540_1003142 | Ga0081540_100314212 | 179 |
| 228 | 3300005983 | Ga0081540_1006347 | Ga0081540_10063476 | 179 |
| 229 | 3300005983 | Ga0081540_1032727 | Ga0081540_10327274 | 179 |
| 230 | 3300005983 | Ga0081540_1047121 | Ga0081540_10471213 | 179 |
| 231 | 3300006038 | Ga0075365_10281454 | Ga0075365_102814542 | 179 |
| 232 | 3300006048 | Ga0075363_100003491 | Ga0075363_1000034914 | 179 |
| 233 | 3300006051 | Ga0075364_10091336 | Ga0075364_100913361 | 179 |
| 234 | 3300006058 | Ga0075432_10238181 | Ga0075432_102381811 | 179 |
| 235 | 3300006177 | Ga0075362_10141874 | Ga0075362_101418742 | 179 |
| 236 | 3300006178 | Ga0075367_10002314 | Ga0075367_100023147 | 179 |
| 237 | 3300006178 | Ga0075367_10089310 | Ga0075367_100893102 | 179 |
| 238 | 3300006186 | Ga0075369_10036501 | Ga0075369_100365011 | 179 |
| 239 | 3300006195 | Ga0075366_10025892 | Ga0075366_100258921 | 179 |
| 240 | 3300006195 | Ga0075366_10114107 | Ga0075366_101141072 | 179 |
| 241 | 3300006353 | Ga0075370_10015254 | Ga0075370_100152544 | 179 |
| 242 | 3300006844 | Ga0075428_100154775 | Ga0075428_1001547752 | 179 |
| 243 | 3300006881 | Ga0068865_100017682 | Ga0068865_1000176824 | 179 |
| 244 | 3300006931 | Ga0097620_100052457 | Ga0097620_1000524574 | 179 |
| 245 | 3300006931 | Ga0097620_100137735 | Ga0097620_1001377352 | 179 |
| 246 | 3300006931 | Ga0097620_100194183 | Ga0097620_1001941832 | 179 |
| 247 | 3300009094 | Ga0111539_10095400 | Ga0111539_100954003 | 179 |
| 248 | 3300009147 | Ga0114129_11217745 | Ga0114129_112177452 | 179 |
| 249 | 3300009148 | Ga0105243_10035721 | Ga0105243_100357214 | 179 |
| 250 | 3300009148 | Ga0105243_10893310 | Ga0105243_108933101 | 179 |
| 251 | 3300009176 | Ga0105242_10187680 | Ga0105242_101876803 | 179 |
| 252 | 3300009177 | Ga0105248_10233854 | Ga0105248_102338541 | 179 |
| 253 | 3300009551 | Ga0105238_10086651 | Ga0105238_100866512 | 179 |
| 254 | 3300010375 | Ga0105239_10019844 | Ga0105239_100198447 | 179 |
| 255 | 3300011119 | Ga0105246_10340721 | Ga0105246_103407212 | 179 |
| 256 | 3300013297 | Ga0157378_10289454 | Ga0157378_102894541 | 179 |
| 257 | 3300013308 | Ga0157375_10644913 | Ga0157375_106449132 | 179 |
| 258 | 3300014326 | Ga0157380_10245118 | Ga0157380_102451182 | 179 |
| 259 | 3300014968 | Ga0157379_10142098 | Ga0157379_101420984 | 179 |
| 260 | 3300017792 | Ga0163161_10838422 | Ga0163161_108384221 | 179 |
| 261 | 3300025321 | Ga0207656_10009540 | Ga0207656_100095402 | 179 |
| 262 | 3300025907 | Ga0207645_10248388 | Ga0207645_102483881 | 179 |
| 263 | 3300025909 | Ga0207705_10339689 | Ga0207705_103396892 | 179 |
| 264 | 3300025912 | Ga0207707_10001050 | Ga0207707_100010504 | 179 |
| 265 | 3300025917 | Ga0207660_10008627 | Ga0207660_100086272 | 179 |
| 266 | 3300025920 | Ga0207649_10271431 | Ga0207649_102714311 | 179 |
| 267 | 3300025921 | Ga0207652_10089128 | Ga0207652_100891282 | 179 |
| 268 | 3300025923 | Ga0207681_10307526 | Ga0207681_103075262 | 179 |
| 269 | 3300025927 | Ga0207687_10169337 | Ga0207687_101693372 | 179 |
| 270 | 3300025933 | Ga0207706_10075238 | Ga0207706_100752382 | 179 |
| 271 | 3300025933 | Ga0207706_10475095 | Ga0207706_104750952 | 179 |
| 272 | 3300025934 | Ga0207686_10716299 | Ga0207686_107162991 | 179 |
| 273 | 3300025935 | Ga0207709_10011375 | Ga0207709_100113754 | 179 |
| 274 | 3300025935 | Ga0207709_10118646 | Ga0207709_101186462 | 179 |
| 275 | 3300025937 | Ga0207669_10008753 | Ga0207669_100087533 | 179 |
| 276 | 3300025938 | Ga0207704_10014566 | Ga0207704_100145664 | 179 |
| 277 | 3300025942 | Ga0207689_10046303 | Ga0207689_100463034 | 179 |
| 278 | 3300025945 | Ga0207679_10226208 | Ga0207679_102262082 | 179 |
| 279 | 3300025945 | Ga0207679_11186801 | Ga0207679_111868011 | 179 |
| 280 | 3300025961 | Ga0207712_10033048 | Ga0207712_100330482 | 179 |
| 281 | 3300025972 | Ga0207668_10390102 | Ga0207668_103901022 | 179 |
| 282 | 3300025981 | Ga0207640_10216320 | Ga0207640_102163202 | 179 |
| 283 | 3300025981 | Ga0207640_10926028 | Ga0207640_109260281 | 179 |
| 284 | 3300026023 | Ga0207677_10286338 | Ga0207677_102863382 | 179 |
| 285 | 3300026035 | Ga0207703_10060703 | Ga0207703_100607031 | 179 |
| 286 | 3300026067 | Ga0207678_10031422 | Ga0207678_100314224 | 179 |
| 287 | 3300026067 | Ga0207678_10048031 | Ga0207678_100480313 | 179 |
| 288 | 3300026067 | Ga0207678_10171594 | Ga0207678_101715942 | 179 |
| 289 | 3300026067 | Ga0207678_10178225 | Ga0207678_101782252 | 179 |
| 290 | 3300026116 | Ga0207674_10016517 | Ga0207674_100165177 | 179 |
| 291 | 3300026118 | Ga0207675_100104446 | Ga0207675_1001044464 | 179 |
| 292 | 3300026121 | Ga0207683_10422406 | Ga0207683_104224061 | 179 |
| 293 | 3300026142 | Ga0207698_10081852 | Ga0207698_100818522 | 179 |
| 294 | 3300028379 | Ga0268266_10002006 | Ga0268266_1000200618 | 179 |
| 295 | 3300028379 | Ga0268266_10002738 | Ga0268266_1000273812 | 179 |
| 296 | 3300028379 | Ga0268266_10482106 | Ga0268266_104821062 | 179 |
| 297 | 3300028380 | Ga0268265_10205861 | Ga0268265_102058612 | 179 |
| 298 | 3300028380 | Ga0268265_10250093 | Ga0268265_102500932 | 179 |
| 299 | 3300028380 | Ga0268265_10773774 | Ga0268265_107737741 | 179 |
| 300 | 3300028380 | Ga0268265_11337056 | Ga0268265_113370562 | 179 |
| 301 | 3300028558 | Ga0265326_10008483 | Ga0265326_100084832 | 179 |
| 302 | 3300028563 | Ga0265319_1001409 | Ga0265319_10014093 | 179 |
| 303 | 3300028573 | Ga0265334_10006596 | Ga0265334_100065964 | 179 |
| 304 | 3300028577 | Ga0265318_10002397 | Ga0265318_1000239710 | 179 |
| 305 | 3300028653 | Ga0265323_10001183 | Ga0265323_100011837 | 179 |
| 306 | 3300028666 | Ga0265336_10000459 | Ga0265336_100004593 | 179 |
| 307 | 3300028786 | Ga0307517_10002574 | Ga0307517_1000257417 | 179 |
| 308 | 3300028786 | Ga0307517_10115520 | Ga0307517_101155203 | 179 |
| 309 | 3300028800 | Ga0265338_10002741 | Ga0265338_1000274120 | 179 |
| 310 | 3300029957 | Ga0265324_10085558 | Ga0265324_100855582 | 179 |
| 311 | 3300031456 | Ga0307513_10296388 | Ga0307513_102963882 | 179 |
| 312 | 3300031548 | Ga0307408_100116061 | Ga0307408_1001160612 | 179 |
| 313 | 3300031852 | Ga0307410_10160018 | Ga0307410_101600182 | 179 |
| 314 | 3300031995 | Ga0307409_100786527 | Ga0307409_1007865272 | 179 |
| 315 | 3300032004 | Ga0307414_11031013 | Ga0307414_110310132 | 179 |
| 316 | 3300032005 | Ga0307411_10079809 | Ga0307411_100798091 | 179 |
| 317 | 3300033180 | Ga0307510_10010125 | Ga0307510_100101252 | 179 |
| 318 | 3300035113 | Ga0373936_0161980 | Ga0373936_0161980_44_583 | 179 |
| 319 | 3300035117 | Ga0373953_0018839 | Ga0373953_0018839_1459_2046 | 179 |
| 320 | 3300035118 | Ga0373954_0000308 | Ga0373954_0000308_15504_16091 | 179 |
| 321 | 3300035119 | Ga0373956_0060455 | Ga0373956_0060455_158_745 | 179 |
| 322 | 3300035120 | Ga0373957_0004737 | Ga0373957_0004737_1366_1953 | 179 |
| 323 | 3300035172 | Ga0373955_0000625 | Ga0373955_0000625_957_1544 | 179 |
| 324 | 3300035207 | Ga0373942_0018588 | Ga0373942_0018588_448_1011 | 179 |
| 325 | 3300035410 | Ga0373924_0001037 | Ga0373924_0001037_2251_2838 | 179 |
| 326 | 3300035724 | Ga0373933_0003162 | Ga0373933_0003162_7658_8245 | 179 |
| 327 | 3300036401 | Ga0373937_0013852 | Ga0373937_0013852_5479_6066 | 179 |
| 328 | 3300037068 | Ga0373925_0483448 | Ga0373925_0483448_57_596 | 179 |
| 329 | 3300046452 | Ga0495617_019921 | Ga0495617_019921_1564_2103 | 179 |
| 330 | 3300046454 | Ga0495592_0001710 | Ga0495592_0001710_13573_14160 | 179 |
| 331 | 3300046455 | Ga0495603_0045203 | Ga0495603_0045203_1290_1829 | 179 |
| 332 | 3300046459 | Ga0495629_0000348 | Ga0495629_0000348_17620_18207 | 179 |
| 333 | 3300046462 | Ga0495651_0003574 | Ga0495651_0003574_11244_11831 | 179 |
| 334 | 3300046463 | Ga0495653_0002076 | Ga0495653_0002076_13964_14551 | 179 |
| 335 | 3300046472 | Ga0495580_0296820 | Ga0495580_0296820_233_772 | 179 |
| 336 | 3300046499 | Ga0495594_0023235 | Ga0495594_0023235_1858_2397 | 179 |
| 337 | 3300046501 | Ga0495607_0122695 | Ga0495607_0122695_625_1164 | 179 |
| 338 | 3300046511 | Ga0495608_0000368 | Ga0495608_0000368_15376_15963 | 179 |
| 339 | 3300046513 | Ga0495616_0115685 | Ga0495616_0115685_261_800 | 179 |
| 340 | 3300046514 | Ga0495618_0018215 | Ga0495618_0018215_2485_3072 | 179 |
| 341 | 3300046525 | Ga0495663_0134484 | Ga0495663_0134484_32_571 | 179 |
| 342 | 3300046529 | Ga0495652_0081837 | Ga0495652_0081837_1855_2442 | 179 |
| 343 | 3300046536 | Ga0495587_0001529 | Ga0495587_0001529_13724_14311 | 179 |
| 344 | 3300046539 | Ga0495621_0063101 | Ga0495621_0063101_278_817 | 179 |
| 345 | 3300046543 | Ga0495645_0008041 | Ga0495645_0008041_649_1236 | 179 |
| 346 | 3300046559 | Ga0495667_0000778 | Ga0495667_0000778_18945_19532 | 179 |
| 347 | 3300046615 | Ga0495656_0004904 | Ga0495656_0004904_1618_2157 | 179 |
| 348 | 3300046615 | Ga0495656_0017632 | Ga0495656_0017632_35_574 | 179 |
| 349 | 3300046615 | Ga0495656_0018685 | Ga0495656_0018685_688_1227 | 179 |
| 350 | 3300046616 | Ga0495668_0035000 | Ga0495668_0035000_2024_2611 | 179 |
| 351 | 3300046642 | Ga0495634_0014193 | Ga0495634_0014193_4532_5119 | 179 |
| 352 | 3300046648 | Ga0495611_0024765 | Ga0495611_0024765_1898_2437 | 179 |
| 353 | 3300046663 | Ga0495635_0000372 | Ga0495635_0000372_12293_12880 | 179 |
| 354 | 3300046664 | Ga0495659_0060726 | Ga0495659_0060726_124_663 | 179 |
| 355 | 3300046678 | Ga0495599_0003226 | Ga0495599_0003226_140_727 | 179 |
| 356 | 3300046679 | Ga0495623_0043995 | Ga0495623_0043995_1210_1797 | 179 |
| 357 | 3300046680 | Ga0495646_0002558 | Ga0495646_0002558_5909_6496 | 179 |
| 358 | 3300046684 | Ga0495669_0013307 | Ga0495669_0013307_1735_2274 | 179 |
| 359 | 3300046684 | Ga0495669_0030494 | Ga0495669_0030494_1372_1911 | 179 |
| 360 | 3300046691 | Ga0495670_0145764 | Ga0495670_0145764_260_799 | 179 |
| 361 | 3300046794 | Ga0495589_0221158 | Ga0495589_0221158_106_645 | 179 |
| 362 | 3300047317 | Ga0495604_0014529 | Ga0495604_0014529_4740_5327 | 179 |
| 363 | 3300047318 | Ga0495636_0060704 | Ga0495636_0060704_463_1002 | 179 |
| 364 | 3300047318 | Ga0495636_0172139 | Ga0495636_0172139_209_748 | 179 |
| 365 | 3300047318 | Ga0495636_0196690 | Ga0495636_0196690_10_549 | 179 |
| 366 | 3300047322 | Ga0495680_0002581 | Ga0495680_0002581_17707_18294 | 179 |
| 367 | 3300047444 | Ga0495675_0044173 | Ga0495675_0044173_1042_1629 | 179 |
| 368 | 3300047469 | Ga0495673_0174997 | Ga0495673_0174997_262_801 | 179 |
| 369 | 3300047471 | Ga0495684_0001014 | Ga0495684_0001014_21399_21986 | 179 |
| 370 | 3300047673 | Ga0495593_0004444 | Ga0495593_0004444_187_774 | 179 |
| 371 | 3300048088 | Ga0495602_0002140 | Ga0495602_0002140_2428_3015 | 179 |
| 372 | 3300048090 | Ga0495615_0003787 | Ga0495615_0003787_1558_2097 | 179 |
| 373 | 3300048903 | Ga0496100_0182447 | Ga0496100_0182447_383_922 | 179 |
| 374 | 3300048904 | Ga0496101_0075445 | Ga0496101_0075445_214_753 | 179 |
| 375 | 3300048905 | Ga0496102_0131752 | Ga0496102_0131752_484_1023 | 179 |
| 376 | 3300048906 | Ga0496103_0735234 | Ga0496103_0735234_11_550 | 179 |
| 377 | 3300048911 | Ga0496108_0488544 | Ga0496108_0488544_55_630 | 179 |
| 378 | 3300048912 | Ga0496109_0151874 | Ga0496109_0151874_407_982 | 179 |
| 379 | 3300048917 | Ga0496114_1237815 | Ga0496114_1237815_48_587 | 179 |
| 380 | 3300048918 | Ga0496115_0756406 | Ga0496115_0756406_105_644 | 179 |
| 381 | 3300048922 | Ga0496119_0150832 | Ga0496119_0150832_591_1130 | 179 |
| 382 | 3300048924 | Ga0496121_0362399 | Ga0496121_0362399_294_833 | 179 |
| 383 | 3300048928 | Ga0496125_0068442 | Ga0496125_0068442_1190_1729 | 179 |
| 384 | 3300048929 | Ga0496126_0984848 | Ga0496126_0984848_21_578 | 179 |
| 385 | 3300049574 | Ga0501038_0214211 | Ga0501038_0214211_377_916 | 179 |
| 386 | 3300049592 | Ga0501076_0180664 | Ga0501076_0180664_346_885 | 179 |
| 387 | 3300050493 | nmdc:mga0k408_187269_c1 | nmdc:mga0k408_187269_c1_271_1002 | 179 |
| 388 | 3300050511 | nmdc:mga08y16_425849_c1 | nmdc:mga08y16_425849_c1_391_930 | 179 |
| 389 | 3300053077 | Ga0495601_0082883 | Ga0495601_0082883_555_1142 | 179 |
| 390 | 3300053084 | Ga0495595_0001247 | Ga0495595_0001247_8895_9482 | 179 |
| 391 | 3300053085 | Ga0495619_0000563 | Ga0495619_0000563_6237_6824 | 179 |
| 392 | 3300053096 | Ga0500641_0006410 | Ga0500641_0006410_3047_3586 | 179 |
| 393 | 3300053150 | Ga0500603_006249 | Ga0500603_006249_1645_2220 | 179 |
| 394 | 3300053162 | Ga0500638_001732 | Ga0500638_001732_2175_2750 | 179 |
| 395 | 3300053162 | Ga0500638_081847 | Ga0500638_081847_215_778 | 179 |
| 396 | 3300053178 | Ga0500637_0000168 | Ga0500637_0000168_1624_2199 | 179 |
| 397 | 3300055283 | Ga0500661_000293 | Ga0500661_000293_5965_6540 | 179 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ija-assembly1.cif.gz_B | structure of s. aureus methicillin resistance factor mecr2 | 0.9558 | 60 | 119 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9164 | 60 | 120 |
| 2heo-assembly1.cif.gz_A | general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. | 0.9108 | 57 | 119 |
| 2l02-assembly1.cif.gz_A | solution nmr structure of protein bt2368 from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr375 | 0.9076 | 59 | 119 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.9014 | 60 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ijaB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9395 | 60 | 120 | 1.10.10.10 |
| 2xrnA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9247 | 60 | 119 | 1.10.10.10 |
| af_P71977_12_75_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9218 | 59 | 119 | 1.10.10.10 |
| af_P77569_1_73_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9185 | 60 | 120 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9164 | 60 | 120 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C6D109-F1-model_v4 | deleted | 0.9314 | 49 | 160 |
|
| AF-A0A6N9T8Q8-F1-model_v4 | MarR family transcriptional regulator | 0.9284 | 37 | 165 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A6N9T8Q8-F1-model_v4 | MarR family transcriptional regulator | 0.9019 | 37 | 165 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A536WN11-F1-model_v4 | MarR family transcriptional regulator | 0.9001 | 42 | 163 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A2I1DP50-F1-model_v4 | MarR family transcriptional regulator | 0.8927 | 44 | 164 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar