F434036

General Info

Members Datasets Scaffolds Average Seq Length
398 281 796 330

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10018604|Ga0157371_100186043
Length 347
Sequence MGRLDHMTAKTVTPRYIVPDVMKAIDPDAPGGPEVLVLVERAVPHPGAGXXXXKVAAAGVNRPEVMQRQGKYPPPPGAPSILGMEIAGTIVAVGDGVGEEQIGQRICALITGGAYAEYAVAPFGQCLSVPEALTMVEAAAMPETLFTVWTNLFERAYATEGDTVLVHGGTSGIGTMAIGLCSIFGIDIIVTAGSKAKCQAALSLGATHAIDYKTEDFVERVKQITGGKGVAAVLDMVGGDYVARNLQCLAEDGRHVSIAVQGGANATVPLFEIMRRRLTLTGSTLRPRDTAFKSLVADELARTVWPHVEAGKLKPVIDRVFAFADAPAAHARMEAGDHVGKIVLSMT

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
121 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
122 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
123 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
124 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
154 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
155 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
156 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
157 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
158 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
159 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
160 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
163 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
164 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
165 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
166 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
167 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
168 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
169 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
170 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
171 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
172 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
173 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
174 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
175 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
176 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
177 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
178 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
179 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
180 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
181 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
182 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
183 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
184 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
185 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
186 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
187 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
188 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
189 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
190 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
191 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
192 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
193 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
194 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
195 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
196 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
197 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
198 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
199 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
200 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
201 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
202 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
203 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
204 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
205 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
206 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
207 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
208 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
209 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
210 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
211 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
212 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
213 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
214 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
215 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
216 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
217 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
218 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
219 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
220 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
221 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
222 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
223 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
224 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
225 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
226 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
227 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
228 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
229 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
230 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
231 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
232 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
233 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
234 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
235 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
236 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
237 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
238 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
239 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
240 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
241 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
242 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
243 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
244 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
245 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
246 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
247 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
248 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
249 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
250 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
251 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
252 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
253 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
254 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
255 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
256 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
257 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
258 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
259 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
260 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
261 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
262 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
263 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
264 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
265 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
266 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
267 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
268 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
269 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
270 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
271 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
272 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
273 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
274 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
275 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
276 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
277 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
278 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
279 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
280 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
281 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.85
Metatranscriptomes 0
Isolates 30.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.29
Nodule 27.89
Rhizoplane 1.76
Rhizosphere 57.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10018604 3300013102 Bacteria 5132
2 JGI24736J21556_1000519 3300001904 Bacteria 7186
3 JGI24736J21556_1002154 3300001904 Bacteria 3496
4 JGI24741J21665_1000583 3300001915 Bacteria 11060
5 JGI24740J21852_10005710 3300001979 Bacteria 5233
6 JGI24739J22299_10003840 3300001989 Bacteria 5732
7 JGI24735J21928_10000683 3300002067 Bacteria 12035
8 JGI25150J39212_1000886 3300002774 Bacteria 9837
9 JGI25151J46595_10026616 3300003187 Bacteria 2331
10 JGI25165J46597_1000024 3300003214 Bacteria 335150
11 JGI25153J46596_10000091 3300003215 Bacteria 105614
12 JGI25153J46596_10000186 3300003215 Bacteria 60427
13 rootH1_10006736 3300003316 Bacteria 1227
14 Ga0055526_1009414 3300003771 Bacteria 4701
15 Ga0055537_1001804 3300003773 Bacteria 7783
16 Ga0065165_1003640 3300005262 Bacteria 10533
17 Ga0065704_10001898 3300005289 Bacteria 6321
18 Ga0070658_10007316 3300005327 Bacteria 8916
19 Ga0070658_10019618 3300005327 Bacteria 5413
20 Ga0070683_100450155 3300005329 Bacteria 1228
21 Ga0070660_100001066 3300005339 Bacteria 18437
22 Ga0070660_100017115 3300005339 Bacteria 5278
23 Ga0070660_100073630 3300005339 Bacteria 2671
24 Ga0070661_100138020 3300005344 Bacteria 1836
25 Ga0070692_10034107 3300005345 Bacteria 2568
26 Ga0070668_100017467 3300005347 Bacteria 5378
27 Ga0070668_100039885 3300005347 Bacteria 3592
28 Ga0070675_100023581 3300005354 Bacteria 4921
29 Ga0070675_100038793 3300005354 Bacteria 3884
30 Ga0070673_100017391 3300005364 Bacteria 5111
31 Ga0070688_100014671 3300005365 Bacteria 4443
32 Ga0070659_100011540 3300005366 Bacteria 6537
33 Ga0070659_100017777 3300005366 Bacteria 5355
34 Ga0070659_100020518 3300005366 Bacteria 5021
35 Ga0070659_100132963 3300005366 Bacteria 2021
36 Ga0070659_100266432 3300005366 Bacteria 1422
37 Ga0070663_100012087 3300005455 Bacteria 5448
38 Ga0070678_100016484 3300005456 Bacteria 4729
39 Ga0070684_100105217 3300005535 Bacteria 2525
40 Ga0068853_100119786 3300005539 Bacteria 2346
41 Ga0068853_100174762 3300005539 Bacteria 1945
42 Ga0070672_100070368 3300005543 Bacteria 2780
43 Ga0070665_100006682 3300005548 Bacteria 11728
44 Ga0068855_100001731 3300005563 Bacteria 27264
45 Ga0068855_100116519 3300005563 Bacteria 3062
46 Ga0070664_100042633 3300005564 Bacteria 3830
47 Ga0070664_100072362 3300005564 Bacteria 2956
48 Ga0068857_100057636 3300005577 Bacteria 3448
49 Ga0068857_100093600 3300005577 Bacteria 2691
50 Ga0068854_100001958 3300005578 Bacteria 12586
51 Ga0068854_100066261 3300005578 Bacteria 2628
52 Ga0068856_100008682 3300005614 Bacteria 9884
53 Ga0068856_100169423 3300005614 Bacteria 2196
54 Ga0068852_100001847 3300005616 Bacteria 14394
55 Ga0068852_100007109 3300005616 Bacteria 8155
56 Ga0068852_100156132 3300005616 Bacteria 2126
57 Ga0068859_100021809 3300005617 Bacteria 6424
58 Ga0068861_100000349 3300005719 Bacteria 26297
59 Ga0068860_100080306 3300005843 Bacteria 3102
60 Ga0097620_100021809 3300006931 Bacteria 6424
61 Ga0097620_100155645 3300006931 Bacteria 2363
62 Ga0079104_1005018 3300006946 Bacteria 5419
63 Ga0105251_10054843 3300009011 Bacteria 1891
64 Ga0105240_10030389 3300009093 Bacteria 7021
65 Ga0105240_10086138 3300009093 Bacteria 3848
66 Ga0105240_10104563 3300009093 Bacteria 3439
67 Ga0105240_10236329 3300009093 Bacteria 2121
68 Ga0105245_10000853 3300009098 Bacteria 27630
69 Ga0105243_10060489 3300009148 Bacteria 3026
70 Ga0105243_10288583 3300009148 Bacteria 1481
71 Ga0105241_10024108 3300009174 Bacteria 4518
72 Ga0105248_10105518 3300009177 Bacteria 3177
73 Ga0105237_10090852 3300009545 Bacteria 3043
74 Ga0105238_10113404 3300009551 Bacteria 2690
75 Ga0105238_10346553 3300009551 Bacteria 1474
76 Ga0105238_10402577 3300009551 Bacteria 1362
77 Ga0105148_100223 3300009978 Bacteria 8086
78 Ga0105239_10086153 3300010375 Bacteria 3462
79 Ga0105239_10378907 3300010375 Bacteria 1599
80 Ga0105239_10492285 3300010375 Bacteria 1393
81 Ga0157373_10071651 3300013100 Bacteria 2447
82 Ga0157371_10009668 3300013102 Bacteria 7578
83 Ga0157371_10024152 3300013102 Bacteria 4441
84 Ga0157371_10071085 3300013102 Bacteria 2463
85 Ga0157371_10155777 3300013102 Bacteria 1630
86 Ga0157370_10037708 3300013104 Bacteria 4682
87 Ga0157370_10197891 3300013104 Bacteria 1865
88 Ga0157369_10001843 3300013105 Bacteria 25619
89 Ga0157369_10004559 3300013105 Bacteria 16291
90 Ga0157369_10068681 3300013105 Bacteria 3807
91 Ga0157369_10108914 3300013105 Bacteria 2946
92 Ga0157374_10010254 3300013296 Bacteria 8058
93 Ga0163162_10068828 3300013306 Bacteria 3592
94 Ga0157372_10042339 3300013307 Bacteria 5036
95 Ga0157372_10087458 3300013307 Bacteria 3536
96 Ga0163163_10113021 3300014325 Bacteria 2745
97 Ga0163161_10083831 3300017792 Bacteria 2350
98 Ga0163161_10097758 3300017792 Bacteria 2181
99 Ga0213875_10000230 3300021388 Bacteria 56647
100 Ga0209437_104090 3300025233 Bacteria 2585
101 Ga0207425_1000049 3300025245 Bacteria 180735
102 Ga0209129_1001567 3300025258 Bacteria 12551
103 Ga0209233_1000084 3300025261 Bacteria 335222
104 Ga0209565_1000170 3300025263 Bacteria 84580
105 Ga0209673_1011318 3300025273 Bacteria 3686
106 Ga0209025_1000068 3300025294 Bacteria 294129
107 Ga0209564_1000335 3300025295 Bacteria 91079
108 Ga0209758_1000019 3300025297 Bacteria 743682
109 Ga0209050_1000001 3300025298 Bacteria 3563507
110 Ga0209050_1000108 3300025298 Bacteria 222534
111 Ga0207426_1014823 3300025302 Bacteria 2847
112 Ga0209051_1000239 3300025303 Bacteria 92575
113 Ga0207647_10009334 3300025904 Bacteria 6974
114 Ga0207647_10016410 3300025904 Bacteria 5055
115 Ga0207647_10039536 3300025904 Bacteria 2975
116 Ga0207705_10000003 3300025909 Bacteria 709270
117 Ga0207705_10000046 3300025909 Bacteria 177574
118 Ga0207705_10000215 3300025909 Bacteria 57467
119 Ga0207705_10000849 3300025909 Bacteria 25053
120 Ga0207705_10003040 3300025909 Bacteria 12799
121 Ga0207705_10039675 3300025909 Bacteria 3375
122 Ga0207705_10087451 3300025909 Bacteria 2279
123 Ga0207654_10008029 3300025911 Bacteria 5320
124 Ga0207695_10003916 3300025913 Bacteria 20603
125 Ga0207695_10040354 3300025913 Bacteria 5007
126 Ga0207671_10013100 3300025914 Bacteria 6625
127 Ga0207671_10364792 3300025914 Bacteria 1147
128 Ga0207657_10001406 3300025919 Bacteria 25663
129 Ga0207657_10008313 3300025919 Bacteria 10560
130 Ga0207657_10008667 3300025919 Bacteria 10298
131 Ga0207657_10009957 3300025919 Bacteria 9515
132 Ga0207649_10053969 3300025920 Bacteria 2500
133 Ga0207652_10111263 3300025921 Bacteria 2429
134 Ga0207694_10351768 3300025924 Bacteria 1220
135 Ga0207659_10005781 3300025926 Bacteria 7537
136 Ga0207690_10012871 3300025932 Bacteria 5013
137 Ga0207690_10038294 3300025932 Bacteria 3119
138 Ga0207690_10096183 3300025932 Bacteria 2105
139 Ga0207706_10013110 3300025933 Bacteria 7540
140 Ga0207709_10073199 3300025935 Bacteria 2182
141 Ga0207704_10242743 3300025938 Bacteria 1347
142 Ga0207711_10055027 3300025941 Bacteria 3416
143 Ga0207661_10407854 3300025944 Bacteria 1233
144 Ga0207679_10235233 3300025945 Bacteria 1549
145 Ga0207679_10284863 3300025945 Bacteria 1418
146 Ga0207667_10011763 3300025949 Bacteria 10146
147 Ga0207651_10018208 3300025960 Bacteria 4173
148 Ga0207668_10010040 3300025972 Bacteria 5701
149 Ga0207668_10394490 3300025972 Bacteria 1168
150 Ga0207640_10006808 3300025981 Bacteria 6286
151 Ga0207640_10072907 3300025981 Bacteria 2318
152 Ga0207640_10416154 3300025981 Bacteria 1099
153 Ga0207639_10013261 3300026041 Bacteria 5763
154 Ga0207639_10091721 3300026041 Bacteria 2433
155 Ga0207678_10000084 3300026067 Bacteria 76874
156 Ga0207678_10014541 3300026067 Bacteria 6923
157 Ga0207702_10003656 3300026078 Bacteria 13929
158 Ga0207702_10011897 3300026078 Bacteria 7243
159 Ga0207702_10069389 3300026078 Bacteria 3030
160 Ga0207702_10122053 3300026078 Bacteria 2333
161 Ga0207674_10016841 3300026116 Bacteria 7988
162 Ga0207674_10233693 3300026116 Bacteria 1786
163 Ga0207675_100006464 3300026118 Bacteria 11097
164 Ga0207698_10001653 3300026142 Bacteria 13007
165 Ga0207698_10008368 3300026142 Bacteria 6539
166 Ga0207698_10025524 3300026142 Bacteria 4165
167 Ga0207698_10034492 3300026142 Bacteria 3689
168 Ga0209281_1005626 3300027111 Bacteria 3436
169 Ga0268266_10021864 3300028379 Bacteria 5450
170 Ga0307405_10066420 3300031731 Bacteria 2299
171 Ga0307405_10069373 3300031731 Bacteria 2259
172 Ga0307410_10002245 3300031852 Bacteria 9229
173 Ga0307410_10038892 3300031852 Bacteria 3119
174 Ga0307407_10044364 3300031903 Bacteria 2505
175 Ga0307412_10046715 3300031911 Bacteria 2839
176 Ga0307412_10278765 3300031911 Bacteria 1311
177 Ga0307409_100077810 3300031995 Bacteria 2666
178 Ga0307416_100008803 3300032002 Bacteria 6546
179 Ga0307416_100110027 3300032002 Bacteria 2425
180 Ga0307414_10051900 3300032004 Bacteria 2850
181 Ga0307414_10123197 3300032004 Bacteria 1997
182 Ga0307411_10010511 3300032005 Bacteria 4938
183 Ga0307411_10306807 3300032005 Bacteria 1275
184 Ga0307415_100131959 3300032126 Bacteria 1893
185 Ga0307415_100296032 3300032126 Bacteria 1338
186 Ga0395899_0000825 3300037312 Bacteria 30147
187 Ga0395899_0012651 3300037312 Bacteria 6468
188 Ga0395900_0000031 3300037418 Bacteria 262393
189 Ga0395900_0049098 3300037418 Bacteria 4347
190 Ga0395900_0055371 3300037418 Bacteria 4084
191 Ga0395900_0195009 3300037418 Bacteria 2052
192 Ga0395900_0232446 3300037418 Bacteria 1853
193 Ga0395900_0268092 3300037418 Bacteria 1703
194 Ga0395900_0333378 3300037418 Bacteria 1494
195 Ga0395900_0342082 3300037418 Bacteria 1471
196 Ga0395900_0484075 3300037418 Bacteria 1189
197 Ga0395898_0004862 3300037466 Bacteria 14588
198 Ga0395898_0022516 3300037466 Bacteria 6381
199 Ga0395898_0038832 3300037466 Bacteria 4715
200 Ga0395898_0120076 3300037466 Bacteria 2518
201 Ga0395898_0228050 3300037466 Bacteria 1776
202 Ga0395898_0467473 3300037466 Bacteria 1200
203 Ga0395905_0047664 3300037471 Bacteria 4015
204 Ga0395905_0108076 3300037471 Bacteria 2611
205 Ga0395905_0220075 3300037471 Bacteria 1777
206 Ga0436364_1120654 3300037853 Bacteria 86811
207 Ga0395901_0000260 3300038443 Bacteria 66084
208 Ga0395901_0046372 3300038443 Bacteria 4514
209 Ga0395901_0062897 3300038443 Bacteria 3862
210 Ga0395901_0105084 3300038443 Bacteria 2964
211 Ga0439461_0000634 3300041410 Bacteria 5067
212 Ga0439461_0000778 3300041410 Bacteria 4674
213 Ga0439465_0000274 3300041413 Bacteria 14388
214 Ga0439431_0000103 3300041997 Bacteria 14374
215 Ga0439442_003667 3300042002 Bacteria 3042
216 Ga0439445_0000055 3300042004 Bacteria 16763
217 Ga0439432_000219 3300042006 Bacteria 20597
218 Ga0439432_016344 3300042006 Bacteria 2499
219 Ga0439457_003225 3300042014 Bacteria 4482
220 Ga0439462_0002177 3300042015 Bacteria 4517
221 Ga0439462_0003426 3300042015 Bacteria 3807
222 Ga0439434_0008358 3300042435 Bacteria 3034
223 Ga0466969_0013373 3300044656 Bacteria 4321
224 Ga0466972_0017055 3300044658 Bacteria 3633
225 Ga0466966_0000010 3300044684 Bacteria 150868
226 Ga0466966_0011880 3300044684 Bacteria 5768
227 Ga0466966_0065786 3300044684 Bacteria 2279
228 Ga0466961_0013583 3300044693 Bacteria 5214
229 Ga0466961_0015301 3300044693 Bacteria 4927
230 Ga0466963_0005683 3300044694 Bacteria 7326
231 Ga0466971_0001547 3300044719 Bacteria 9696
232 Ga0466971_0117367 3300044719 Bacteria 1230
233 Ga0466968_0028188 3300044735 Bacteria 2315
234 Ga0466957_0005415 3300044842 Bacteria 7165
235 Ga0466959_0003693 3300045049 Bacteria 10097
236 Ga0466959_0017441 3300045049 Bacteria 5263
237 Ga0466958_0006384 3300045836 Bacteria 6412
238 Ga0466958_0029737 3300045836 Bacteria 3242
239 Ga0466967_0039447 3300045976 Bacteria 4060
240 Ga0466967_0594529 3300045976 Bacteria 1092
241 Ga0495638_0003984 3300046460 Bacteria 11359
242 Ga0495625_0001071 3300046660 Bacteria 35534
243 Ga0495670_0000028 3300046691 Bacteria 90085
244 Ga0495686_0014672 3300047472 Bacteria 5387
245 Ga0495615_0000230 3300048090 Bacteria 11820
246 Ga0496102_0447401 3300048905 Bacteria 1212
247 Ga0496104_0503705 3300048907 Bacteria 1122
248 Ga0496108_0040070 3300048911 Bacteria 3904
249 Ga0496108_0221914 3300048911 Bacteria 1642
250 Ga0496111_0302230 3300048914 Bacteria 1186
251 Ga0496121_0002011 3300048924 Bacteria 32308
252 Ga0496121_0003564 3300048924 Bacteria 22015
253 Ga0496122_0021820 3300048925 Bacteria 5715
254 Ga0496122_0028808 3300048925 Bacteria 4700
255 Ga0496122_0051412 3300048925 Bacteria 3131
256 Ga0496123_0031243 3300048926 Bacteria 3878
257 Ga0496123_0039052 3300048926 Bacteria 3325
258 Ga0496123_0053700 3300048926 Bacteria 2660
259 Ga0496123_0061356 3300048926 Bacteria 2416
260 Ga0496124_0035559 3300048927 Bacteria 4356
261 Ga0496124_0080806 3300048927 Bacteria 2674
262 Ga0496124_0254756 3300048927 Bacteria 1295
263 Ga0496124_0311248 3300048927 Bacteria 1132
264 Ga0496125_0031167 3300048928 Bacteria 4756
265 Ga0501069_0012332 3300049585 Bacteria 4541
266 Ga0501223_000015 3300049663 Bacteria 68826
267 Ga0501225_0000832 3300049705 Bacteria 9604
268 Ga0501225_0003443 3300049705 Bacteria 4794
269 Ga0500635_0000192 3300053080 Bacteria 31343
270 Ga0500566_0057276 3300053094 Bacteria 2213
271 Ga0500562_001810 3300053108 Bacteria 5357
272 Ga0500618_000214 3300053125 Bacteria 45376
273 Ga0500658_0006179 3300053134 Bacteria 4454
274 Ga0500658_0016069 3300053134 Bacteria 2786
275 Ga0500658_0020457 3300053134 Bacteria 2499
276 Ga0500645_001144 3300053730 Bacteria 14373
277 Ga0466962_0000549 3300061719 Bacteria 16555
278 Ga0466962_0011648 3300061719 Bacteria 4235
279 2510307569 2510065057 Bacteria 6649661
280 2511499510 2511231052 Bacteria 6974333
281 2513586214 2513237086 Bacteria 7265287
282 2513619901 2513237091 Bacteria 6900273
283 2516897777 2516653046 Bacteria 6989037
284 2551676095 2551306084 Bacteria 8942552
285 2551683904 2551306085 Bacteria 7347181
286 2551693279 2551306086 Bacteria 6843938
287 2551700814 2551306087 Bacteria 7351905
288 2551721468 2551306090 Bacteria 7953713
289 2551739659 2551306093 Bacteria 7064773
290 2600202810 2599185354 Bacteria 4398675
291 2600228184 2599185359 Bacteria 4772316
292 2778123601 2775507255 Bacteria 3945731
293 2819716229 2818991466 Bacteria 4748179
294 2855830301 2855825444 Bacteria 6785811
295 2855845918 2855839649 Bacteria 7135830
296 2858805291 2858800743 Bacteria 6603254
297 2879163807 2879163058 Bacteria 4223965
298 2915988732 2915986958 Bacteria 6739310
299 2915995882 2915993759 Bacteria 7016183
300 2916012845 2916007675 Bacteria 6898660
301 2916017668 2916014648 Bacteria 6946486
302 2916027124 2916021584 Bacteria 6854472
303 2916028653 2916028427 Bacteria 6748433
304 2916038746 2916035215 Bacteria 6755766
305 2916048305 2916041962 Bacteria 6820487
306 2916052774 2916048683 Bacteria 6543552
307 2916056043 2916055098 Bacteria 6758838
308 2916070199 2916068649 Bacteria 6943657
309 2916080970 2916076590 Bacteria 6596108
310 2921206810 2921201388 Bacteria 6926299
311 2921214697 2921208531 Bacteria 6745326
312 2921243320 2921237296 Bacteria 6876710
313 2921264277 2921263974 Bacteria 6864552
314 2921293889 2921289301 Bacteria 7316391
315 2921302334 2921296804 Bacteria 7176999
316 2924155623 2924150972 Bacteria 7169444
317 2924162915 2924158325 Bacteria 7188855
318 2924169629 2924165586 Bacteria 7260590
319 2924179482 2924172951 Bacteria 6749356
320 2924190070 2924186466 Bacteria 6876637
321 2924213248 2924207177 Bacteria 6917007
322 2924220370 2924214083 Bacteria 7080103
323 2924224579 2924221636 Bacteria 7113495
324 2924233325 2924228884 Bacteria 6633132
325 2928528969 2928526807 Bacteria 4760224
326 2928971203 2928968154 Bacteria 4633371
327 2937006572 2937002841 Bacteria 6934057
328 2937013186 2937009748 Bacteria 6746052
329 2937047639 2937042894 Bacteria 6741576
330 2937055841 2937049772 Bacteria 6757901
331 2937061231 2937056579 Bacteria 7107896
332 2937075844 2937071275 Bacteria 6984483
333 2937096273 2937091812 Bacteria 6979387
334 2937103891 2937098957 Bacteria 7249374
335 2937110438 2937106411 Bacteria 6947143
336 2937122280 2937119839 Bacteria 6597547
337 2937126593 2937126314 Bacteria 6771275
338 2946787635 2946787523 Bacteria 4366789
339 2957385420 2957382221 Bacteria 6737050
340 2957391231 2957388812 Bacteria 6778072
341 2957406012 2957402308 Bacteria 6741770
342 2957428772 2957422303 Bacteria 7172205
343 2957436664 2957430029 Bacteria 7022557
344 2957453657 2957450854 Bacteria 6765715
345 2957458277 2957457609 Bacteria 6967680
346 2957474991 2957471148 Bacteria 6797643
347 2957478268 2957478035 Bacteria 6756658
348 2957485363 2957484790 Bacteria 6703082
349 2957503172 2957498199 Bacteria 7126688
350 2957509549 2957505466 Bacteria 7253085
351 2960608219 2960603979 Bacteria 6898737
352 2960616051 2960610863 Bacteria 6691244
353 2960630743 2960624210 Bacteria 6875384
354 2960649304 2960645483 Bacteria 7211087
355 2960655792 2960652885 Bacteria 7083688
356 2960691338 2960687367 Bacteria 6535474
357 2964612628 2964607997 Bacteria 7101408
358 2964633463 2964628898 Bacteria 7083044
359 2964640563 2964636051 Bacteria 7091832
360 2964644933 2964643177 Bacteria 6820887
361 2964654206 2964649959 Bacteria 6675118
362 2964661340 2964656573 Bacteria 7100150
363 2964670070 2964663802 Bacteria 7019362
364 2964678400 2964678106 Bacteria 6792020
365 2964701257 2964698721 Bacteria 6765331
366 2964714585 2964712639 Bacteria 6695970
367 2967670888 2967664464 Bacteria 6948836
368 2967683596 2967678726 Bacteria 7264382
369 2967695870 2967693043 Bacteria 6804451
370 2967713620 2967706974 Bacteria 7186053
371 2967719156 2967714385 Bacteria 7000047
372 2967725634 2967721400 Bacteria 7073753
373 2967739111 2967735183 Bacteria 6827012
374 2967768863 2967762386 Bacteria 6923502
375 2967780348 2967775926 Bacteria 6738189
376 2970043119 2970040964 Bacteria 6731123
377 2970047735 2970047711 Bacteria 7088379
378 2970058108 2970054988 Bacteria 6611507
379 2970066076 2970061556 Bacteria 7099761
380 2970077663 2970076120 Bacteria 6697332
381 2970092984 2970088815 Bacteria 6933825
382 2970114846 2970109326 Bacteria 6863976
383 2970117503 2970116247 Bacteria 6501857
384 2970132364 2970129317 Bacteria 6806560
385 2970139491 2970136068 Bacteria 7207982
386 2970150956 2970149975 Bacteria 6779706
387 2970168014 2970164137 Bacteria 6861252
388 2970176682 2970170962 Bacteria 6876229
389 2970189084 2970184632 Bacteria 7054431
390 2970195525 2970191845 Bacteria 7032787
391 2977528250 2977523885 Bacteria 6960446
392 2977542144 2977537788 Bacteria 6929320
393 2977556588 2977551784 Bacteria 7125765
394 2977571416 2977565890 Bacteria 6901543
395 2977575815 2977572785 Bacteria 6763888
396 2977581928 2977579622 Bacteria 6772100
397 8003997614 8003992118 Bacteria 7266902
398 8057101639 8057101203 Bacteria 5034064
399 Ga0157371_10018604
400 JGI24736J21556_1000519
401 JGI24736J21556_1002154
402 JGI24741J21665_1000583
403 JGI24740J21852_10005710
404 JGI24739J22299_10003840
405 JGI24735J21928_10000683
406 JGI25150J39212_1000886
407 JGI25151J46595_10026616
408 JGI25165J46597_1000024
409 JGI25153J46596_10000091
410 JGI25153J46596_10000186
411 rootH1_10006736
412 Ga0055526_1009414
413 Ga0055537_1001804
414 Ga0065165_1003640
415 Ga0065704_10001898
416 Ga0070658_10007316
417 Ga0070658_10019618
418 Ga0070683_100450155
419 Ga0070660_100001066
420 Ga0070660_100017115
421 Ga0070660_100073630
422 Ga0070661_100138020
423 Ga0070692_10034107
424 Ga0070668_100017467
425 Ga0070668_100039885
426 Ga0070675_100023581
427 Ga0070675_100038793
428 Ga0070673_100017391
429 Ga0070688_100014671
430 Ga0070659_100011540
431 Ga0070659_100017777
432 Ga0070659_100020518
433 Ga0070659_100132963
434 Ga0070659_100266432
435 Ga0070663_100012087
436 Ga0070678_100016484
437 Ga0070684_100105217
438 Ga0068853_100119786
439 Ga0068853_100174762
440 Ga0070672_100070368
441 Ga0070665_100006682
442 Ga0068855_100001731
443 Ga0068855_100116519
444 Ga0070664_100042633
445 Ga0070664_100072362
446 Ga0068857_100057636
447 Ga0068857_100093600
448 Ga0068854_100001958
449 Ga0068854_100066261
450 Ga0068856_100008682
451 Ga0068856_100169423
452 Ga0068852_100001847
453 Ga0068852_100007109
454 Ga0068852_100156132
455 Ga0068859_100021809
456 Ga0068861_100000349
457 Ga0068860_100080306
458 Ga0097620_100021809
459 Ga0097620_100155645
460 Ga0079104_1005018
461 Ga0105251_10054843
462 Ga0105240_10030389
463 Ga0105240_10086138
464 Ga0105240_10104563
465 Ga0105240_10236329
466 Ga0105245_10000853
467 Ga0105243_10060489
468 Ga0105243_10288583
469 Ga0105241_10024108
470 Ga0105248_10105518
471 Ga0105237_10090852
472 Ga0105238_10113404
473 Ga0105238_10346553
474 Ga0105238_10402577
475 Ga0105148_100223
476 Ga0105239_10086153
477 Ga0105239_10378907
478 Ga0105239_10492285
479 Ga0157373_10071651
480 Ga0157371_10009668
481 Ga0157371_10024152
482 Ga0157371_10071085
483 Ga0157371_10155777
484 Ga0157370_10037708
485 Ga0157370_10197891
486 Ga0157369_10001843
487 Ga0157369_10004559
488 Ga0157369_10068681
489 Ga0157369_10108914
490 Ga0157374_10010254
491 Ga0163162_10068828
492 Ga0157372_10042339
493 Ga0157372_10087458
494 Ga0163163_10113021
495 Ga0163161_10083831
496 Ga0163161_10097758
497 Ga0213875_10000230
498 Ga0209437_104090
499 Ga0207425_1000049
500 Ga0209129_1001567
501 Ga0209233_1000084
502 Ga0209565_1000170
503 Ga0209673_1011318
504 Ga0209025_1000068
505 Ga0209564_1000335
506 Ga0209758_1000019
507 Ga0209050_1000001
508 Ga0209050_1000108
509 Ga0207426_1014823
510 Ga0209051_1000239
511 Ga0207647_10009334
512 Ga0207647_10016410
513 Ga0207647_10039536
514 Ga0207705_10000003
515 Ga0207705_10000046
516 Ga0207705_10000215
517 Ga0207705_10000849
518 Ga0207705_10003040
519 Ga0207705_10039675
520 Ga0207705_10087451
521 Ga0207654_10008029
522 Ga0207695_10003916
523 Ga0207695_10040354
524 Ga0207671_10013100
525 Ga0207671_10364792
526 Ga0207657_10001406
527 Ga0207657_10008313
528 Ga0207657_10008667
529 Ga0207657_10009957
530 Ga0207649_10053969
531 Ga0207652_10111263
532 Ga0207694_10351768
533 Ga0207659_10005781
534 Ga0207690_10012871
535 Ga0207690_10038294
536 Ga0207690_10096183
537 Ga0207706_10013110
538 Ga0207709_10073199
539 Ga0207704_10242743
540 Ga0207711_10055027
541 Ga0207661_10407854
542 Ga0207679_10235233
543 Ga0207679_10284863
544 Ga0207667_10011763
545 Ga0207651_10018208
546 Ga0207668_10010040
547 Ga0207668_10394490
548 Ga0207640_10006808
549 Ga0207640_10072907
550 Ga0207640_10416154
551 Ga0207639_10013261
552 Ga0207639_10091721
553 Ga0207678_10000084
554 Ga0207678_10014541
555 Ga0207702_10003656
556 Ga0207702_10011897
557 Ga0207702_10069389
558 Ga0207702_10122053
559 Ga0207674_10016841
560 Ga0207674_10233693
561 Ga0207675_100006464
562 Ga0207698_10001653
563 Ga0207698_10008368
564 Ga0207698_10025524
565 Ga0207698_10034492
566 Ga0209281_1005626
567 Ga0268266_10021864
568 Ga0307405_10066420
569 Ga0307405_10069373
570 Ga0307410_10002245
571 Ga0307410_10038892
572 Ga0307407_10044364
573 Ga0307412_10046715
574 Ga0307412_10278765
575 Ga0307409_100077810
576 Ga0307416_100008803
577 Ga0307416_100110027
578 Ga0307414_10051900
579 Ga0307414_10123197
580 Ga0307411_10010511
581 Ga0307411_10306807
582 Ga0307415_100131959
583 Ga0307415_100296032
584 Ga0395899_0000825
585 Ga0395899_0012651
586 Ga0395900_0000031
587 Ga0395900_0049098
588 Ga0395900_0055371
589 Ga0395900_0195009
590 Ga0395900_0232446
591 Ga0395900_0268092
592 Ga0395900_0333378
593 Ga0395900_0342082
594 Ga0395900_0484075
595 Ga0395898_0004862
596 Ga0395898_0022516
597 Ga0395898_0038832
598 Ga0395898_0120076
599 Ga0395898_0228050
600 Ga0395898_0467473
601 Ga0395905_0047664
602 Ga0395905_0108076
603 Ga0395905_0220075
604 Ga0436364_1120654
605 Ga0395901_0000260
606 Ga0395901_0046372
607 Ga0395901_0062897
608 Ga0395901_0105084
609 Ga0439461_0000634
610 Ga0439461_0000778
611 Ga0439465_0000274
612 Ga0439431_0000103
613 Ga0439442_003667
614 Ga0439445_0000055
615 Ga0439432_000219
616 Ga0439432_016344
617 Ga0439457_003225
618 Ga0439462_0002177
619 Ga0439462_0003426
620 Ga0439434_0008358
621 Ga0466969_0013373
622 Ga0466972_0017055
623 Ga0466966_0000010
624 Ga0466966_0011880
625 Ga0466966_0065786
626 Ga0466961_0013583
627 Ga0466961_0015301
628 Ga0466963_0005683
629 Ga0466971_0001547
630 Ga0466971_0117367
631 Ga0466968_0028188
632 Ga0466957_0005415
633 Ga0466959_0003693
634 Ga0466959_0017441
635 Ga0466958_0006384
636 Ga0466958_0029737
637 Ga0466967_0039447
638 Ga0466967_0594529
639 Ga0495638_0003984
640 Ga0495625_0001071
641 Ga0495670_0000028
642 Ga0495686_0014672
643 Ga0495615_0000230
644 Ga0496102_0447401
645 Ga0496104_0503705
646 Ga0496108_0040070
647 Ga0496108_0221914
648 Ga0496111_0302230
649 Ga0496121_0002011
650 Ga0496121_0003564
651 Ga0496122_0021820
652 Ga0496122_0028808
653 Ga0496122_0051412
654 Ga0496123_0031243
655 Ga0496123_0039052
656 Ga0496123_0053700
657 Ga0496123_0061356
658 Ga0496124_0035559
659 Ga0496124_0080806
660 Ga0496124_0254756
661 Ga0496124_0311248
662 Ga0496125_0031167
663 Ga0501069_0012332
664 Ga0501223_000015
665 Ga0501225_0000832
666 Ga0501225_0003443
667 Ga0500635_0000192
668 Ga0500566_0057276
669 Ga0500562_001810
670 Ga0500618_000214
671 Ga0500658_0006179
672 Ga0500658_0016069
673 Ga0500658_0020457
674 Ga0500645_001144
675 Ga0466962_0000549
676 Ga0466962_0011648
677 2510307569
678 2511499510
679 2513586214
680 2513619901
681 2516897777
682 2551676095
683 2551683904
684 2551693279
685 2551700814
686 2551721468
687 2551739659
688 2600202810
689 2600228184
690 2778123601
691 2819716229
692 2855830301
693 2855845918
694 2858805291
695 2879163807
696 2915988732
697 2915995882
698 2916012845
699 2916017668
700 2916027124
701 2916028653
702 2916038746
703 2916048305
704 2916052774
705 2916056043
706 2916070199
707 2916080970
708 2921206810
709 2921214697
710 2921243320
711 2921264277
712 2921293889
713 2921302334
714 2924155623
715 2924162915
716 2924169629
717 2924179482
718 2924190070
719 2924213248
720 2924220370
721 2924224579
722 2924233325
723 2928528969
724 2928971203
725 2937006572
726 2937013186
727 2937047639
728 2937055841
729 2937061231
730 2937075844
731 2937096273
732 2937103891
733 2937110438
734 2937122280
735 2937126593
736 2946787635
737 2957385420
738 2957391231
739 2957406012
740 2957428772
741 2957436664
742 2957453657
743 2957458277
744 2957474991
745 2957478268
746 2957485363
747 2957503172
748 2957509549
749 2960608219
750 2960616051
751 2960630743
752 2960649304
753 2960655792
754 2960691338
755 2964612628
756 2964633463
757 2964640563
758 2964644933
759 2964654206
760 2964661340
761 2964670070
762 2964678400
763 2964701257
764 2964714585
765 2967670888
766 2967683596
767 2967695870
768 2967713620
769 2967719156
770 2967725634
771 2967739111
772 2967768863
773 2967780348
774 2970043119
775 2970047735
776 2970058108
777 2970066076
778 2970077663
779 2970092984
780 2970114846
781 2970117503
782 2970132364
783 2970139491
784 2970150956
785 2970168014
786 2970176682
787 2970189084
788 2970195525
789 2977528250
790 2977542144
791 2977556588
792 2977571416
793 2977575815
794 2977581928
795 8003997614
796 8057101639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

172

302

0.92

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

204

344

0.9

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

47

131

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9756 14 335
2oby-assembly2.cif.gz_C crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9656 14 335
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9649 11 336
4dup-assembly1.cif.gz_B crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9571 11 336
4dup-assembly1.cif.gz_B crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9541 11 336
ID Description Score Start End Superfamily
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9848 138 273 3.40.50.720
af_A0A1D6HNQ2_126_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9807 134 291 3.40.50.720
af_Q75JT6_1_334_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9768 14 335 3.90.180.10
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9707 138 273 3.40.50.720
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9702 131 273 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2E6BLH0-F1-model_v4 NAD(P)H-quinone oxidoreductase 0.9811 11 335 GO:0016651
GO:0070402
AF-B9JTA9-F1-model_v4 Quinone oxidoreductase 0.9791 7 336 GO:0016651
GO:0070402
AF-A0A251X6J7-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9777 14 335 GO:0016651
GO:0070402
AF-A0A7Y5K1F7-F1-model_v4 NAD(P)H-quinone oxidoreductase 0.9763 14 335 GO:0016020
GO:0016651
GO:0070402
AF-S9V5M4-F1-model_v4 NADPH2:quinone reductase 0.9763 167 336 GO:0016651
GO:0070402

Map