F433891

General Info

Members Datasets Scaffolds Average Seq Length
397 202 397 133

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_1071737_c1|nmdc:mga08y16_1071737_c1_171_626
Length 151
Sequence MTSLLAIAVVAAMVAPVLAHHSATMFESEKTITVEGVVKEFQFTNPHSWLLVDVKNKNGTVTTWGFEAEGPSTLQRSGIRPSDFAAGTKLKITGRPMKNGSPAAIWVDAVRADGKRFDPRRIQGQVGNGESGERPGAEAFPSLAKEGWLRH

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
144 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.25
Rhizosphere 99.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10089776 3300003203 Bacteria 929
2 Ga0065704_10681372 3300005289 Unclassified 556
3 Ga0065712_10327474 3300005290 Unclassified 819
4 Ga0065712_10411962 3300005290 Bacteria 720
5 Ga0065715_10219620 3300005293 Bacteria 1278
6 Ga0065715_10538663 3300005293 Unclassified 723
7 Ga0065707_10484805 3300005295 Unclassified 770
8 Ga0070683_101332323 3300005329 Unclassified 690
9 Ga0070690_100665350 3300005330 Unclassified 797
10 Ga0070690_100785584 3300005330 Unclassified 737
11 Ga0070670_100055410 3300005331 Unclassified 3403
12 Ga0068869_100494948 3300005334 Bacteria 1020
13 Ga0070680_100633285 3300005336 Bacteria 919
14 Ga0070689_100151182 3300005340 Bacteria 1872
15 Ga0070689_100751883 3300005340 Unclassified 854
16 Ga0070691_10179256 3300005341 Bacteria 1102
17 Ga0070691_10180246 3300005341 Bacteria 1099
18 Ga0070687_100094376 3300005343 Bacteria 1661
19 Ga0070687_100126931 3300005343 Bacteria 1467
20 Ga0070687_101499916 3300005343 Unclassified 507
21 Ga0070661_100495152 3300005344 Unclassified 978
22 Ga0070668_100119191 3300005347 Bacteria 2108
23 Ga0070669_100002320 3300005353 Bacteria 13766
24 Ga0070675_100023030 3300005354 Bacteria 4976
25 Ga0070675_100110239 3300005354 Bacteria 2327
26 Ga0070675_100230237 3300005354 Bacteria 1616
27 Ga0070675_100590415 3300005354 Bacteria 1007
28 Ga0070671_100200169 3300005355 Unclassified 1693
29 Ga0070671_100803329 3300005355 Unclassified 819
30 Ga0070674_100360307 3300005356 Unclassified 1177
31 Ga0070673_100130563 3300005364 Bacteria 2107
32 Ga0070673_100933735 3300005364 Unclassified 806
33 Ga0070688_100057484 3300005365 Unclassified 2445
34 Ga0070688_100331022 3300005365 Bacteria 1109
35 Ga0070659_101945168 3300005366 Unclassified 528
36 Ga0070701_10002939 3300005438 Bacteria 6653
37 Ga0070701_10015921 3300005438 Bacteria 3484
38 Ga0070701_10401440 3300005438 Bacteria 869
39 Ga0070705_100016820 3300005440 Bacteria 3807
40 Ga0070705_100084098 3300005440 Bacteria 1963
41 Ga0070705_100261430 3300005440 Unclassified 1221
42 Ga0070700_100164350 3300005441 Unclassified 1531
43 Ga0070700_100542989 3300005441 Bacteria 902
44 Ga0070694_100001751 3300005444 Bacteria 12819
45 Ga0070694_100001969 3300005444 Bacteria 12177
46 Ga0070694_100009058 3300005444 Bacteria 6101
47 Ga0070694_100092460 3300005444 Bacteria 2125
48 Ga0070694_101888948 3300005444 Unclassified 510
49 Ga0070663_100786185 3300005455 Unclassified 815
50 Ga0070678_102392792 3300005456 Unclassified 502
51 Ga0070662_100018635 3300005457 Bacteria 4699
52 Ga0068867_100042600 3300005459 Unclassified 3322
53 Ga0068867_100580952 3300005459 Unclassified 974
54 Ga0068867_101601457 3300005459 Unclassified 609
55 Ga0070685_10153120 3300005466 Unclassified 1463
56 Ga0070706_100512678 3300005467 Unclassified 1115
57 Ga0070706_100733263 3300005467 Unclassified 916
58 Ga0070706_101042499 3300005467 Unclassified 754
59 Ga0070707_100018324 3300005468 Bacteria 6588
60 Ga0070707_101236909 3300005468 Bacteria 713
61 Ga0070707_101250687 3300005468 Unclassified 709
62 Ga0070707_101823286 3300005468 Unclassified 576
63 Ga0070698_100004770 3300005471 Bacteria 14880
64 Ga0070698_100016307 3300005471 Bacteria 7843
65 Ga0070698_100070914 3300005471 Bacteria 3496
66 Ga0070699_100000148 3300005518 Bacteria 66426
67 Ga0070699_100005763 3300005518 Bacteria 10840
68 Ga0070699_100021890 3300005518 Bacteria 5509
69 Ga0070699_100622668 3300005518 Bacteria 985
70 Ga0070679_100766249 3300005530 Bacteria 908
71 Ga0070697_100112517 3300005536 Bacteria 2270
72 Ga0070697_100982732 3300005536 Unclassified 750
73 Ga0070672_100157966 3300005543 Bacteria 1879
74 Ga0070672_100775236 3300005543 Unclassified 843
75 Ga0070672_101291484 3300005543 Unclassified 651
76 Ga0070686_101375550 3300005544 Unclassified 592
77 Ga0070695_100007561 3300005545 Bacteria 6437
78 Ga0070695_100045623 3300005545 Unclassified 2794
79 Ga0070695_100074126 3300005545 Bacteria 2236
80 Ga0070695_100134567 3300005545 Bacteria 1707
81 Ga0070695_100227162 3300005545 Bacteria 1348
82 Ga0070695_100294962 3300005545 Bacteria 1196
83 Ga0070695_100695989 3300005545 Unclassified 806
84 Ga0070696_100000912 3300005546 Bacteria 19224
85 Ga0070696_100323840 3300005546 Unclassified 1187
86 Ga0070696_101007109 3300005546 Unclassified 696
87 Ga0070696_101205228 3300005546 Bacteria 640
88 Ga0070693_100359468 3300005547 Bacteria 999
89 Ga0070665_100006313 3300005548 Bacteria 12099
90 Ga0070704_100010290 3300005549 Bacteria 5688
91 Ga0070704_100910029 3300005549 Unclassified 792
92 Ga0070704_100990328 3300005549 Unclassified 760
93 Ga0070664_100118946 3300005564 Bacteria 2312
94 Ga0070664_100205249 3300005564 Unclassified 1760
95 Ga0070664_101795882 3300005564 Bacteria 581
96 Ga0068857_100063530 3300005577 Bacteria 3282
97 Ga0068857_100073624 3300005577 Bacteria 3044
98 Ga0068857_100108997 3300005577 Bacteria 2488
99 Ga0068854_100842868 3300005578 Unclassified 802
100 Ga0070702_100382166 3300005615 Unclassified 1002
101 Ga0070702_100472652 3300005615 Bacteria 914
102 Ga0070702_101204324 3300005615 Bacteria 610
103 Ga0070702_101289922 3300005615 Unclassified 592
104 Ga0070702_101550184 3300005615 Unclassified 547
105 Ga0068852_101820985 3300005616 Bacteria 631
106 Ga0068859_100056052 3300005617 Unclassified 3966
107 Ga0068859_100191166 3300005617 Bacteria 2131
108 Ga0068859_100239966 3300005617 Unclassified 1901
109 Ga0068859_100861099 3300005617 Unclassified 992
110 Ga0068861_100002036 3300005719 Bacteria 13092
111 Ga0068861_100592044 3300005719 Unclassified 1017
112 Ga0068861_100747367 3300005719 Bacteria 913
113 Ga0068861_100887594 3300005719 Unclassified 843
114 Ga0068870_10002016 3300005840 Bacteria 8393
115 Ga0068870_10265371 3300005840 Bacteria 1070
116 Ga0068863_100086143 3300005841 Unclassified 2976
117 Ga0068863_100936198 3300005841 Bacteria 868
118 Ga0068858_100002852 3300005842 Bacteria 17379
119 Ga0068858_100209923 3300005842 Unclassified 1842
120 Ga0068858_100289508 3300005842 Unclassified 1561
121 Ga0068860_100311471 3300005843 Unclassified 1544
122 Ga0068860_101314383 3300005843 Unclassified 744
123 Ga0068862_100002651 3300005844 Bacteria 15744
124 Ga0068862_101180556 3300005844 Bacteria 763
125 Ga0068862_102438750 3300005844 Bacteria 535
126 Ga0081539_10000175 3300005985 Bacteria 150479
127 Ga0081539_10002917 3300005985 Bacteria 22574
128 Ga0070717_11975738 3300006028 Unclassified 526
129 Ga0075432_10010445 3300006058 Bacteria 3152
130 Ga0070716_100175314 3300006173 Unclassified 1403
131 Ga0097621_100245152 3300006237 Bacteria 1567
132 Ga0097621_101210173 3300006237 Unclassified 712
133 Ga0097621_101669710 3300006237 Unclassified 606
134 Ga0068871_100049463 3300006358 Bacteria 3398
135 Ga0068871_100065561 3300006358 Bacteria 2974
136 Ga0075428_100152304 3300006844 Bacteria 2512
137 Ga0075428_100223867 3300006844 Bacteria 2031
138 Ga0075428_100493563 3300006844 Unclassified 1310
139 Ga0075430_100163393 3300006846 Bacteria 1853
140 Ga0075433_10000250 3300006852 Bacteria 31089
141 Ga0075433_10106466 3300006852 Bacteria 2486
142 Ga0075433_10249214 3300006852 Unclassified 1576
143 Ga0075433_10422594 3300006852 Bacteria 1175
144 Ga0075433_11644492 3300006852 Unclassified 553
145 Ga0075434_100000994 3300006871 Bacteria 22977
146 Ga0075434_100036617 3300006871 Bacteria 4854
147 Ga0075434_100230196 3300006871 Bacteria 1873
148 Ga0075434_100293016 3300006871 Unclassified 1647
149 Ga0075434_100407062 3300006871 Bacteria 1381
150 Ga0075434_101042445 3300006871 Bacteria 832
151 Ga0075434_101302136 3300006871 Unclassified 737
152 Ga0075429_100026245 3300006880 Bacteria 5056
153 Ga0075429_100631165 3300006880 Bacteria 939
154 Ga0068865_100373799 3300006881 Bacteria 1161
155 Ga0068865_100402313 3300006881 Unclassified 1122
156 Ga0075436_100868526 3300006914 Unclassified 674
157 Ga0075436_101225079 3300006914 Unclassified 567
158 Ga0075436_101270001 3300006914 Unclassified 557
159 Ga0097620_100056053 3300006931 Unclassified 3966
160 Ga0097620_100191179 3300006931 Bacteria 2131
161 Ga0097620_100239974 3300006931 Unclassified 1901
162 Ga0097620_100861060 3300006931 Unclassified 992
163 Ga0075435_100003523 3300007076 Bacteria 10623
164 Ga0075435_100074405 3300007076 Unclassified 2779
165 Ga0075435_100094503 3300007076 Bacteria 2471
166 Ga0075435_100174600 3300007076 Unclassified 1814
167 Ga0075435_101563469 3300007076 Unclassified 579
168 Ga0105240_10057138 3300009093 Unclassified 4878
169 Ga0111539_10003655 3300009094 Bacteria 20264
170 Ga0111539_10004603 3300009094 Bacteria 18020
171 Ga0111539_10530869 3300009094 Unclassified 1371
172 Ga0111539_11112946 3300009094 Unclassified 918
173 Ga0105245_10163812 3300009098 Bacteria 2112
174 Ga0105247_10208593 3300009101 Unclassified 1317
175 Ga0114129_10005499 3300009147 Bacteria 17911
176 Ga0114129_10020765 3300009147 Bacteria 9333
177 Ga0114129_10021565 3300009147 Bacteria 9144
178 Ga0114129_10091901 3300009147 Bacteria 4204
179 Ga0114129_10125781 3300009147 Bacteria 3524
180 Ga0114129_10305527 3300009147 Unclassified 2119
181 Ga0114129_10443256 3300009147 Bacteria 1704
182 Ga0114129_11366043 3300009147 Unclassified 875
183 Ga0105243_10047095 3300009148 Bacteria 3393
184 Ga0105243_10138691 3300009148 Unclassified 2072
185 Ga0105243_13029124 3300009148 Unclassified 509
186 Ga0105242_10105463 3300009176 Bacteria 2394
187 Ga0105242_11215273 3300009176 Bacteria 774
188 Ga0105248_10366972 3300009177 Bacteria 1621
189 Ga0105248_11428512 3300009177 Unclassified 783
190 Ga0105249_10002720 3300009553 Bacteria 15285
191 Ga0105249_10184891 3300009553 Bacteria 2030
192 Ga0105249_10320676 3300009553 Unclassified 1561
193 Ga0105246_10296262 3300011119 Unclassified 1304
194 Ga0105246_10503078 3300011119 Bacteria 1029
195 Ga0105246_10662138 3300011119 Unclassified 910
196 Ga0157315_1017523 3300012508 Bacteria 721
197 Ga0157374_10225542 3300013296 Bacteria 1840
198 Ga0157378_11263642 3300013297 Unclassified 779
199 Ga0157378_11268838 3300013297 Unclassified 777
200 Ga0163162_11064494 3300013306 Bacteria 916
201 Ga0157375_10039449 3300013308 Bacteria 4546
202 Ga0157375_10887672 3300013308 Bacteria 1036
203 Ga0163163_11601278 3300014325 Bacteria 712
204 Ga0157380_10044308 3300014326 Bacteria 3486
205 Ga0157380_10155396 3300014326 Bacteria 1982
206 Ga0157380_11072423 3300014326 Unclassified 843
207 Ga0157377_10324505 3300014745 Unclassified 1024
208 Ga0157379_10012294 3300014968 Bacteria 7477
209 Ga0157376_10132315 3300014969 Bacteria 2228
210 Ga0157376_10651593 3300014969 Bacteria 1054
211 Ga0207666_1030728 3300025271 Unclassified 822
212 Ga0207653_10047160 3300025885 Bacteria 1426
213 Ga0207682_10075995 3300025893 Bacteria 1431
214 Ga0207710_10112550 3300025900 Unclassified 1293
215 Ga0207680_10104501 3300025903 Bacteria 1826
216 Ga0207645_10149364 3300025907 Bacteria 1525
217 Ga0207643_10002530 3300025908 Bacteria 9892
218 Ga0207684_10892741 3300025910 Unclassified 747
219 Ga0207695_10093853 3300025913 Unclassified 3009
220 Ga0207660_10423016 3300025917 Bacteria 1075
221 Ga0207662_10102080 3300025918 Bacteria 1778
222 Ga0207662_10484706 3300025918 Bacteria 850
223 Ga0207662_10503506 3300025918 Unclassified 834
224 Ga0207649_11309712 3300025920 Unclassified 573
225 Ga0207646_10011300 3300025922 Bacteria 8669
226 Ga0207646_10948013 3300025922 Unclassified 762
227 Ga0207646_11130069 3300025922 Unclassified 689
228 Ga0207646_11436685 3300025922 Unclassified 599
229 Ga0207681_10009535 3300025923 Bacteria 5932
230 Ga0207650_10040801 3300025925 Unclassified 3398
231 Ga0207659_10008010 3300025926 Bacteria 6535
232 Ga0207659_10326107 3300025926 Bacteria 1268
233 Ga0207659_10357550 3300025926 Unclassified 1213
234 Ga0207659_10978094 3300025926 Unclassified 728
235 Ga0207687_10548224 3300025927 Unclassified 970
236 Ga0207700_10416385 3300025928 Bacteria 1180
237 Ga0207644_10071441 3300025931 Bacteria 2539
238 Ga0207690_10533193 3300025932 Bacteria 953
239 Ga0207706_10068701 3300025933 Unclassified 3117
240 Ga0207709_10021900 3300025935 Bacteria 3621
241 Ga0207709_10153301 3300025935 Unclassified 1598
242 Ga0207670_10005252 3300025936 Bacteria 7091
243 Ga0207670_10573291 3300025936 Unclassified 924
244 Ga0207669_11225941 3300025937 Bacteria 636
245 Ga0207691_10171849 3300025940 Bacteria 1898
246 Ga0207691_10196375 3300025940 Bacteria 1758
247 Ga0207711_10797690 3300025941 Unclassified 879
248 Ga0207689_10062783 3300025942 Unclassified 3055
249 Ga0207689_10188828 3300025942 Bacteria 1700
250 Ga0207689_10441294 3300025942 Unclassified 1087
251 Ga0207689_10473787 3300025942 Bacteria 1048
252 Ga0207679_10096756 3300025945 Bacteria 2298
253 Ga0207651_10127454 3300025960 Bacteria 1942
254 Ga0207651_10145509 3300025960 Bacteria 1837
255 Ga0207651_10173979 3300025960 Bacteria 1701
256 Ga0207651_11510838 3300025960 Unclassified 605
257 Ga0207712_10004553 3300025961 Bacteria 8747
258 Ga0207668_10030570 3300025972 Bacteria 3540
259 Ga0207640_10801873 3300025981 Unclassified 816
260 Ga0207658_12037636 3300025986 Bacteria 522
261 Ga0207677_10175991 3300026023 Bacteria 1678
262 Ga0207703_10016344 3300026035 Bacteria 5785
263 Ga0207703_10053602 3300026035 Bacteria 3278
264 Ga0207703_10914199 3300026035 Unclassified 840
265 Ga0207639_11668475 3300026041 Bacteria 597
266 Ga0207678_10865095 3300026067 Unclassified 799
267 Ga0207708_10057953 3300026075 Unclassified 2955
268 Ga0207641_10033865 3300026088 Unclassified 4246
269 Ga0207641_11192382 3300026088 Bacteria 761
270 Ga0207648_10001634 3300026089 Bacteria 24557
271 Ga0207676_10345248 3300026095 Bacteria 1375
272 Ga0207676_10732697 3300026095 Bacteria 960
273 Ga0207676_10855762 3300026095 Bacteria 890
274 Ga0207674_10005085 3300026116 Bacteria 15701
275 Ga0207674_10089311 3300026116 Bacteria 3074
276 Ga0207674_10121101 3300026116 Unclassified 2584
277 Ga0207675_100003468 3300026118 Bacteria 15411
278 Ga0207675_100008997 3300026118 Bacteria 9370
279 Ga0207675_100135071 3300026118 Bacteria 2340
280 Ga0207675_100720139 3300026118 Bacteria 1008
281 Ga0207675_100812975 3300026118 Unclassified 948
282 Ga0207428_10000231 3300027907 Bacteria 77049
283 Ga0268265_10000545 3300028380 Bacteria 38390
284 Ga0268265_10206670 3300028380 Bacteria 1708
285 Ga0268265_10521652 3300028380 Unclassified 1123
286 Ga0268264_10130194 3300028381 Unclassified 2229
287 Ga0268264_10495052 3300028381 Unclassified 1191
288 Ga0268264_10552660 3300028381 Bacteria 1129
289 Ga0307408_100484988 3300031548 Unclassified 1079
290 Ga0316576_10567546 3300031727 Bacteria 830
291 Ga0307410_10491743 3300031852 Bacteria 1008
292 Ga0307412_10438131 3300031911 Unclassified 1073
293 Ga0307416_103042998 3300032002 Unclassified 561
294 Ga0373948_0100715 3300034817 Unclassified 680
295 Ga0373958_0073047 3300034819 Unclassified 764
296 Ga0373949_0026460 3300035090 Unclassified 1359
297 Ga0373932_0144128 3300035112 Unclassified 812
298 Ga0373939_0053368 3300035114 Bacteria 1262
299 Ga0373962_0055791 3300035242 Bacteria 1149
300 Ga0316574_0078967 3300035398 Bacteria 2087
301 Ga0373947_0459639 3300035725 Bacteria 863
302 Ga0373925_1588649 3300037068 Unclassified 535
303 Ga0450916_057110 3300042530 Bacteria 627
304 Ga0450916_081873 3300042530 Unclassified 552
305 Ga0451576_0014207 3300045051 Bacteria 8874
306 Ga0451576_0077659 3300045051 Bacteria 3456
307 Ga0451576_0139640 3300045051 Bacteria 2527
308 Ga0451576_0210917 3300045051 Bacteria 2028
309 Ga0451576_0993286 3300045051 Unclassified 880
310 Ga0495603_0130468 3300046455 Bacteria 1464
311 Ga0495629_0524098 3300046459 Unclassified 797
312 Ga0495580_0147590 3300046472 Bacteria 1630
313 Ga0495580_0399913 3300046472 Bacteria 926
314 Ga0495584_0058948 3300046491 Unclassified 1931
315 Ga0495585_0391892 3300046492 Unclassified 670
316 Ga0495594_0016834 3300046499 Bacteria 3856
317 Ga0495643_0355444 3300046522 Unclassified 655
318 Ga0495598_0021705 3300046537 Bacteria 1711
319 Ga0495598_0430204 3300046537 Unclassified 520
320 Ga0495621_0005881 3300046539 Bacteria 3552
321 Ga0495621_0050312 3300046539 Unclassified 1489
322 Ga0495668_0232006 3300046616 Bacteria 1011
323 Ga0495659_0006398 3300046664 Bacteria 3717
324 Ga0495659_0059675 3300046664 Bacteria 1406
325 Ga0495659_0064078 3300046664 Bacteria 1364
326 Ga0495659_0120546 3300046664 Bacteria 1032
327 Ga0495659_0199380 3300046664 Unclassified 820
328 Ga0495659_0209645 3300046664 Bacteria 802
329 Ga0495659_0230634 3300046664 Unclassified 767
330 Ga0495659_0241601 3300046664 Unclassified 750
331 Ga0495659_0375363 3300046664 Unclassified 611
332 Ga0495588_0032683 3300046674 Unclassified 2623
333 Ga0495670_0342639 3300046691 Bacteria 804
334 Ga0495670_0408477 3300046691 Unclassified 734
335 Ga0495671_0078357 3300046692 Bacteria 1620
336 Ga0495636_0029544 3300047318 Bacteria 2237
337 Ga0495636_0364996 3300047318 Unclassified 683
338 Ga0495676_1026926 3300047321 Unclassified 525
339 Ga0496110_1127004 3300048913 Bacteria 693
340 Ga0501031_0812397 3300049568 Unclassified 599
341 Ga0501032_0911268 3300049569 Unclassified 553
342 Ga0501039_0022791 3300049575 Bacteria 4803
343 Ga0501041_0518330 3300049577 Bacteria 759
344 Ga0501042_0036538 3300049578 Bacteria 3485
345 Ga0501046_0516247 3300049580 Unclassified 854
346 Ga0501048_0104581 3300049582 Bacteria 1998
347 Ga0501067_0140068 3300049583 Bacteria 1347
348 Ga0501068_0368770 3300049584 Unclassified 924
349 Ga0501071_0095890 3300049587 Bacteria 2183
350 Ga0501072_0044680 3300049588 Bacteria 3483
351 Ga0501074_0881487 3300049590 Unclassified 630
352 Ga0501076_0192098 3300049592 Bacteria 1666
353 Ga0501077_0774924 3300049593 Unclassified 617
354 Ga0501249_028380 3300049679 Unclassified 1241
355 Ga0501229_054313 3300049706 Unclassified 598
356 Ga0501080_0896720 3300049742 Unclassified 773
357 Ga0501080_1214490 3300049742 Bacteria 648
358 Ga0501081_0105140 3300049743 Bacteria 2000
359 Ga0501035_0092645 3300049822 Bacteria 2659
360 Ga0501035_0413963 3300049822 Bacteria 1120
361 Ga0501045_0009100 3300049824 Bacteria 6937
362 nmdc:mga05p37_1124697_c1 3300050507 Unclassified 820
363 nmdc:mga05p37_175712_c1 3300050507 Bacteria 2609
364 nmdc:mga05p37_368026_c1 3300050507 Bacteria 1688
365 nmdc:mga05p37_37661_c1 3300050507 Bacteria 5931
366 nmdc:mga05p37_44446_c1 3300050507 Bacteria 5465
367 nmdc:mga05p37_955_c1 3300050507 Bacteria 32691
368 nmdc:mga09592_122654_c1 3300050508 Unclassified 2233
369 nmdc:mga09592_78978_c1 3300050508 Bacteria 2801
370 nmdc:mga0qj67_66589_c1 3300050509 Bacteria 2869
371 nmdc:mga06r32_1119886_c1 3300050510 Unclassified 736
372 nmdc:mga06r32_1323227_c1 3300050510 Bacteria 664
373 nmdc:mga08y16_1071737_c1 3300050511 Bacteria 782
374 nmdc:mga08y16_149592_c1 3300050511 Unclassified 2427
375 nmdc:mga08y16_49577_c1 3300050511 Unclassified 4395
376 nmdc:mga08y16_499277_c1 3300050511 Unclassified 1236
377 nmdc:mga08y16_7227_c1 3300050511 Bacteria 11653
378 nmdc:mga0n895_1122987_c1 3300050512 Unclassified 763
379 nmdc:mga0n895_137220_c1 3300050512 Unclassified 2473
380 nmdc:mga0n895_164923_c1 3300050512 Unclassified 2247
381 nmdc:mga0n895_18089_c1 3300050512 Bacteria 6515
382 nmdc:mga0n895_30123_c1 3300050512 Bacteria 5183
383 nmdc:mga0n895_94801_c1 3300050512 Bacteria 2989
384 nmdc:mga0rr50_151686_c1 3300050513 Unclassified 1873
385 nmdc:mga0rr50_162205_c1 3300050513 Bacteria 1815
386 nmdc:mga0rr50_1967_c1 3300050513 Bacteria 11407
387 nmdc:mga0rr50_8392_c1 3300050513 Bacteria 6428
388 nmdc:mga08x19_1088782_c1 3300050514 Unclassified 567
389 nmdc:mga08x19_1120350_c1 3300050514 Bacteria 558
390 nmdc:mga0a205_131811_c1 3300050515 Bacteria 2400
391 nmdc:mga0a205_15107_c1 3300050515 Bacteria 7212
392 nmdc:mga0a205_26160_c1 3300050515 Bacteria 5560
393 nmdc:mga0a205_518740_c1 3300050515 Bacteria 1048
394 nmdc:mga0a205_83027_c1 3300050515 Bacteria 3095
395 Ga0501084_0017086 3300054114 Bacteria 6027
396 Ga0501082_0253189 3300060353 Bacteria 1532
397 Ga0530510_0001643 3300061734 Bacteria 15123

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10155396 Ga0157380_101553963 111
2 3300049577 Ga0501041_0518330 Ga0501041_0518330_298_672 114
3 3300005840 Ga0068870_10265371 Ga0068870_102653712 115
4 3300046664 Ga0495659_0120546 Ga0495659_0120546_270_668 115
5 3300005329 Ga0070683_101332323 Ga0070683_1013323231 116
6 3300005354 Ga0070675_100590415 Ga0070675_1005904152 116
7 3300005355 Ga0070671_100200169 Ga0070671_1002001691 116
8 3300005543 Ga0070672_100157966 Ga0070672_1001579662 116
9 3300005548 Ga0070665_100006313 Ga0070665_1000063133 116
10 3300005841 Ga0068863_100086143 Ga0068863_1000861433 116
11 3300006237 Ga0097621_101210173 Ga0097621_1012101731 116
12 3300006871 Ga0075434_100230196 Ga0075434_1002301961 116
13 3300006871 Ga0075434_100407062 Ga0075434_1004070622 116
14 3300006914 Ga0075436_101270001 Ga0075436_1012700012 116
15 3300007076 Ga0075435_100074405 Ga0075435_1000744052 116
16 3300007076 Ga0075435_101563469 Ga0075435_1015634691 116
17 3300009177 Ga0105248_11428512 Ga0105248_114285122 116
18 3300013297 Ga0157378_11268838 Ga0157378_112688381 116
19 3300014325 Ga0163163_11601278 Ga0163163_116012781 116
20 3300025926 Ga0207659_10326107 Ga0207659_103261072 116
21 3300025931 Ga0207644_10071441 Ga0207644_100714412 116
22 3300025940 Ga0207691_10171849 Ga0207691_101718492 116
23 3300026088 Ga0207641_10033865 Ga0207641_100338653 116
24 3300026095 Ga0207676_10732697 Ga0207676_107326971 116
25 3300048913 Ga0496110_1127004 Ga0496110_1127004_163_558 116
26 3300050511 nmdc:mga08y16_1071737_c1 nmdc:mga08y16_1071737_c1_171_626 116
27 3300050512 nmdc:mga0n895_137220_c1 nmdc:mga0n895_137220_c1_2051_2446 116
28 3300050512 nmdc:mga0n895_164923_c1 nmdc:mga0n895_164923_c1_358_753 116
29 3300050513 nmdc:mga0rr50_162205_c1 nmdc:mga0rr50_162205_c1_269_664 116
30 3300050513 nmdc:mga0rr50_8392_c1 nmdc:mga0rr50_8392_c1_3341_3736 116
31 3300050514 nmdc:mga08x19_1120350_c1 nmdc:mga08x19_1120350_c1_74_469 116
32 3300005343 Ga0070687_101499916 Ga0070687_1014999161 117
33 3300005347 Ga0070668_100119191 Ga0070668_1001191912 117
34 3300005468 Ga0070707_101236909 Ga0070707_1012369092 117
35 3300005564 Ga0070664_101795882 Ga0070664_1017958821 117
36 3300006844 Ga0075428_100223867 Ga0075428_1002238673 117
37 3300006846 Ga0075430_100163393 Ga0075430_1001633931 117
38 3300006852 Ga0075433_10106466 Ga0075433_101064662 117
39 3300006880 Ga0075429_100026245 Ga0075429_1000262453 117
40 3300006880 Ga0075429_100631165 Ga0075429_1006311652 117
41 3300009147 Ga0114129_10005499 Ga0114129_1000549913 117
42 3300009147 Ga0114129_10125781 Ga0114129_101257813 117
43 3300009147 Ga0114129_10443256 Ga0114129_104432562 117
44 3300014326 Ga0157380_11072423 Ga0157380_110724231 117
45 3300042530 Ga0450916_081873 Ga0450916_081873_141_542 117
46 3300046537 Ga0495598_0021705 Ga0495598_0021705_649_1053 117
47 3300046664 Ga0495659_0006398 Ga0495659_0006398_528_932 117
48 3300049568 Ga0501031_0812397 Ga0501031_0812397_98_499 117
49 3300049569 Ga0501032_0911268 Ga0501032_0911268_121_522 117
50 3300049575 Ga0501039_0022791 Ga0501039_0022791_1980_2381 117
51 3300049578 Ga0501042_0036538 Ga0501042_0036538_768_1169 117
52 3300049580 Ga0501046_0516247 Ga0501046_0516247_382_783 117
53 3300049582 Ga0501048_0104581 Ga0501048_0104581_1536_1937 117
54 3300049588 Ga0501072_0044680 Ga0501072_0044680_1559_1960 117
55 3300049592 Ga0501076_0192098 Ga0501076_0192098_473_874 117
56 3300049593 Ga0501077_0774924 Ga0501077_0774924_202_603 117
57 3300049742 Ga0501080_0896720 Ga0501080_0896720_236_637 117
58 3300049743 Ga0501081_0105140 Ga0501081_0105140_415_816 117
59 3300049822 Ga0501035_0092645 Ga0501035_0092645_798_1199 117
60 3300049824 Ga0501045_0009100 Ga0501045_0009100_2875_3276 117
61 3300050507 nmdc:mga05p37_175712_c1 nmdc:mga05p37_175712_c1_633_1031 117
62 3300050507 nmdc:mga05p37_368026_c1 nmdc:mga05p37_368026_c1_513_914 117
63 3300050507 nmdc:mga05p37_955_c1 nmdc:mga05p37_955_c1_12097_12495 117
64 3300050508 nmdc:mga09592_122654_c1 nmdc:mga09592_122654_c1_53_451 117
65 3300050508 nmdc:mga09592_78978_c1 nmdc:mga09592_78978_c1_1679_2077 117
66 3300050509 nmdc:mga0qj67_66589_c1 nmdc:mga0qj67_66589_c1_48_446 117
67 3300050510 nmdc:mga06r32_1119886_c1 nmdc:mga06r32_1119886_c1_78_476 117
68 3300050515 nmdc:mga0a205_131811_c1 nmdc:mga0a205_131811_c1_927_1325 117
69 3300054114 Ga0501084_0017086 Ga0501084_0017086_3400_3801 117
70 3300060353 Ga0501082_0253189 Ga0501082_0253189_1014_1415 117
71 3300061734 Ga0530510_0001643 Ga0530510_0001643_7653_8054 117
72 3300005289 Ga0065704_10681372 Ga0065704_106813722 118
73 3300005290 Ga0065712_10411962 Ga0065712_104119622 118
74 3300005293 Ga0065715_10219620 Ga0065715_102196202 118
75 3300005293 Ga0065715_10538663 Ga0065715_105386632 118
76 3300005295 Ga0065707_10484805 Ga0065707_104848052 118
77 3300005330 Ga0070690_100665350 Ga0070690_1006653502 118
78 3300005331 Ga0070670_100055410 Ga0070670_1000554103 118
79 3300005334 Ga0068869_100494948 Ga0068869_1004949482 118
80 3300005336 Ga0070680_100633285 Ga0070680_1006332852 118
81 3300005340 Ga0070689_100151182 Ga0070689_1001511822 118
82 3300005340 Ga0070689_100751883 Ga0070689_1007518832 118
83 3300005341 Ga0070691_10179256 Ga0070691_101792562 118
84 3300005341 Ga0070691_10180246 Ga0070691_101802462 118
85 3300005343 Ga0070687_100094376 Ga0070687_1000943761 118
86 3300005343 Ga0070687_100126931 Ga0070687_1001269312 118
87 3300005344 Ga0070661_100495152 Ga0070661_1004951522 118
88 3300005353 Ga0070669_100002320 Ga0070669_10000232010 118
89 3300005354 Ga0070675_100023030 Ga0070675_1000230302 118
90 3300005354 Ga0070675_100230237 Ga0070675_1002302372 118
91 3300005356 Ga0070674_100360307 Ga0070674_1003603071 118
92 3300005364 Ga0070673_100130563 Ga0070673_1001305633 118
93 3300005365 Ga0070688_100057484 Ga0070688_1000574843 118
94 3300005365 Ga0070688_100331022 Ga0070688_1003310222 118
95 3300005366 Ga0070659_101945168 Ga0070659_1019451681 118
96 3300005438 Ga0070701_10002939 Ga0070701_100029395 118
97 3300005438 Ga0070701_10015921 Ga0070701_100159213 118
98 3300005438 Ga0070701_10401440 Ga0070701_104014402 118
99 3300005440 Ga0070705_100016820 Ga0070705_1000168204 118
100 3300005440 Ga0070705_100084098 Ga0070705_1000840983 118
101 3300005440 Ga0070705_100261430 Ga0070705_1002614302 118
102 3300005441 Ga0070700_100542989 Ga0070700_1005429892 118
103 3300005444 Ga0070694_100001751 Ga0070694_10000175113 118
104 3300005444 Ga0070694_100001969 Ga0070694_1000019695 118
105 3300005444 Ga0070694_100009058 Ga0070694_1000090585 118
106 3300005444 Ga0070694_100092460 Ga0070694_1000924601 118
107 3300005444 Ga0070694_101888948 Ga0070694_1018889481 118
108 3300005455 Ga0070663_100786185 Ga0070663_1007861851 118
109 3300005456 Ga0070678_102392792 Ga0070678_1023927921 118
110 3300005457 Ga0070662_100018635 Ga0070662_1000186353 118
111 3300005459 Ga0068867_100042600 Ga0068867_1000426002 118
112 3300005459 Ga0068867_100580952 Ga0068867_1005809522 118
113 3300005459 Ga0068867_101601457 Ga0068867_1016014571 118
114 3300005466 Ga0070685_10153120 Ga0070685_101531202 118
115 3300005467 Ga0070706_100512678 Ga0070706_1005126781 118
116 3300005467 Ga0070706_100733263 Ga0070706_1007332631 118
117 3300005467 Ga0070706_101042499 Ga0070706_1010424991 118
118 3300005468 Ga0070707_100018324 Ga0070707_1000183245 118
119 3300005468 Ga0070707_101250687 Ga0070707_1012506872 118
120 3300005468 Ga0070707_101823286 Ga0070707_1018232861 118
121 3300005471 Ga0070698_100004770 Ga0070698_10000477012 118
122 3300005471 Ga0070698_100016307 Ga0070698_1000163073 118
123 3300005518 Ga0070699_100000148 Ga0070699_10000014811 118
124 3300005518 Ga0070699_100005763 Ga0070699_1000057639 118
125 3300005518 Ga0070699_100021890 Ga0070699_1000218905 118
126 3300005518 Ga0070699_100622668 Ga0070699_1006226682 118
127 3300005530 Ga0070679_100766249 Ga0070679_1007662492 118
128 3300005536 Ga0070697_100112517 Ga0070697_1001125172 118
129 3300005543 Ga0070672_100775236 Ga0070672_1007752361 118
130 3300005544 Ga0070686_101375550 Ga0070686_1013755502 118
131 3300005545 Ga0070695_100007561 Ga0070695_1000075617 118
132 3300005545 Ga0070695_100045623 Ga0070695_1000456232 118
133 3300005545 Ga0070695_100074126 Ga0070695_1000741262 118
134 3300005545 Ga0070695_100227162 Ga0070695_1002271621 118
135 3300005545 Ga0070695_100294962 Ga0070695_1002949622 118
136 3300005546 Ga0070696_100000912 Ga0070696_10000091219 118
137 3300005546 Ga0070696_100323840 Ga0070696_1003238402 118
138 3300005547 Ga0070693_100359468 Ga0070693_1003594682 118
139 3300005549 Ga0070704_100010290 Ga0070704_1000102902 118
140 3300005549 Ga0070704_100990328 Ga0070704_1009903281 118
141 3300005564 Ga0070664_100118946 Ga0070664_1001189463 118
142 3300005564 Ga0070664_100205249 Ga0070664_1002052492 118
143 3300005577 Ga0068857_100063530 Ga0068857_1000635301 118
144 3300005577 Ga0068857_100073624 Ga0068857_1000736243 118
145 3300005578 Ga0068854_100842868 Ga0068854_1008428682 118
146 3300005615 Ga0070702_100382166 Ga0070702_1003821662 118
147 3300005615 Ga0070702_100472652 Ga0070702_1004726522 118
148 3300005615 Ga0070702_101204324 Ga0070702_1012043241 118
149 3300005615 Ga0070702_101289922 Ga0070702_1012899221 118
150 3300005615 Ga0070702_101550184 Ga0070702_1015501841 118
151 3300005616 Ga0068852_101820985 Ga0068852_1018209852 118
152 3300005617 Ga0068859_100056052 Ga0068859_1000560521 118
153 3300005617 Ga0068859_100191166 Ga0068859_1001911662 118
154 3300005617 Ga0068859_100239966 Ga0068859_1002399663 118
155 3300005719 Ga0068861_100002036 Ga0068861_1000020365 118
156 3300005719 Ga0068861_100592044 Ga0068861_1005920441 118
157 3300005719 Ga0068861_100887594 Ga0068861_1008875942 118
158 3300005840 Ga0068870_10002016 Ga0068870_100020161 118
159 3300005841 Ga0068863_100936198 Ga0068863_1009361982 118
160 3300005842 Ga0068858_100209923 Ga0068858_1002099232 118
161 3300005844 Ga0068862_100002651 Ga0068862_10000265112 118
162 3300005844 Ga0068862_101180556 Ga0068862_1011805562 118
163 3300006058 Ga0075432_10010445 Ga0075432_100104452 118
164 3300006237 Ga0097621_100245152 Ga0097621_1002451522 118
165 3300006358 Ga0068871_100049463 Ga0068871_1000494633 118
166 3300006358 Ga0068871_100065561 Ga0068871_1000655612 118
167 3300006852 Ga0075433_10249214 Ga0075433_102492142 118
168 3300006852 Ga0075433_10422594 Ga0075433_104225941 118
169 3300006852 Ga0075433_11644492 Ga0075433_116444922 118
170 3300006871 Ga0075434_100036617 Ga0075434_1000366173 118
171 3300006871 Ga0075434_100293016 Ga0075434_1002930161 118
172 3300006871 Ga0075434_101042445 Ga0075434_1010424452 118
173 3300006871 Ga0075434_101302136 Ga0075434_1013021361 118
174 3300006881 Ga0068865_100373799 Ga0068865_1003737991 118
175 3300006881 Ga0068865_100402313 Ga0068865_1004023132 118
176 3300006914 Ga0075436_100868526 Ga0075436_1008685262 118
177 3300006914 Ga0075436_101225079 Ga0075436_1012250791 118
178 3300006931 Ga0097620_100056053 Ga0097620_1000560531 118
179 3300006931 Ga0097620_100191179 Ga0097620_1001911792 118
180 3300006931 Ga0097620_100239974 Ga0097620_1002399743 118
181 3300007076 Ga0075435_100094503 Ga0075435_1000945035 118
182 3300007076 Ga0075435_100174600 Ga0075435_1001746002 118
183 3300009094 Ga0111539_10004603 Ga0111539_1000460313 118
184 3300009094 Ga0111539_10530869 Ga0111539_105308692 118
185 3300009098 Ga0105245_10163812 Ga0105245_101638122 118
186 3300009147 Ga0114129_10020765 Ga0114129_100207653 118
187 3300009147 Ga0114129_10021565 Ga0114129_1002156511 118
188 3300009147 Ga0114129_10091901 Ga0114129_100919015 118
189 3300009147 Ga0114129_10305527 Ga0114129_103055272 118
190 3300009148 Ga0105243_10047095 Ga0105243_100470953 118
191 3300009148 Ga0105243_10138691 Ga0105243_101386912 118
192 3300009148 Ga0105243_13029124 Ga0105243_130291241 118
193 3300009176 Ga0105242_10105463 Ga0105242_101054631 118
194 3300009177 Ga0105248_10366972 Ga0105248_103669722 118
195 3300009553 Ga0105249_10002720 Ga0105249_100027206 118
196 3300011119 Ga0105246_10296262 Ga0105246_102962622 118
197 3300011119 Ga0105246_10503078 Ga0105246_105030782 118
198 3300012508 Ga0157315_1017523 Ga0157315_10175231 118
199 3300013296 Ga0157374_10225542 Ga0157374_102255422 118
200 3300013297 Ga0157378_11263642 Ga0157378_112636421 118
201 3300013306 Ga0163162_11064494 Ga0163162_110644942 118
202 3300013308 Ga0157375_10039449 Ga0157375_100394495 118
203 3300013308 Ga0157375_10887672 Ga0157375_108876721 118
204 3300014326 Ga0157380_10044308 Ga0157380_100443081 118
205 3300014745 Ga0157377_10324505 Ga0157377_103245052 118
206 3300014969 Ga0157376_10132315 Ga0157376_101323152 118
207 3300014969 Ga0157376_10651593 Ga0157376_106515931 118
208 3300025271 Ga0207666_1030728 Ga0207666_10307282 118
209 3300025885 Ga0207653_10047160 Ga0207653_100471602 118
210 3300025893 Ga0207682_10075995 Ga0207682_100759952 118
211 3300025903 Ga0207680_10104501 Ga0207680_101045013 118
212 3300025907 Ga0207645_10149364 Ga0207645_101493642 118
213 3300025908 Ga0207643_10002530 Ga0207643_100025303 118
214 3300025910 Ga0207684_10892741 Ga0207684_108927411 118
215 3300025917 Ga0207660_10423016 Ga0207660_104230162 118
216 3300025918 Ga0207662_10102080 Ga0207662_101020802 118
217 3300025918 Ga0207662_10484706 Ga0207662_104847062 118
218 3300025920 Ga0207649_11309712 Ga0207649_113097122 118
219 3300025922 Ga0207646_10011300 Ga0207646_100113002 118
220 3300025922 Ga0207646_10948013 Ga0207646_109480131 118
221 3300025922 Ga0207646_11130069 Ga0207646_111300692 118
222 3300025922 Ga0207646_11436685 Ga0207646_114366852 118
223 3300025923 Ga0207681_10009535 Ga0207681_100095355 118
224 3300025925 Ga0207650_10040801 Ga0207650_100408012 118
225 3300025926 Ga0207659_10008010 Ga0207659_100080102 118
226 3300025926 Ga0207659_10357550 Ga0207659_103575502 118
227 3300025926 Ga0207659_10978094 Ga0207659_109780942 118
228 3300025927 Ga0207687_10548224 Ga0207687_105482242 118
229 3300025932 Ga0207690_10533193 Ga0207690_105331932 118
230 3300025933 Ga0207706_10068701 Ga0207706_100687012 118
231 3300025935 Ga0207709_10021900 Ga0207709_100219003 118
232 3300025935 Ga0207709_10153301 Ga0207709_101533012 118
233 3300025936 Ga0207670_10005252 Ga0207670_100052528 118
234 3300025936 Ga0207670_10573291 Ga0207670_105732912 118
235 3300025937 Ga0207669_11225941 Ga0207669_112259412 118
236 3300025940 Ga0207691_10196375 Ga0207691_101963752 118
237 3300025942 Ga0207689_10188828 Ga0207689_101888282 118
238 3300025942 Ga0207689_10441294 Ga0207689_104412942 118
239 3300025942 Ga0207689_10473787 Ga0207689_104737872 118
240 3300025945 Ga0207679_10096756 Ga0207679_100967563 118
241 3300025960 Ga0207651_10127454 Ga0207651_101274542 118
242 3300025960 Ga0207651_10145509 Ga0207651_101455092 118
243 3300025960 Ga0207651_10173979 Ga0207651_101739792 118
244 3300025961 Ga0207712_10004553 Ga0207712_100045536 118
245 3300025972 Ga0207668_10030570 Ga0207668_100305703 118
246 3300025981 Ga0207640_10801873 Ga0207640_108018732 118
247 3300025986 Ga0207658_12037636 Ga0207658_120376361 118
248 3300026023 Ga0207677_10175991 Ga0207677_101759912 118
249 3300026035 Ga0207703_10053602 Ga0207703_100536023 118
250 3300026041 Ga0207639_11668475 Ga0207639_116684752 118
251 3300026067 Ga0207678_10865095 Ga0207678_108650952 118
252 3300026075 Ga0207708_10057953 Ga0207708_100579532 118
253 3300026088 Ga0207641_11192382 Ga0207641_111923821 118
254 3300026089 Ga0207648_10001634 Ga0207648_100016345 118
255 3300026095 Ga0207676_10345248 Ga0207676_103452481 118
256 3300026116 Ga0207674_10005085 Ga0207674_100050853 118
257 3300026116 Ga0207674_10089311 Ga0207674_100893112 118
258 3300026118 Ga0207675_100003468 Ga0207675_10000346814 118
259 3300026118 Ga0207675_100008997 Ga0207675_1000089971 118
260 3300026118 Ga0207675_100135071 Ga0207675_1001350713 118
261 3300026118 Ga0207675_100812975 Ga0207675_1008129752 118
262 3300027907 Ga0207428_10000231 Ga0207428_1000023180 118
263 3300028380 Ga0268265_10000545 Ga0268265_1000054515 118
264 3300028381 Ga0268264_10552660 Ga0268264_105526602 118
265 3300031548 Ga0307408_100484988 Ga0307408_1004849882 118
266 3300031727 Ga0316576_10567546 Ga0316576_105675462 118
267 3300031852 Ga0307410_10491743 Ga0307410_104917432 118
268 3300031911 Ga0307412_10438131 Ga0307412_104381312 118
269 3300032002 Ga0307416_103042998 Ga0307416_1030429982 118
270 3300034817 Ga0373948_0100715 Ga0373948_0100715_195_599 118
271 3300034819 Ga0373958_0073047 Ga0373958_0073047_329_733 118
272 3300035090 Ga0373949_0026460 Ga0373949_0026460_389_793 118
273 3300035112 Ga0373932_0144128 Ga0373932_0144128_156_560 118
274 3300035114 Ga0373939_0053368 Ga0373939_0053368_200_604 118
275 3300035242 Ga0373962_0055791 Ga0373962_0055791_518_922 118
276 3300045051 Ga0451576_0014207 Ga0451576_0014207_2675_3076 118
277 3300045051 Ga0451576_0077659 Ga0451576_0077659_545_946 118
278 3300045051 Ga0451576_0139640 Ga0451576_0139640_1308_1712 118
279 3300045051 Ga0451576_0210917 Ga0451576_0210917_259_663 118
280 3300046455 Ga0495603_0130468 Ga0495603_0130468_834_1241 118
281 3300046459 Ga0495629_0524098 Ga0495629_0524098_68_475 118
282 3300046491 Ga0495584_0058948 Ga0495584_0058948_1292_1693 118
283 3300046492 Ga0495585_0391892 Ga0495585_0391892_42_446 118
284 3300046499 Ga0495594_0016834 Ga0495594_0016834_458_865 118
285 3300046537 Ga0495598_0430204 Ga0495598_0430204_89_490 118
286 3300046539 Ga0495621_0005881 Ga0495621_0005881_655_1059 118
287 3300046539 Ga0495621_0050312 Ga0495621_0050312_819_1220 118
288 3300046664 Ga0495659_0059675 Ga0495659_0059675_236_634 118
289 3300046664 Ga0495659_0064078 Ga0495659_0064078_528_929 118
290 3300046664 Ga0495659_0199380 Ga0495659_0199380_346_750 118
291 3300046664 Ga0495659_0209645 Ga0495659_0209645_63_464 118
292 3300046664 Ga0495659_0230634 Ga0495659_0230634_151_558 118
293 3300046664 Ga0495659_0241601 Ga0495659_0241601_287_688 118
294 3300046664 Ga0495659_0375363 Ga0495659_0375363_142_546 118
295 3300046674 Ga0495588_0032683 Ga0495588_0032683_1594_2001 118
296 3300046691 Ga0495670_0342639 Ga0495670_0342639_28_429 118
297 3300046691 Ga0495670_0408477 Ga0495670_0408477_184_588 118
298 3300047318 Ga0495636_0029544 Ga0495636_0029544_1774_2175 118
299 3300047318 Ga0495636_0364996 Ga0495636_0364996_196_597 118
300 3300049583 Ga0501067_0140068 Ga0501067_0140068_383_787 118
301 3300049584 Ga0501068_0368770 Ga0501068_0368770_119_523 118
302 3300049590 Ga0501074_0881487 Ga0501074_0881487_22_426 118
303 3300049742 Ga0501080_1214490 Ga0501080_1214490_186_578 118
304 3300050507 nmdc:mga05p37_1124697_c1 nmdc:mga05p37_1124697_c1_333_734 118
305 3300050507 nmdc:mga05p37_37661_c1 nmdc:mga05p37_37661_c1_4601_5002 118
306 3300050507 nmdc:mga05p37_44446_c1 nmdc:mga05p37_44446_c1_4942_5343 118
307 3300050511 nmdc:mga08y16_149592_c1 nmdc:mga08y16_149592_c1_1013_1417 118
308 3300050511 nmdc:mga08y16_7227_c1 nmdc:mga08y16_7227_c1_2338_2742 118
309 3300050512 nmdc:mga0n895_1122987_c1 nmdc:mga0n895_1122987_c1_148_549 118
310 3300050512 nmdc:mga0n895_18089_c1 nmdc:mga0n895_18089_c1_2558_2959 118
311 3300050512 nmdc:mga0n895_94801_c1 nmdc:mga0n895_94801_c1_2058_2459 118
312 3300050513 nmdc:mga0rr50_151686_c1 nmdc:mga0rr50_151686_c1_899_1285 118
313 3300050514 nmdc:mga08x19_1088782_c1 nmdc:mga08x19_1088782_c1_64_465 118
314 3300050515 nmdc:mga0a205_15107_c1 nmdc:mga0a205_15107_c1_127_528 118
315 3300050515 nmdc:mga0a205_83027_c1 nmdc:mga0a205_83027_c1_2630_3031 118
316 3300005536 Ga0070697_100982732 Ga0070697_1009827321 119
317 3300005985 Ga0081539_10000175 Ga0081539_10000175127 119
318 3300006028 Ga0070717_11975738 Ga0070717_119757382 119
319 3300006173 Ga0070716_100175314 Ga0070716_1001753141 119
320 3300009093 Ga0105240_10057138 Ga0105240_100571382 119
321 3300009094 Ga0111539_11112946 Ga0111539_111129462 119
322 3300009553 Ga0105249_10320676 Ga0105249_103206762 119
323 3300025913 Ga0207695_10093853 Ga0207695_100938533 119
324 3300025928 Ga0207700_10416385 Ga0207700_104163851 119
325 3300028380 Ga0268265_10206670 Ga0268265_102066702 119
326 3300035398 Ga0316574_0078967 Ga0316574_0078967_686_1108 119
327 3300035725 Ga0373947_0459639 Ga0373947_0459639_415_825 119
328 3300037068 Ga0373925_1588649 Ga0373925_1588649_25_435 119
329 3300042530 Ga0450916_057110 Ga0450916_057110_131_523 119
330 3300045051 Ga0451576_0993286 Ga0451576_0993286_289_678 119
331 3300046472 Ga0495580_0147590 Ga0495580_0147590_917_1327 119
332 3300046522 Ga0495643_0355444 Ga0495643_0355444_119_511 119
333 3300047321 Ga0495676_1026926 Ga0495676_1026926_84_494 119
334 3300049587 Ga0501071_0095890 Ga0501071_0095890_64_456 119
335 3300049822 Ga0501035_0413963 Ga0501035_0413963_714_1106 119
336 3300050511 nmdc:mga08y16_499277_c1 nmdc:mga08y16_499277_c1_62_451 119
337 3300050515 nmdc:mga0a205_518740_c1 nmdc:mga0a205_518740_c1_137_526 119
338 3300005719 Ga0068861_100747367 Ga0068861_1007473671 120
339 3300005843 Ga0068860_101314383 Ga0068860_1013143832 120
340 3300006844 Ga0075428_100152304 Ga0075428_1001523043 120
341 3300006844 Ga0075428_100493563 Ga0075428_1004935632 120
342 3300009094 Ga0111539_10003655 Ga0111539_100036554 120
343 3300025918 Ga0207662_10503506 Ga0207662_105035062 120
344 3300026095 Ga0207676_10855762 Ga0207676_108557621 120
345 3300026118 Ga0207675_100720139 Ga0207675_1007201391 120
346 3300046616 Ga0495668_0232006 Ga0495668_0232006_67_462 120
347 3300046692 Ga0495671_0078357 Ga0495671_0078357_552_947 120
348 3300050511 nmdc:mga08y16_49577_c1 nmdc:mga08y16_49577_c1_1115_1513 120
349 3300005290 Ga0065712_10327474 Ga0065712_103274741 121
350 3300005354 Ga0070675_100110239 Ga0070675_1001102394 121
351 3300005545 Ga0070695_100134567 Ga0070695_1001345672 121
352 3300005546 Ga0070696_101205228 Ga0070696_1012052282 121
353 3300005549 Ga0070704_100910029 Ga0070704_1009100292 121
354 3300005577 Ga0068857_100108997 Ga0068857_1001089972 121
355 3300005617 Ga0068859_100861099 Ga0068859_1008610992 121
356 3300005842 Ga0068858_100002852 Ga0068858_1000028522 121
357 3300005842 Ga0068858_100289508 Ga0068858_1002895082 121
358 3300005843 Ga0068860_100311471 Ga0068860_1003114712 121
359 3300005844 Ga0068862_102438750 Ga0068862_1024387501 121
360 3300006931 Ga0097620_100861060 Ga0097620_1008610602 121
361 3300009101 Ga0105247_10208593 Ga0105247_102085932 121
362 3300009147 Ga0114129_11366043 Ga0114129_113660432 121
363 3300009553 Ga0105249_10184891 Ga0105249_101848911 121
364 3300011119 Ga0105246_10662138 Ga0105246_106621382 121
365 3300014968 Ga0157379_10012294 Ga0157379_100122943 121
366 3300025900 Ga0207710_10112550 Ga0207710_101125502 121
367 3300025941 Ga0207711_10797690 Ga0207711_107976902 121
368 3300025942 Ga0207689_10062783 Ga0207689_100627831 121
369 3300025960 Ga0207651_11510838 Ga0207651_115108382 121
370 3300026035 Ga0207703_10016344 Ga0207703_100163441 121
371 3300026035 Ga0207703_10914199 Ga0207703_109141992 121
372 3300026116 Ga0207674_10121101 Ga0207674_101211012 121
373 3300028380 Ga0268265_10521652 Ga0268265_105216522 121
374 3300028381 Ga0268264_10130194 Ga0268264_101301943 121
375 3300028381 Ga0268264_10495052 Ga0268264_104950522 121
376 3300050510 nmdc:mga06r32_1323227_c1 nmdc:mga06r32_1323227_c1_155_550 121
377 3300005330 Ga0070690_100785584 Ga0070690_1007855842 122
378 3300005355 Ga0070671_100803329 Ga0070671_1008033292 122
379 3300005364 Ga0070673_100933735 Ga0070673_1009337352 122
380 3300005441 Ga0070700_100164350 Ga0070700_1001643502 122
381 3300005471 Ga0070698_100070914 Ga0070698_1000709142 122
382 3300005543 Ga0070672_101291484 Ga0070672_1012914842 122
383 3300005545 Ga0070695_100695989 Ga0070695_1006959892 122
384 3300005546 Ga0070696_101007109 Ga0070696_1010071091 122
385 3300006237 Ga0097621_101669710 Ga0097621_1016697102 122
386 3300006852 Ga0075433_10000250 Ga0075433_1000025012 122
387 3300006871 Ga0075434_100000994 Ga0075434_1000009943 122
388 3300007076 Ga0075435_100003523 Ga0075435_10000352312 122
389 3300046472 Ga0495580_0399913 Ga0495580_0399913_238_636 122
390 3300049679 Ga0501249_028380 Ga0501249_028380_586_984 122
391 3300049706 Ga0501229_054313 Ga0501229_054313_46_444 122
392 3300050512 nmdc:mga0n895_30123_c1 nmdc:mga0n895_30123_c1_3511_3909 122
393 3300050513 nmdc:mga0rr50_1967_c1 nmdc:mga0rr50_1967_c1_1370_1768 122
394 3300050515 nmdc:mga0a205_26160_c1 nmdc:mga0a205_26160_c1_2884_3282 122
395 3300009176 Ga0105242_11215273 Ga0105242_112152731 125
396 3300003203 JGI25406J46586_10089776 JGI25406J46586_100897762 127
397 3300005985 Ga0081539_10002917 Ga0081539_1000291714 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

7

106

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xn1-assembly1.cif.gz_A crystal structure of the gh43_1 enzyme from xanthomonas citri complexed with xylose 0.7687 41 71
1sru-assembly1.cif.gz_C crystal structure of full length e. coli ssb protein 0.7635 31 95
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7438 34 68
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7435 34 68
6xn1-assembly2.cif.gz_B crystal structure of the gh43_1 enzyme from xanthomonas citri complexed with xylose 0.7429 41 71
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8708 38 67 2.30.29.30
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8261 38 71 2.30.29.30
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.806 32 91 2.40.50.140
af_Q69TF4_44_149_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.806 40 69 3.30.420.40
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7992 32 92 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A381VHI2-F1-model_v4 Uncharacterized protein 0.9699 30 120
AF-A0A4Q6B4C5-F1-model_v4 Uncharacterized protein 0.9656 26 120
AF-A0A2V8GWG2-F1-model_v4 DUF5666 domain-containing protein 0.9642 30 119
AF-A0A2V8MEI0-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9635 24 121
AF-A0A2V8A7A3-F1-model_v4 Uncharacterized protein 0.9622 21 119

Feature Viewer

pLDDT pTM Quality
86.91 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map