F433889

General Info

Members Datasets Scaffolds Average Seq Length
397 273 388 181

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_187269_c1|nmdc:mga0k408_187269_c1_271_1002
Length 215
Sequence MIFSENRRPLFRIMLWPKACELAKLVASATILNPLAPPASTKIGEILANAVAKPAKGNARLDLFKFVPFRLNRLAAEVSSALSAEYQVRYGLDIPEWRVLATLGFRDHACSAQYIAHCTRTHKSTISRAVTTLMKRQMIERVENADDRREFRLRMTTKGKALYEELIPNLLRREQEILSCLSAQERKNLAALFGKIEASLDLVQTSAEADAKEAY

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
3 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
4 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
5 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
6 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
229 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
262 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
263 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
264 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
265 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
266 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
267 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
268 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
269 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
270 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
271 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
272 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
273 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.05
Nodule 2.02
Rhizoplane 6.3
Rhizosphere 81.36
Stem 0
Stem Tuber 0
Unclassified 3.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10081871 3300002075 Bacteria 676
2 JGI25404J52841_10022235 3300003659 Bacteria 1370
3 Ga0065715_10410964 3300005293 Bacteria 870
4 Ga0070670_100592927 3300005331 Bacteria 991
5 Ga0070680_100052242 3300005336 Bacteria 3336
6 Ga0070682_100284369 3300005337 Bacteria 1207
7 Ga0068868_100436140 3300005338 Bacteria 1137
8 Ga0070660_100009783 3300005339 Bacteria 6755
9 Ga0070691_10037778 3300005341 Bacteria 2279
10 Ga0070661_100366139 3300005344 Bacteria 1134
11 Ga0070675_100142286 3300005354 Bacteria 2051
12 Ga0070671_100274233 3300005355 Bacteria 1434
13 Ga0070674_100084727 3300005356 Bacteria 2273
14 Ga0070673_100964629 3300005364 Bacteria 793
15 Ga0070659_100666801 3300005366 Bacteria 898
16 Ga0070714_100313687 3300005435 Bacteria 1465
17 Ga0070713_100038244 3300005436 Bacteria 3886
18 Ga0070713_100351960 3300005436 Bacteria 1367
19 Ga0070700_100073138 3300005441 Bacteria 2193
20 Ga0070700_101049794 3300005441 Bacteria 673
21 Ga0070708_100779930 3300005445 Bacteria 899
22 Ga0070663_100022315 3300005455 Bacteria 4230
23 Ga0070663_100045675 3300005455 Bacteria 3096
24 Ga0070663_100077282 3300005455 Bacteria 2436
25 Ga0070663_100107908 3300005455 Bacteria 2088
26 Ga0070663_100247518 3300005455 Bacteria 1410
27 Ga0070663_100356163 3300005455 Bacteria 1186
28 Ga0070678_100027180 3300005456 Bacteria 3882
29 Ga0070678_100130340 3300005456 Bacteria 1997
30 Ga0070662_100070598 3300005457 Bacteria 2574
31 Ga0070681_10020406 3300005458 Bacteria 6641
32 Ga0070681_10024092 3300005458 Bacteria 6127
33 Ga0068867_100281966 3300005459 Bacteria 1363
34 Ga0068867_100443147 3300005459 Bacteria 1105
35 Ga0070698_100249502 3300005471 Bacteria 1708
36 Ga0070679_100140520 3300005530 Bacteria 2394
37 Ga0070684_100048558 3300005535 Bacteria 3682
38 Ga0070697_101180672 3300005536 Bacteria 682
39 Ga0068853_100007556 3300005539 Bacteria 8700
40 Ga0068853_100252531 3300005539 Bacteria 1618
41 Ga0068853_100406096 3300005539 Bacteria 1276
42 Ga0068853_100467990 3300005539 Bacteria 1187
43 Ga0068853_101003069 3300005539 Bacteria 804
44 Ga0070665_100011218 3300005548 Bacteria 9061
45 Ga0070665_100082768 3300005548 Bacteria 3214
46 Ga0070665_100155855 3300005548 Bacteria 2286
47 Ga0070665_100163739 3300005548 Bacteria 2226
48 Ga0070665_100603409 3300005548 Bacteria 1111
49 Ga0070664_100582413 3300005564 Bacteria 1037
50 Ga0070664_100851413 3300005564 Bacteria 854
51 Ga0068857_100012153 3300005577 Bacteria 7490
52 Ga0068854_100522597 3300005578 Bacteria 1003
53 Ga0068856_101008444 3300005614 Bacteria 851
54 Ga0070702_100109992 3300005615 Bacteria 1707
55 Ga0068852_100049008 3300005616 Bacteria 3612
56 Ga0068852_100243559 3300005616 Bacteria 1720
57 Ga0068852_100453038 3300005616 Bacteria 1270
58 Ga0068859_100052455 3300005617 Bacteria 4100
59 Ga0068859_100194158 3300005617 Bacteria 2114
60 Ga0068864_100665624 3300005618 Bacteria 1015
61 Ga0068861_100085153 3300005719 Bacteria 2482
62 Ga0068861_100689300 3300005719 Bacteria 948
63 Ga0068851_10012271 3300005834 Bacteria 4035
64 Ga0068851_10304449 3300005834 Bacteria 917
65 Ga0068863_100460623 3300005841 Bacteria 1249
66 Ga0068863_101067052 3300005841 Bacteria 812
67 Ga0068858_100171532 3300005842 Bacteria 2045
68 Ga0068858_100279545 3300005842 Bacteria 1589
69 Ga0068858_100708057 3300005842 Bacteria 980
70 Ga0068858_100827283 3300005842 Bacteria 904
71 Ga0068862_100243746 3300005844 Bacteria 1635
72 Ga0068862_100465977 3300005844 Bacteria 1193
73 Ga0081538_10048665 3300005981 Bacteria 2581
74 Ga0081538_10056728 3300005981 Bacteria 2291
75 Ga0081540_1003142 3300005983 Bacteria 13197
76 Ga0081540_1006347 3300005983 Bacteria 8636
77 Ga0081540_1032727 3300005983 Bacteria 2834
78 Ga0081540_1047121 3300005983 Bacteria 2170
79 Ga0075365_10281454 3300006038 Bacteria 1170
80 Ga0075363_100003491 3300006048 Bacteria 6694
81 Ga0075364_10091336 3300006051 Bacteria 2020
82 Ga0075432_10238181 3300006058 Bacteria 734
83 Ga0070716_100262730 3300006173 Bacteria 1182
84 Ga0075362_10141874 3300006177 Bacteria 1148
85 Ga0075367_10002314 3300006178 Bacteria 8656
86 Ga0075367_10089310 3300006178 Bacteria 1873
87 Ga0075367_10190850 3300006178 Bacteria 1278
88 Ga0075369_10036501 3300006186 Bacteria 2091
89 Ga0075369_10060624 3300006186 Bacteria 1650
90 Ga0075366_10025892 3300006195 Bacteria 3431
91 Ga0075366_10114107 3300006195 Bacteria 1627
92 Ga0075370_10015254 3300006353 Bacteria 4109
93 Ga0075370_10179793 3300006353 Bacteria 1244
94 Ga0068871_100166607 3300006358 Bacteria 1887
95 Ga0075428_100154775 3300006844 Bacteria 2491
96 Ga0068865_100017682 3300006881 Bacteria 4589
97 Ga0097620_100052457 3300006931 Bacteria 4100
98 Ga0097620_100137735 3300006931 Bacteria 2515
99 Ga0097620_100194183 3300006931 Bacteria 2114
100 Ga0111539_10095400 3300009094 Bacteria 3493
101 Ga0114129_11217745 3300009147 Bacteria 937
102 Ga0105243_10035721 3300009148 Bacteria 3853
103 Ga0105243_10893310 3300009148 Bacteria 883
104 Ga0105241_10303134 3300009174 Bacteria 1372
105 Ga0105242_10187680 3300009176 Bacteria 1828
106 Ga0105242_11430565 3300009176 Bacteria 720
107 Ga0105248_10233854 3300009177 Bacteria 2069
108 Ga0105237_10149559 3300009545 Bacteria 2331
109 Ga0105237_10168697 3300009545 Bacteria 2188
110 Ga0105238_10086651 3300009551 Bacteria 3119
111 Ga0105239_10019844 3300010375 Bacteria 7417
112 Ga0105239_10165739 3300010375 Bacteria 2470
113 Ga0105246_10340721 3300011119 Bacteria 1225
114 Ga0105246_10426592 3300011119 Bacteria 1108
115 Ga0157370_10216068 3300013104 Bacteria 1776
116 Ga0157369_10071598 3300013105 Bacteria 3721
117 Ga0157378_10289454 3300013297 Bacteria 1582
118 Ga0157375_10644913 3300013308 Bacteria 1215
119 Ga0157375_10939641 3300013308 Bacteria 1007
120 Ga0157375_11421004 3300013308 Bacteria 818
121 Ga0157380_10245118 3300014326 Bacteria 1618
122 Ga0157379_10142098 3300014968 Bacteria 2164
123 Ga0163161_10838422 3300017792 Bacteria 775
124 Ga0207656_10009540 3300025321 Bacteria 3606
125 Ga0207645_10248388 3300025907 Bacteria 1177
126 Ga0207705_10339689 3300025909 Bacteria 1156
127 Ga0207707_10001050 3300025912 Bacteria 26502
128 Ga0207671_10017229 3300025914 Bacteria 5580
129 Ga0207671_10120698 3300025914 Bacteria 2003
130 Ga0207693_10042933 3300025915 Bacteria 3559
131 Ga0207660_10008627 3300025917 Bacteria 6593
132 Ga0207649_10271431 3300025920 Bacteria 1229
133 Ga0207652_10089128 3300025921 Bacteria 2708
134 Ga0207646_10420902 3300025922 Bacteria 1206
135 Ga0207681_10307526 3300025923 Bacteria 1256
136 Ga0207687_10024723 3300025927 Bacteria 4015
137 Ga0207687_10169337 3300025927 Bacteria 1683
138 Ga0207700_10004470 3300025928 Bacteria 8250
139 Ga0207700_10024372 3300025928 Bacteria 4187
140 Ga0207664_10198828 3300025929 Bacteria 1729
141 Ga0207664_10229781 3300025929 Bacteria 1612
142 Ga0207664_10443991 3300025929 Bacteria 1157
143 Ga0207706_10075238 3300025933 Bacteria 2969
144 Ga0207706_10475095 3300025933 Bacteria 1080
145 Ga0207686_10132684 3300025934 Bacteria 1710
146 Ga0207686_10716299 3300025934 Bacteria 796
147 Ga0207709_10011375 3300025935 Bacteria 4909
148 Ga0207709_10118646 3300025935 Bacteria 1782
149 Ga0207669_10008753 3300025937 Bacteria 4772
150 Ga0207704_10014566 3300025938 Bacteria 3974
151 Ga0207711_10873507 3300025941 Bacteria 836
152 Ga0207689_10046303 3300025942 Bacteria 3595
153 Ga0207661_10766209 3300025944 Bacteria 888
154 Ga0207679_10226208 3300025945 Bacteria 1577
155 Ga0207679_11186801 3300025945 Bacteria 700
156 Ga0207712_10033048 3300025961 Bacteria 3495
157 Ga0207668_10390102 3300025972 Bacteria 1174
158 Ga0207640_10216320 3300025981 Bacteria 1464
159 Ga0207640_10926028 3300025981 Bacteria 763
160 Ga0207677_10286338 3300026023 Bacteria 1355
161 Ga0207703_10060703 3300026035 Bacteria 3092
162 Ga0207639_10088791 3300026041 Bacteria 2468
163 Ga0207639_10166038 3300026041 Bacteria 1865
164 Ga0207639_10571828 3300026041 Bacteria 1040
165 Ga0207678_10031422 3300026067 Bacteria 4632
166 Ga0207678_10048031 3300026067 Bacteria 3690
167 Ga0207678_10171594 3300026067 Bacteria 1852
168 Ga0207678_10178225 3300026067 Bacteria 1815
169 Ga0207678_10494415 3300026067 Bacteria 1066
170 Ga0207678_10545993 3300026067 Bacteria 1013
171 Ga0207702_11234502 3300026078 Bacteria 742
172 Ga0207676_10703607 3300026095 Bacteria 979
173 Ga0207674_10016517 3300026116 Bacteria 8077
174 Ga0207675_100104446 3300026118 Bacteria 2670
175 Ga0207683_10422406 3300026121 Bacteria 1228
176 Ga0207698_10081852 3300026142 Bacteria 2608
177 Ga0207698_10082098 3300026142 Bacteria 2604
178 Ga0207698_10514272 3300026142 Bacteria 1167
179 Ga0268266_10002006 3300028379 Bacteria 22754
180 Ga0268266_10002738 3300028379 Bacteria 18434
181 Ga0268266_10425305 3300028379 Bacteria 1259
182 Ga0268266_10482106 3300028379 Bacteria 1182
183 Ga0268265_10205861 3300028380 Bacteria 1710
184 Ga0268265_10250093 3300028380 Bacteria 1569
185 Ga0268265_10773774 3300028380 Bacteria 933
186 Ga0268265_11337056 3300028380 Bacteria 717
187 Ga0265326_10008483 3300028558 Bacteria 3098
188 Ga0265319_1001409 3300028563 Bacteria 14410
189 Ga0265334_10006596 3300028573 Bacteria 4995
190 Ga0265318_10002397 3300028577 Bacteria 10036
191 Ga0265323_10001183 3300028653 Bacteria 13288
192 Ga0265336_10000459 3300028666 Bacteria 24631
193 Ga0307517_10002574 3300028786 Bacteria 28885
194 Ga0307517_10115520 3300028786 Bacteria 2014
195 Ga0265338_10002741 3300028800 Bacteria 25847
196 Ga0265324_10085558 3300029957 Bacteria 1072
197 Ga0265330_10015957 3300031235 Bacteria 3471
198 Ga0265328_10178813 3300031239 Bacteria 802
199 Ga0265331_10018556 3300031250 Bacteria 3605
200 Ga0265316_10454402 3300031344 Bacteria 918
201 Ga0307513_10240214 3300031456 Bacteria 1617
202 Ga0307513_10296388 3300031456 Bacteria 1386
203 Ga0307408_100116061 3300031548 Bacteria 2066
204 Ga0265314_10056061 3300031711 Bacteria 2715
205 Ga0265342_10020456 3300031712 Bacteria 4244
206 Ga0307410_10160018 3300031852 Bacteria 1686
207 Ga0307409_100786527 3300031995 Bacteria 958
208 Ga0307416_100872145 3300032002 Bacteria 999
209 Ga0307414_11031013 3300032004 Bacteria 758
210 Ga0307411_10079809 3300032005 Bacteria 2248
211 Ga0307510_10010125 3300033180 Bacteria 11211
212 Ga0373930_0011290 3300034816 Bacteria 1611
213 Ga0373929_0018975 3300035085 Bacteria 1372
214 Ga0373936_0003033 3300035113 Bacteria 6278
215 Ga0373936_0161980 3300035113 Bacteria 975
216 Ga0373941_0035725 3300035115 Bacteria 1507
217 Ga0373953_0018839 3300035117 Bacteria 2560
218 Ga0373953_0147794 3300035117 Bacteria 1006
219 Ga0373954_0000308 3300035118 Bacteria 17778
220 Ga0373954_0066522 3300035118 Bacteria 1706
221 Ga0373956_0060455 3300035119 Bacteria 1715
222 Ga0373957_0004737 3300035120 Bacteria 4163
223 Ga0373943_0032413 3300035170 Bacteria 2484
224 Ga0373946_0051299 3300035171 Bacteria 1726
225 Ga0373955_0000625 3300035172 Bacteria 15149
226 Ga0373955_0052688 3300035172 Bacteria 2220
227 Ga0373942_0018588 3300035207 Bacteria 1727
228 Ga0373962_0142707 3300035242 Bacteria 779
229 Ga0373924_0001037 3300035410 Bacteria 8827
230 Ga0373931_0020458 3300035691 Bacteria 3312
231 Ga0373935_0000119 3300035692 Bacteria 35716
232 Ga0373927_0000641 3300035695 Bacteria 26496
233 Ga0373927_0228228 3300035695 Bacteria 1223
234 Ga0373933_0003162 3300035724 Bacteria 9197
235 Ga0373947_0001785 3300035725 Bacteria 13162
236 Ga0373937_0013852 3300036401 Bacteria 7107
237 Ga0373937_0014783 3300036401 Bacteria 6892
238 Ga0373925_0002584 3300037068 Bacteria 14399
239 Ga0373925_0053921 3300037068 Bacteria 3007
240 Ga0373925_0483448 3300037068 Bacteria 1016
241 Ga0373925_1361569 3300037068 Bacteria 582
242 Ga0395905_0253741 3300037471 Bacteria 1643
243 Ga0436365_1340371 3300039437 Bacteria 899
244 Ga0451853_3034735 3300041512 Bacteria 845
245 Ga0466966_0403070 3300044684 Bacteria 822
246 Ga0466964_0252429 3300044706 Bacteria 870
247 Ga0466959_0054677 3300045049 Bacteria 2916
248 Ga0466958_0077722 3300045836 Bacteria 2039
249 Ga0495617_019921 3300046452 Bacteria 2267
250 Ga0495592_0001710 3300046454 Bacteria 15422
251 Ga0495592_0009597 3300046454 Bacteria 7283
252 Ga0495603_0045203 3300046455 Bacteria 2626
253 Ga0495629_0000348 3300046459 Bacteria 39364
254 Ga0495629_0000353 3300046459 Bacteria 39092
255 Ga0495641_0000972 3300046461 Bacteria 24598
256 Ga0495651_0003574 3300046462 Bacteria 11925
257 Ga0495653_0002076 3300046463 Bacteria 15760
258 Ga0495653_0704165 3300046463 Bacteria 613
259 Ga0495580_0004944 3300046472 Bacteria 11142
260 Ga0495580_0296820 3300046472 Bacteria 1101
261 Ga0495582_0080328 3300046473 Bacteria 1810
262 Ga0495639_0000177 3300046475 Bacteria 33573
263 Ga0495662_0000461 3300046476 Bacteria 18377
264 Ga0495664_0006586 3300046477 Bacteria 6419
265 Ga0495594_0000079 3300046499 Bacteria 42880
266 Ga0495594_0023235 3300046499 Bacteria 3321
267 Ga0495607_0122695 3300046501 Bacteria 1362
268 Ga0495608_0000368 3300046511 Bacteria 31510
269 Ga0495616_0115685 3300046513 Bacteria 1242
270 Ga0495618_0018215 3300046514 Bacteria 4312
271 Ga0495618_0250039 3300046514 Bacteria 1112
272 Ga0495630_0001616 3300046517 Bacteria 15677
273 Ga0495630_0717232 3300046517 Bacteria 765
274 Ga0495663_0134484 3300046525 Bacteria 836
275 Ga0495666_0384790 3300046526 Bacteria 631
276 Ga0495652_0081837 3300046529 Bacteria 2662
277 Ga0495652_0158696 3300046529 Bacteria 1758
278 Ga0495665_0000570 3300046531 Bacteria 18750
279 Ga0495665_0288038 3300046531 Bacteria 842
280 Ga0495640_0001386 3300046533 Bacteria 19082
281 Ga0495586_0076568 3300046535 Bacteria 1833
282 Ga0495587_0001529 3300046536 Bacteria 15391
283 Ga0495621_0063101 3300046539 Bacteria 1349
284 Ga0495645_0008041 3300046543 Bacteria 7344
285 Ga0495645_0493123 3300046543 Bacteria 767
286 Ga0495622_0002449 3300046557 Bacteria 8997
287 Ga0495667_0000778 3300046559 Bacteria 20484
288 Ga0495667_0015301 3300046559 Bacteria 5181
289 Ga0495656_0004904 3300046615 Bacteria 4606
290 Ga0495656_0017632 3300046615 Bacteria 2727
291 Ga0495656_0018685 3300046615 Bacteria 2667
292 Ga0495668_0035000 3300046616 Bacteria 2815
293 Ga0495634_0000334 3300046642 Bacteria 45432
294 Ga0495634_0014193 3300046642 Bacteria 5747
295 Ga0495611_0024765 3300046648 Bacteria 2612
296 Ga0495625_0188894 3300046660 Bacteria 1366
297 Ga0495625_0495523 3300046660 Bacteria 748
298 Ga0495635_0000372 3300046663 Bacteria 28497
299 Ga0495635_0000477 3300046663 Bacteria 25298
300 Ga0495659_0060726 3300046664 Bacteria 1395
301 Ga0495599_0003226 3300046678 Bacteria 9493
302 Ga0495599_0233312 3300046678 Bacteria 1123
303 Ga0495623_0043995 3300046679 Bacteria 2838
304 Ga0495646_0002558 3300046680 Bacteria 11178
305 Ga0495647_0003566 3300046681 Bacteria 4989
306 Ga0495658_0000416 3300046683 Bacteria 23941
307 Ga0495669_0013307 3300046684 Bacteria 3504
308 Ga0495669_0030494 3300046684 Bacteria 2367
309 Ga0495613_0005732 3300046689 Bacteria 9304
310 Ga0495624_0001221 3300046690 Bacteria 20262
311 Ga0495670_0145764 3300046691 Bacteria 1240
312 Ga0495589_0221158 3300046794 Bacteria 889
313 Ga0495581_0000477 3300047315 Bacteria 20433
314 Ga0495581_0153686 3300047315 Bacteria 1344
315 Ga0495604_0014529 3300047317 Bacteria 6279
316 Ga0495604_0367477 3300047317 Bacteria 953
317 Ga0495636_0060704 3300047318 Bacteria 1598
318 Ga0495636_0172139 3300047318 Bacteria 979
319 Ga0495636_0196690 3300047318 Bacteria 919
320 Ga0495674_0000533 3300047319 Bacteria 35160
321 Ga0495674_0226505 3300047319 Bacteria 1544
322 Ga0495680_0002581 3300047322 Bacteria 18442
323 Ga0495680_0474926 3300047322 Bacteria 852
324 Ga0495675_0044173 3300047444 Bacteria 2838
325 Ga0495673_0174997 3300047469 Bacteria 816
326 Ga0495684_0001014 3300047471 Bacteria 22867
327 Ga0495593_0001154 3300047673 Bacteria 15412
328 Ga0495593_0004444 3300047673 Bacteria 8330
329 Ga0495602_0002140 3300048088 Bacteria 19931
330 Ga0495602_0181142 3300048088 Bacteria 1625
331 Ga0495614_0005404 3300048089 Bacteria 5764
332 Ga0495614_0274160 3300048089 Bacteria 776
333 Ga0495615_0003787 3300048090 Bacteria 2571
334 Ga0496100_0182447 3300048903 Bacteria 1518
335 Ga0496101_0075445 3300048904 Bacteria 2482
336 Ga0496101_0497205 3300048904 Bacteria 963
337 Ga0496102_0096464 3300048905 Bacteria 2741
338 Ga0496102_0131752 3300048905 Bacteria 2341
339 Ga0496103_0011840 3300048906 Bacteria 5177
340 Ga0496103_0735234 3300048906 Bacteria 624
341 Ga0496104_0063943 3300048907 Bacteria 3490
342 Ga0496105_0023168 3300048908 Bacteria 5034
343 Ga0496106_0172617 3300048909 Bacteria 1714
344 Ga0496108_0052485 3300048911 Bacteria 3417
345 Ga0496108_0488544 3300048911 Bacteria 1075
346 Ga0496109_0095294 3300048912 Bacteria 2755
347 Ga0496109_0151874 3300048912 Bacteria 2168
348 Ga0496110_0319369 3300048913 Bacteria 1414
349 Ga0496110_1166490 3300048913 Bacteria 679
350 Ga0496111_0069157 3300048914 Bacteria 2567
351 Ga0496112_0026725 3300048915 Bacteria 5560
352 Ga0496112_0267929 3300048915 Bacteria 1656
353 Ga0496113_0179428 3300048916 Bacteria 1678
354 Ga0496114_0092048 3300048917 Bacteria 2576
355 Ga0496114_0218270 3300048917 Bacteria 1673
356 Ga0496114_1237815 3300048917 Bacteria 633
357 Ga0496115_0061669 3300048918 Bacteria 3023
358 Ga0496115_0756406 3300048918 Bacteria 759
359 Ga0496119_0106311 3300048922 Bacteria 1566
360 Ga0496119_0150832 3300048922 Bacteria 1246
361 Ga0496121_0362399 3300048924 Bacteria 962
362 Ga0496125_0068442 3300048928 Bacteria 2793
363 Ga0496126_0984848 3300048929 Bacteria 634
364 Ga0501038_0214211 3300049574 Bacteria 1540
365 Ga0501042_0447434 3300049578 Bacteria 937
366 Ga0501067_0133458 3300049583 Bacteria 1382
367 Ga0501076_0180664 3300049592 Bacteria 1720
368 nmdc:mga0yw44_272192_c1 3300050492 Bacteria 1131
369 nmdc:mga0k408_187269_c1 3300050493 Bacteria 1234
370 nmdc:mga08y16_425849_c1 3300050511 Bacteria 1356
371 Ga0495601_0063470 3300053077 Bacteria 2348
372 Ga0495601_0082883 3300053077 Bacteria 2059
373 Ga0495612_0093142 3300053078 Bacteria 1278
374 Ga0500635_0034855 3300053080 Bacteria 1651
375 Ga0495595_0001247 3300053084 Bacteria 9910
376 Ga0495619_0000563 3300053085 Bacteria 24565
377 Ga0500641_0006410 3300053096 Bacteria 4177
378 Ga0500572_000057 3300053111 Bacteria 33904
379 Ga0500559_0000219 3300053136 Bacteria 45843
380 Ga0500603_006249 3300053150 Bacteria 2585
381 Ga0500620_033906 3300053155 Bacteria 1636
382 Ga0500638_001732 3300053162 Bacteria 7123
383 Ga0500638_081847 3300053162 Bacteria 1532
384 Ga0500637_0000168 3300053178 Bacteria 24363
385 Ga0500576_026268 3300053725 Bacteria 2656
386 Ga0500596_001061 3300053735 Bacteria 5538
387 Ga0500661_000293 3300055283 Bacteria 9112
388 Ga0500661_050014 3300055283 Bacteria 746

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100313687 Ga0070714_1003136871 167
2 3300006186 Ga0075369_10060624 Ga0075369_100606242 167
3 3300006353 Ga0075370_10179793 Ga0075370_101797932 167
4 3300025928 Ga0207700_10024372 Ga0207700_100243722 167
5 3300025929 Ga0207664_10229781 Ga0207664_102297812 167
6 3300031235 Ga0265330_10015957 Ga0265330_100159573 167
7 3300031239 Ga0265328_10178813 Ga0265328_101788131 167
8 3300031250 Ga0265331_10018556 Ga0265331_100185564 167
9 3300031344 Ga0265316_10454402 Ga0265316_104544022 167
10 3300031712 Ga0265342_10020456 Ga0265342_100204566 167
11 3300032002 Ga0307416_100872145 Ga0307416_1008721452 167
12 3300041512 Ga0451853_3034735 Ga0451853_3034735_90_671 167
13 3300048088 Ga0495602_0181142 Ga0495602_0181142_544_1077 167
14 3300048917 Ga0496114_0092048 Ga0496114_0092048_177_758 167
15 3300050492 nmdc:mga0yw44_272192_c1 nmdc:mga0yw44_272192_c1_242_829 167
16 3300005293 Ga0065715_10410964 Ga0065715_104109641 172
17 3300005338 Ga0068868_100436140 Ga0068868_1004361401 172
18 3300005539 Ga0068853_100252531 Ga0068853_1002525312 172
19 3300009174 Ga0105241_10303134 Ga0105241_103031341 172
20 3300009545 Ga0105237_10149559 Ga0105237_101495592 172
21 3300010375 Ga0105239_10165739 Ga0105239_101657392 172
22 3300011119 Ga0105246_10426592 Ga0105246_104265922 172
23 3300013308 Ga0157375_10939641 Ga0157375_109396412 172
24 3300025915 Ga0207693_10042933 Ga0207693_100429333 172
25 3300025929 Ga0207664_10443991 Ga0207664_104439912 172
26 3300025934 Ga0207686_10132684 Ga0207686_101326842 172
27 3300026041 Ga0207639_10571828 Ga0207639_105718282 172
28 3300034816 Ga0373930_0011290 Ga0373930_0011290_107_661 172
29 3300035085 Ga0373929_0018975 Ga0373929_0018975_226_780 172
30 3300035113 Ga0373936_0003033 Ga0373936_0003033_1356_1892 172
31 3300035115 Ga0373941_0035725 Ga0373941_0035725_102_656 172
32 3300035117 Ga0373953_0147794 Ga0373953_0147794_117_653 172
33 3300035118 Ga0373954_0066522 Ga0373954_0066522_145_681 172
34 3300035170 Ga0373943_0032413 Ga0373943_0032413_98_634 172
35 3300035171 Ga0373946_0051299 Ga0373946_0051299_735_1271 172
36 3300035172 Ga0373955_0052688 Ga0373955_0052688_322_858 172
37 3300035242 Ga0373962_0142707 Ga0373962_0142707_139_693 172
38 3300035691 Ga0373931_0020458 Ga0373931_0020458_773_1327 172
39 3300035692 Ga0373935_0000119 Ga0373935_0000119_28214_28750 172
40 3300035695 Ga0373927_0000641 Ga0373927_0000641_7254_7790 172
41 3300035695 Ga0373927_0228228 Ga0373927_0228228_523_1077 172
42 3300035725 Ga0373947_0001785 Ga0373947_0001785_12233_12769 172
43 3300036401 Ga0373937_0014783 Ga0373937_0014783_424_960 172
44 3300037068 Ga0373925_0002584 Ga0373925_0002584_7957_8493 172
45 3300037471 Ga0395905_0253741 Ga0395905_0253741_877_1401 172
46 3300046454 Ga0495592_0009597 Ga0495592_0009597_374_910 172
47 3300046459 Ga0495629_0000353 Ga0495629_0000353_24179_24715 172
48 3300046461 Ga0495641_0000972 Ga0495641_0000972_17686_18222 172
49 3300046463 Ga0495653_0704165 Ga0495653_0704165_18_554 172
50 3300046472 Ga0495580_0004944 Ga0495580_0004944_10212_10748 172
51 3300046473 Ga0495582_0080328 Ga0495582_0080328_881_1417 172
52 3300046475 Ga0495639_0000177 Ga0495639_0000177_14378_14914 172
53 3300046476 Ga0495662_0000461 Ga0495662_0000461_6056_6592 172
54 3300046477 Ga0495664_0006586 Ga0495664_0006586_1379_1915 172
55 3300046499 Ga0495594_0000079 Ga0495594_0000079_23597_24133 172
56 3300046514 Ga0495618_0250039 Ga0495618_0250039_290_826 172
57 3300046517 Ga0495630_0001616 Ga0495630_0001616_13598_14134 172
58 3300046526 Ga0495666_0384790 Ga0495666_0384790_44_580 172
59 3300046529 Ga0495652_0158696 Ga0495652_0158696_74_610 172
60 3300046531 Ga0495665_0000570 Ga0495665_0000570_11889_12425 172
61 3300046533 Ga0495640_0001386 Ga0495640_0001386_3018_3554 172
62 3300046535 Ga0495586_0076568 Ga0495586_0076568_707_1243 172
63 3300046543 Ga0495645_0493123 Ga0495645_0493123_29_583 172
64 3300046557 Ga0495622_0002449 Ga0495622_0002449_5928_6464 172
65 3300046559 Ga0495667_0015301 Ga0495667_0015301_3431_3967 172
66 3300046642 Ga0495634_0000334 Ga0495634_0000334_29529_30065 172
67 3300046663 Ga0495635_0000477 Ga0495635_0000477_19206_19742 172
68 3300046678 Ga0495599_0233312 Ga0495599_0233312_458_994 172
69 3300046681 Ga0495647_0003566 Ga0495647_0003566_111_647 172
70 3300046683 Ga0495658_0000416 Ga0495658_0000416_12891_13427 172
71 3300046689 Ga0495613_0005732 Ga0495613_0005732_127_663 172
72 3300046690 Ga0495624_0001221 Ga0495624_0001221_954_1490 172
73 3300047315 Ga0495581_0000477 Ga0495581_0000477_881_1417 172
74 3300047317 Ga0495604_0367477 Ga0495604_0367477_101_637 172
75 3300047319 Ga0495674_0000533 Ga0495674_0000533_28590_29126 172
76 3300047322 Ga0495680_0474926 Ga0495680_0474926_207_743 172
77 3300047673 Ga0495593_0001154 Ga0495593_0001154_5907_6443 172
78 3300048089 Ga0495614_0005404 Ga0495614_0005404_5093_5629 172
79 3300048904 Ga0496101_0497205 Ga0496101_0497205_79_633 172
80 3300048905 Ga0496102_0096464 Ga0496102_0096464_208_762 172
81 3300048906 Ga0496103_0011840 Ga0496103_0011840_2790_3344 172
82 3300048907 Ga0496104_0063943 Ga0496104_0063943_959_1513 172
83 3300048908 Ga0496105_0023168 Ga0496105_0023168_3986_4540 172
84 3300048909 Ga0496106_0172617 Ga0496106_0172617_754_1308 172
85 3300048911 Ga0496108_0052485 Ga0496108_0052485_936_1490 172
86 3300048912 Ga0496109_0095294 Ga0496109_0095294_1971_2525 172
87 3300048913 Ga0496110_0319369 Ga0496110_0319369_104_658 172
88 3300048913 Ga0496110_1166490 Ga0496110_1166490_61_603 172
89 3300048914 Ga0496111_0069157 Ga0496111_0069157_756_1310 172
90 3300048915 Ga0496112_0267929 Ga0496112_0267929_178_732 172
91 3300048916 Ga0496113_0179428 Ga0496113_0179428_1053_1607 172
92 3300048917 Ga0496114_0218270 Ga0496114_0218270_712_1266 172
93 3300048918 Ga0496115_0061669 Ga0496115_0061669_472_1026 172
94 3300053077 Ga0495601_0063470 Ga0495601_0063470_521_1057 172
95 3300005719 Ga0068861_100689300 Ga0068861_1006893002 173
96 3300006178 Ga0075367_10190850 Ga0075367_101908502 173
97 3300009176 Ga0105242_11430565 Ga0105242_114305652 173
98 3300013308 Ga0157375_11421004 Ga0157375_114210042 173
99 3300031711 Ga0265314_10056061 Ga0265314_100560612 173
100 3300044684 Ga0466966_0403070 Ga0466966_0403070_16_540 173
101 3300046517 Ga0495630_0717232 Ga0495630_0717232_175_735 173
102 3300046531 Ga0495665_0288038 Ga0495665_0288038_26_586 173
103 3300046660 Ga0495625_0495523 Ga0495625_0495523_109_687 173
104 3300047315 Ga0495581_0153686 Ga0495581_0153686_301_861 173
105 3300048922 Ga0496119_0106311 Ga0496119_0106311_407_949 173
106 3300005436 Ga0070713_100038244 Ga0070713_1000382442 175
107 3300005436 Ga0070713_100351960 Ga0070713_1003519602 175
108 3300005458 Ga0070681_10024092 Ga0070681_100240925 175
109 3300005539 Ga0068853_100406096 Ga0068853_1004060962 175
110 3300005981 Ga0081538_10056728 Ga0081538_100567282 175
111 3300006173 Ga0070716_100262730 Ga0070716_1002627302 175
112 3300009545 Ga0105237_10168697 Ga0105237_101686971 175
113 3300013104 Ga0157370_10216068 Ga0157370_102160682 175
114 3300013105 Ga0157369_10071598 Ga0157369_100715984 175
115 3300025922 Ga0207646_10420902 Ga0207646_104209022 175
116 3300025928 Ga0207700_10004470 Ga0207700_100044706 175
117 3300025929 Ga0207664_10198828 Ga0207664_101988282 175
118 3300026041 Ga0207639_10166038 Ga0207639_101660382 175
119 3300037068 Ga0373925_0053921 Ga0373925_0053921_2245_2775 175
120 3300039437 Ga0436365_1340371 Ga0436365_1340371_39_569 175
121 3300044706 Ga0466964_0252429 Ga0466964_0252429_129_659 175
122 3300045049 Ga0466959_0054677 Ga0466959_0054677_157_687 175
123 3300045836 Ga0466958_0077722 Ga0466958_0077722_107_637 175
124 3300047319 Ga0495674_0226505 Ga0495674_0226505_225_755 175
125 3300048089 Ga0495614_0274160 Ga0495614_0274160_61_603 175
126 3300049578 Ga0501042_0447434 Ga0501042_0447434_387_917 175
127 3300049583 Ga0501067_0133458 Ga0501067_0133458_142_675 175
128 3300053078 Ga0495612_0093142 Ga0495612_0093142_543_1073 175
129 3300053080 Ga0500635_0034855 Ga0500635_0034855_162_731 175
130 3300055283 Ga0500661_050014 Ga0500661_050014_110_679 175
131 iso_pu_bacteria 2513237101 2513695020 175
132 iso_pu_bacteria 2721755755 2723841917 175
133 iso_pu_bacteria 2874604998 2874610484 175
134 iso_pu_bacteria 2876808645 2876817417 175
135 iso_pu_bacteria 2879110137 2879115126 175
136 iso_pu_bacteria 2922386360 2922388772 175
137 iso_pu_bacteria 8006964411 8006969385 175
138 iso_pu_bacteria 8006994254 8007000678 175
139 iso_pu_bacteria 8056673599 8056678571 175
140 3300037068 Ga0373925_1361569 Ga0373925_1361569_40_570 176
141 3300053155 Ga0500620_033906 Ga0500620_033906_52_630 176
142 3300005331 Ga0070670_100592927 Ga0070670_1005929272 177
143 3300005455 Ga0070663_100022315 Ga0070663_1000223152 177
144 3300005459 Ga0068867_100443147 Ga0068867_1004431471 177
145 3300005471 Ga0070698_100249502 Ga0070698_1002495022 177
146 3300005536 Ga0070697_101180672 Ga0070697_1011806721 177
147 3300005548 Ga0070665_100155855 Ga0070665_1001558552 177
148 3300005618 Ga0068864_100665624 Ga0068864_1006656242 177
149 3300006358 Ga0068871_100166607 Ga0068871_1001666072 177
150 3300025914 Ga0207671_10120698 Ga0207671_101206982 177
151 3300025927 Ga0207687_10024723 Ga0207687_100247235 177
152 3300025941 Ga0207711_10873507 Ga0207711_108735071 177
153 3300025944 Ga0207661_10766209 Ga0207661_107662092 177
154 3300026041 Ga0207639_10088791 Ga0207639_100887911 177
155 3300026067 Ga0207678_10494415 Ga0207678_104944152 177
156 3300026067 Ga0207678_10545993 Ga0207678_105459932 177
157 3300026078 Ga0207702_11234502 Ga0207702_112345021 177
158 3300026095 Ga0207676_10703607 Ga0207676_107036071 177
159 3300026142 Ga0207698_10082098 Ga0207698_100820982 177
160 3300028379 Ga0268266_10425305 Ga0268266_104253052 177
161 3300031456 Ga0307513_10240214 Ga0307513_102402142 177
162 3300046660 Ga0495625_0188894 Ga0495625_0188894_24_605 177
163 3300053111 Ga0500572_000057 Ga0500572_000057_8524_9066 177
164 3300053136 Ga0500559_0000219 Ga0500559_0000219_21134_21676 177
165 3300053725 Ga0500576_026268 Ga0500576_026268_470_1012 177
166 3300053735 Ga0500596_001061 Ga0500596_001061_3800_4342 177
167 3300005841 Ga0068863_100460623 Ga0068863_1004606232 178
168 3300005842 Ga0068858_100279545 Ga0068858_1002795452 178
169 3300025914 Ga0207671_10017229 Ga0207671_100172295 178
170 3300026142 Ga0207698_10514272 Ga0207698_105142721 178
171 3300048915 Ga0496112_0026725 Ga0496112_0026725_4111_4659 178
172 3300002075 JGI24738J21930_10081871 JGI24738J21930_100818711 179
173 3300003659 JGI25404J52841_10022235 JGI25404J52841_100222352 179
174 3300005336 Ga0070680_100052242 Ga0070680_1000522422 179
175 3300005337 Ga0070682_100284369 Ga0070682_1002843692 179
176 3300005339 Ga0070660_100009783 Ga0070660_1000097832 179
177 3300005341 Ga0070691_10037778 Ga0070691_100377782 179
178 3300005344 Ga0070661_100366139 Ga0070661_1003661391 179
179 3300005354 Ga0070675_100142286 Ga0070675_1001422863 179
180 3300005355 Ga0070671_100274233 Ga0070671_1002742332 179
181 3300005356 Ga0070674_100084727 Ga0070674_1000847273 179
182 3300005364 Ga0070673_100964629 Ga0070673_1009646291 179
183 3300005366 Ga0070659_100666801 Ga0070659_1006668011 179
184 3300005441 Ga0070700_100073138 Ga0070700_1000731382 179
185 3300005441 Ga0070700_101049794 Ga0070700_1010497941 179
186 3300005445 Ga0070708_100779930 Ga0070708_1007799301 179
187 3300005455 Ga0070663_100045675 Ga0070663_1000456754 179
188 3300005455 Ga0070663_100077282 Ga0070663_1000772821 179
189 3300005455 Ga0070663_100107908 Ga0070663_1001079082 179
190 3300005455 Ga0070663_100247518 Ga0070663_1002475181 179
191 3300005455 Ga0070663_100356163 Ga0070663_1003561631 179
192 3300005456 Ga0070678_100027180 Ga0070678_1000271804 179
193 3300005456 Ga0070678_100130340 Ga0070678_1001303402 179
194 3300005457 Ga0070662_100070598 Ga0070662_1000705983 179
195 3300005458 Ga0070681_10020406 Ga0070681_100204064 179
196 3300005459 Ga0068867_100281966 Ga0068867_1002819661 179
197 3300005530 Ga0070679_100140520 Ga0070679_1001405202 179
198 3300005535 Ga0070684_100048558 Ga0070684_1000485583 179
199 3300005539 Ga0068853_100007556 Ga0068853_1000075563 179
200 3300005539 Ga0068853_100467990 Ga0068853_1004679902 179
201 3300005539 Ga0068853_101003069 Ga0068853_1010030691 179
202 3300005548 Ga0070665_100011218 Ga0070665_1000112187 179
203 3300005548 Ga0070665_100082768 Ga0070665_1000827682 179
204 3300005548 Ga0070665_100163739 Ga0070665_1001637392 179
205 3300005548 Ga0070665_100603409 Ga0070665_1006034091 179
206 3300005564 Ga0070664_100582413 Ga0070664_1005824132 179
207 3300005564 Ga0070664_100851413 Ga0070664_1008514132 179
208 3300005577 Ga0068857_100012153 Ga0068857_1000121536 179
209 3300005578 Ga0068854_100522597 Ga0068854_1005225972 179
210 3300005614 Ga0068856_101008444 Ga0068856_1010084442 179
211 3300005615 Ga0070702_100109992 Ga0070702_1001099922 179
212 3300005616 Ga0068852_100049008 Ga0068852_1000490082 179
213 3300005616 Ga0068852_100243559 Ga0068852_1002435592 179
214 3300005616 Ga0068852_100453038 Ga0068852_1004530382 179
215 3300005617 Ga0068859_100052455 Ga0068859_1000524554 179
216 3300005617 Ga0068859_100194158 Ga0068859_1001941581 179
217 3300005719 Ga0068861_100085153 Ga0068861_1000851532 179
218 3300005834 Ga0068851_10012271 Ga0068851_100122713 179
219 3300005834 Ga0068851_10304449 Ga0068851_103044491 179
220 3300005841 Ga0068863_101067052 Ga0068863_1010670521 179
221 3300005842 Ga0068858_100171532 Ga0068858_1001715322 179
222 3300005842 Ga0068858_100708057 Ga0068858_1007080572 179
223 3300005842 Ga0068858_100827283 Ga0068858_1008272831 179
224 3300005844 Ga0068862_100243746 Ga0068862_1002437461 179
225 3300005844 Ga0068862_100465977 Ga0068862_1004659772 179
226 3300005981 Ga0081538_10048665 Ga0081538_100486652 179
227 3300005983 Ga0081540_1003142 Ga0081540_100314212 179
228 3300005983 Ga0081540_1006347 Ga0081540_10063476 179
229 3300005983 Ga0081540_1032727 Ga0081540_10327274 179
230 3300005983 Ga0081540_1047121 Ga0081540_10471213 179
231 3300006038 Ga0075365_10281454 Ga0075365_102814542 179
232 3300006048 Ga0075363_100003491 Ga0075363_1000034914 179
233 3300006051 Ga0075364_10091336 Ga0075364_100913361 179
234 3300006058 Ga0075432_10238181 Ga0075432_102381811 179
235 3300006177 Ga0075362_10141874 Ga0075362_101418742 179
236 3300006178 Ga0075367_10002314 Ga0075367_100023147 179
237 3300006178 Ga0075367_10089310 Ga0075367_100893102 179
238 3300006186 Ga0075369_10036501 Ga0075369_100365011 179
239 3300006195 Ga0075366_10025892 Ga0075366_100258921 179
240 3300006195 Ga0075366_10114107 Ga0075366_101141072 179
241 3300006353 Ga0075370_10015254 Ga0075370_100152544 179
242 3300006844 Ga0075428_100154775 Ga0075428_1001547752 179
243 3300006881 Ga0068865_100017682 Ga0068865_1000176824 179
244 3300006931 Ga0097620_100052457 Ga0097620_1000524574 179
245 3300006931 Ga0097620_100137735 Ga0097620_1001377352 179
246 3300006931 Ga0097620_100194183 Ga0097620_1001941832 179
247 3300009094 Ga0111539_10095400 Ga0111539_100954003 179
248 3300009147 Ga0114129_11217745 Ga0114129_112177452 179
249 3300009148 Ga0105243_10035721 Ga0105243_100357214 179
250 3300009148 Ga0105243_10893310 Ga0105243_108933101 179
251 3300009176 Ga0105242_10187680 Ga0105242_101876803 179
252 3300009177 Ga0105248_10233854 Ga0105248_102338541 179
253 3300009551 Ga0105238_10086651 Ga0105238_100866512 179
254 3300010375 Ga0105239_10019844 Ga0105239_100198447 179
255 3300011119 Ga0105246_10340721 Ga0105246_103407212 179
256 3300013297 Ga0157378_10289454 Ga0157378_102894541 179
257 3300013308 Ga0157375_10644913 Ga0157375_106449132 179
258 3300014326 Ga0157380_10245118 Ga0157380_102451182 179
259 3300014968 Ga0157379_10142098 Ga0157379_101420984 179
260 3300017792 Ga0163161_10838422 Ga0163161_108384221 179
261 3300025321 Ga0207656_10009540 Ga0207656_100095402 179
262 3300025907 Ga0207645_10248388 Ga0207645_102483881 179
263 3300025909 Ga0207705_10339689 Ga0207705_103396892 179
264 3300025912 Ga0207707_10001050 Ga0207707_100010504 179
265 3300025917 Ga0207660_10008627 Ga0207660_100086272 179
266 3300025920 Ga0207649_10271431 Ga0207649_102714311 179
267 3300025921 Ga0207652_10089128 Ga0207652_100891282 179
268 3300025923 Ga0207681_10307526 Ga0207681_103075262 179
269 3300025927 Ga0207687_10169337 Ga0207687_101693372 179
270 3300025933 Ga0207706_10075238 Ga0207706_100752382 179
271 3300025933 Ga0207706_10475095 Ga0207706_104750952 179
272 3300025934 Ga0207686_10716299 Ga0207686_107162991 179
273 3300025935 Ga0207709_10011375 Ga0207709_100113754 179
274 3300025935 Ga0207709_10118646 Ga0207709_101186462 179
275 3300025937 Ga0207669_10008753 Ga0207669_100087533 179
276 3300025938 Ga0207704_10014566 Ga0207704_100145664 179
277 3300025942 Ga0207689_10046303 Ga0207689_100463034 179
278 3300025945 Ga0207679_10226208 Ga0207679_102262082 179
279 3300025945 Ga0207679_11186801 Ga0207679_111868011 179
280 3300025961 Ga0207712_10033048 Ga0207712_100330482 179
281 3300025972 Ga0207668_10390102 Ga0207668_103901022 179
282 3300025981 Ga0207640_10216320 Ga0207640_102163202 179
283 3300025981 Ga0207640_10926028 Ga0207640_109260281 179
284 3300026023 Ga0207677_10286338 Ga0207677_102863382 179
285 3300026035 Ga0207703_10060703 Ga0207703_100607031 179
286 3300026067 Ga0207678_10031422 Ga0207678_100314224 179
287 3300026067 Ga0207678_10048031 Ga0207678_100480313 179
288 3300026067 Ga0207678_10171594 Ga0207678_101715942 179
289 3300026067 Ga0207678_10178225 Ga0207678_101782252 179
290 3300026116 Ga0207674_10016517 Ga0207674_100165177 179
291 3300026118 Ga0207675_100104446 Ga0207675_1001044464 179
292 3300026121 Ga0207683_10422406 Ga0207683_104224061 179
293 3300026142 Ga0207698_10081852 Ga0207698_100818522 179
294 3300028379 Ga0268266_10002006 Ga0268266_1000200618 179
295 3300028379 Ga0268266_10002738 Ga0268266_1000273812 179
296 3300028379 Ga0268266_10482106 Ga0268266_104821062 179
297 3300028380 Ga0268265_10205861 Ga0268265_102058612 179
298 3300028380 Ga0268265_10250093 Ga0268265_102500932 179
299 3300028380 Ga0268265_10773774 Ga0268265_107737741 179
300 3300028380 Ga0268265_11337056 Ga0268265_113370562 179
301 3300028558 Ga0265326_10008483 Ga0265326_100084832 179
302 3300028563 Ga0265319_1001409 Ga0265319_10014093 179
303 3300028573 Ga0265334_10006596 Ga0265334_100065964 179
304 3300028577 Ga0265318_10002397 Ga0265318_1000239710 179
305 3300028653 Ga0265323_10001183 Ga0265323_100011837 179
306 3300028666 Ga0265336_10000459 Ga0265336_100004593 179
307 3300028786 Ga0307517_10002574 Ga0307517_1000257417 179
308 3300028786 Ga0307517_10115520 Ga0307517_101155203 179
309 3300028800 Ga0265338_10002741 Ga0265338_1000274120 179
310 3300029957 Ga0265324_10085558 Ga0265324_100855582 179
311 3300031456 Ga0307513_10296388 Ga0307513_102963882 179
312 3300031548 Ga0307408_100116061 Ga0307408_1001160612 179
313 3300031852 Ga0307410_10160018 Ga0307410_101600182 179
314 3300031995 Ga0307409_100786527 Ga0307409_1007865272 179
315 3300032004 Ga0307414_11031013 Ga0307414_110310132 179
316 3300032005 Ga0307411_10079809 Ga0307411_100798091 179
317 3300033180 Ga0307510_10010125 Ga0307510_100101252 179
318 3300035113 Ga0373936_0161980 Ga0373936_0161980_44_583 179
319 3300035117 Ga0373953_0018839 Ga0373953_0018839_1459_2046 179
320 3300035118 Ga0373954_0000308 Ga0373954_0000308_15504_16091 179
321 3300035119 Ga0373956_0060455 Ga0373956_0060455_158_745 179
322 3300035120 Ga0373957_0004737 Ga0373957_0004737_1366_1953 179
323 3300035172 Ga0373955_0000625 Ga0373955_0000625_957_1544 179
324 3300035207 Ga0373942_0018588 Ga0373942_0018588_448_1011 179
325 3300035410 Ga0373924_0001037 Ga0373924_0001037_2251_2838 179
326 3300035724 Ga0373933_0003162 Ga0373933_0003162_7658_8245 179
327 3300036401 Ga0373937_0013852 Ga0373937_0013852_5479_6066 179
328 3300037068 Ga0373925_0483448 Ga0373925_0483448_57_596 179
329 3300046452 Ga0495617_019921 Ga0495617_019921_1564_2103 179
330 3300046454 Ga0495592_0001710 Ga0495592_0001710_13573_14160 179
331 3300046455 Ga0495603_0045203 Ga0495603_0045203_1290_1829 179
332 3300046459 Ga0495629_0000348 Ga0495629_0000348_17620_18207 179
333 3300046462 Ga0495651_0003574 Ga0495651_0003574_11244_11831 179
334 3300046463 Ga0495653_0002076 Ga0495653_0002076_13964_14551 179
335 3300046472 Ga0495580_0296820 Ga0495580_0296820_233_772 179
336 3300046499 Ga0495594_0023235 Ga0495594_0023235_1858_2397 179
337 3300046501 Ga0495607_0122695 Ga0495607_0122695_625_1164 179
338 3300046511 Ga0495608_0000368 Ga0495608_0000368_15376_15963 179
339 3300046513 Ga0495616_0115685 Ga0495616_0115685_261_800 179
340 3300046514 Ga0495618_0018215 Ga0495618_0018215_2485_3072 179
341 3300046525 Ga0495663_0134484 Ga0495663_0134484_32_571 179
342 3300046529 Ga0495652_0081837 Ga0495652_0081837_1855_2442 179
343 3300046536 Ga0495587_0001529 Ga0495587_0001529_13724_14311 179
344 3300046539 Ga0495621_0063101 Ga0495621_0063101_278_817 179
345 3300046543 Ga0495645_0008041 Ga0495645_0008041_649_1236 179
346 3300046559 Ga0495667_0000778 Ga0495667_0000778_18945_19532 179
347 3300046615 Ga0495656_0004904 Ga0495656_0004904_1618_2157 179
348 3300046615 Ga0495656_0017632 Ga0495656_0017632_35_574 179
349 3300046615 Ga0495656_0018685 Ga0495656_0018685_688_1227 179
350 3300046616 Ga0495668_0035000 Ga0495668_0035000_2024_2611 179
351 3300046642 Ga0495634_0014193 Ga0495634_0014193_4532_5119 179
352 3300046648 Ga0495611_0024765 Ga0495611_0024765_1898_2437 179
353 3300046663 Ga0495635_0000372 Ga0495635_0000372_12293_12880 179
354 3300046664 Ga0495659_0060726 Ga0495659_0060726_124_663 179
355 3300046678 Ga0495599_0003226 Ga0495599_0003226_140_727 179
356 3300046679 Ga0495623_0043995 Ga0495623_0043995_1210_1797 179
357 3300046680 Ga0495646_0002558 Ga0495646_0002558_5909_6496 179
358 3300046684 Ga0495669_0013307 Ga0495669_0013307_1735_2274 179
359 3300046684 Ga0495669_0030494 Ga0495669_0030494_1372_1911 179
360 3300046691 Ga0495670_0145764 Ga0495670_0145764_260_799 179
361 3300046794 Ga0495589_0221158 Ga0495589_0221158_106_645 179
362 3300047317 Ga0495604_0014529 Ga0495604_0014529_4740_5327 179
363 3300047318 Ga0495636_0060704 Ga0495636_0060704_463_1002 179
364 3300047318 Ga0495636_0172139 Ga0495636_0172139_209_748 179
365 3300047318 Ga0495636_0196690 Ga0495636_0196690_10_549 179
366 3300047322 Ga0495680_0002581 Ga0495680_0002581_17707_18294 179
367 3300047444 Ga0495675_0044173 Ga0495675_0044173_1042_1629 179
368 3300047469 Ga0495673_0174997 Ga0495673_0174997_262_801 179
369 3300047471 Ga0495684_0001014 Ga0495684_0001014_21399_21986 179
370 3300047673 Ga0495593_0004444 Ga0495593_0004444_187_774 179
371 3300048088 Ga0495602_0002140 Ga0495602_0002140_2428_3015 179
372 3300048090 Ga0495615_0003787 Ga0495615_0003787_1558_2097 179
373 3300048903 Ga0496100_0182447 Ga0496100_0182447_383_922 179
374 3300048904 Ga0496101_0075445 Ga0496101_0075445_214_753 179
375 3300048905 Ga0496102_0131752 Ga0496102_0131752_484_1023 179
376 3300048906 Ga0496103_0735234 Ga0496103_0735234_11_550 179
377 3300048911 Ga0496108_0488544 Ga0496108_0488544_55_630 179
378 3300048912 Ga0496109_0151874 Ga0496109_0151874_407_982 179
379 3300048917 Ga0496114_1237815 Ga0496114_1237815_48_587 179
380 3300048918 Ga0496115_0756406 Ga0496115_0756406_105_644 179
381 3300048922 Ga0496119_0150832 Ga0496119_0150832_591_1130 179
382 3300048924 Ga0496121_0362399 Ga0496121_0362399_294_833 179
383 3300048928 Ga0496125_0068442 Ga0496125_0068442_1190_1729 179
384 3300048929 Ga0496126_0984848 Ga0496126_0984848_21_578 179
385 3300049574 Ga0501038_0214211 Ga0501038_0214211_377_916 179
386 3300049592 Ga0501076_0180664 Ga0501076_0180664_346_885 179
387 3300050493 nmdc:mga0k408_187269_c1 nmdc:mga0k408_187269_c1_271_1002 179
388 3300050511 nmdc:mga08y16_425849_c1 nmdc:mga08y16_425849_c1_391_930 179
389 3300053077 Ga0495601_0082883 Ga0495601_0082883_555_1142 179
390 3300053084 Ga0495595_0001247 Ga0495595_0001247_8895_9482 179
391 3300053085 Ga0495619_0000563 Ga0495619_0000563_6237_6824 179
392 3300053096 Ga0500641_0006410 Ga0500641_0006410_3047_3586 179
393 3300053150 Ga0500603_006249 Ga0500603_006249_1645_2220 179
394 3300053162 Ga0500638_001732 Ga0500638_001732_2175_2750 179
395 3300053162 Ga0500638_081847 Ga0500638_081847_215_778 179
396 3300053178 Ga0500637_0000168 Ga0500637_0000168_1624_2199 179
397 3300055283 Ga0500661_000293 Ga0500661_000293_5965_6540 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

90

150

0.98

PF13463

HTH_27

Winged helix DNA-binding domain

92

159

0.97

PF01047

MarR

MarR family

92

151

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9558 60 119
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9164 60 120
2heo-assembly1.cif.gz_A general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. 0.9108 57 119
2l02-assembly1.cif.gz_A solution nmr structure of protein bt2368 from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr375 0.9076 59 119
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9014 60 119
ID Description Score Start End Superfamily
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9395 60 120 1.10.10.10
2xrnA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9247 60 119 1.10.10.10
af_P71977_12_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9218 59 119 1.10.10.10
af_P77569_1_73_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9185 60 120 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9164 60 120 1.10.10.10
ID Description Score Start End GO Terms
AF-C6D109-F1-model_v4 deleted 0.9314 49 160
AF-A0A6N9T8Q8-F1-model_v4 MarR family transcriptional regulator 0.9284 37 165 GO:0003677
GO:0003700
GO:0006950
AF-A0A6N9T8Q8-F1-model_v4 MarR family transcriptional regulator 0.9019 37 165 GO:0003677
GO:0003700
GO:0006950
AF-A0A536WN11-F1-model_v4 MarR family transcriptional regulator 0.9001 42 163 GO:0003677
GO:0003700
GO:0006950
AF-A0A2I1DP50-F1-model_v4 MarR family transcriptional regulator 0.8927 44 164 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
67.23 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map