F434040
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 398 | 167 | 398 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10551087|Ga0157372_105510872 |
| Length | 163 |
| Sequence | LQKIHFPGGTAVRRKTLLYVLLISLACFARAQSPSGDEAQIRAAMAAQTAAWNHGDIPGFMQSYEDSPDTTFIGATLRKGFQPILKRYQQAYSNSAQMGTLTFSDLDVRVLPGACGKAEIALVTGKFHLERSEKGEAKKDDGIFSLVWRKGPQGWKIVLDHTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 120 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 121 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 122 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 129 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 134 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 135 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 137 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 141 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 142 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 164 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 165 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 166 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.75 |
| Metatranscriptomes | 0.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.27 |
| Rhizosphere | 95.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10039416 | 3300001991 | Unclassified | 946 |
| 2 | rootH2_10219196 | 3300003320 | Bacteria | 1257 |
| 3 | rootH2_10257385 | 3300003320 | Unclassified | 3093 |
| 4 | rootH2_10266853 | 3300003320 | Bacteria | 1099 |
| 5 | rootH1_10153212 | 3300003323 | Unclassified | 4329 |
| 6 | Ga0070658_10627441 | 3300005327 | Unclassified | 932 |
| 7 | Ga0070683_100000097 | 3300005329 | Bacteria | 57304 |
| 8 | Ga0070683_100141754 | 3300005329 | Bacteria | 2277 |
| 9 | Ga0070683_100325307 | 3300005329 | Unclassified | 1463 |
| 10 | Ga0070670_100071176 | 3300005331 | Bacteria | 2986 |
| 11 | Ga0068869_100000207 | 3300005334 | Bacteria | 30679 |
| 12 | Ga0070666_10010947 | 3300005335 | Bacteria | 5683 |
| 13 | Ga0070680_100328356 | 3300005336 | Unclassified | 1299 |
| 14 | Ga0070682_100655873 | 3300005337 | Unclassified | 836 |
| 15 | Ga0068868_100000210 | 3300005338 | Bacteria | 39514 |
| 16 | Ga0070660_100914736 | 3300005339 | Unclassified | 740 |
| 17 | Ga0070661_100013224 | 3300005344 | Bacteria | 5793 |
| 18 | Ga0070661_100022794 | 3300005344 | Unclassified | 4484 |
| 19 | Ga0070661_100897893 | 3300005344 | Unclassified | 731 |
| 20 | Ga0070661_101437920 | 3300005344 | Unclassified | 580 |
| 21 | Ga0070668_101071381 | 3300005347 | Unclassified | 727 |
| 22 | Ga0070671_100002109 | 3300005355 | Bacteria | 15334 |
| 23 | Ga0070671_100056214 | 3300005355 | Bacteria | 3274 |
| 24 | Ga0070671_100069786 | 3300005355 | Unclassified | 2931 |
| 25 | Ga0070674_100683323 | 3300005356 | Bacteria | 876 |
| 26 | Ga0070688_100880252 | 3300005365 | Unclassified | 705 |
| 27 | Ga0070659_100363466 | 3300005366 | Bacteria | 1216 |
| 28 | Ga0070667_100000592 | 3300005367 | Bacteria | 35570 |
| 29 | Ga0070667_100105275 | 3300005367 | Bacteria | 2441 |
| 30 | Ga0070713_100419319 | 3300005436 | Bacteria | 1253 |
| 31 | Ga0070713_100536036 | 3300005436 | Unclassified | 1107 |
| 32 | Ga0070711_101030933 | 3300005439 | Unclassified | 707 |
| 33 | Ga0070711_101437335 | 3300005439 | Unclassified | 601 |
| 34 | Ga0070663_100308521 | 3300005455 | Bacteria | 1269 |
| 35 | Ga0070678_100043179 | 3300005456 | Bacteria | 3209 |
| 36 | Ga0070662_100250304 | 3300005457 | Unclassified | 1424 |
| 37 | Ga0070662_100347475 | 3300005457 | Unclassified | 1214 |
| 38 | Ga0070681_11074260 | 3300005458 | Unclassified | 725 |
| 39 | Ga0070684_100000031 | 3300005535 | Bacteria | 106109 |
| 40 | Ga0070684_100003264 | 3300005535 | Bacteria | 12146 |
| 41 | Ga0070684_100139466 | 3300005535 | Unclassified | 2192 |
| 42 | Ga0070684_100792061 | 3300005535 | Unclassified | 886 |
| 43 | Ga0068853_100000052 | 3300005539 | Bacteria | 86096 |
| 44 | Ga0068853_100023546 | 3300005539 | Bacteria | 5157 |
| 45 | Ga0068853_100037487 | 3300005539 | Bacteria | 4125 |
| 46 | Ga0068853_100419038 | 3300005539 | Bacteria | 1255 |
| 47 | Ga0068853_100821791 | 3300005539 | Unclassified | 890 |
| 48 | Ga0070695_101539666 | 3300005545 | Unclassified | 554 |
| 49 | Ga0070665_100003053 | 3300005548 | Bacteria | 18030 |
| 50 | Ga0068855_100007110 | 3300005563 | Bacteria | 13577 |
| 51 | Ga0068855_100027394 | 3300005563 | Bacteria | 6817 |
| 52 | Ga0068855_100068712 | 3300005563 | Bacteria | 4124 |
| 53 | Ga0068855_101162694 | 3300005563 | Unclassified | 804 |
| 54 | Ga0068855_101532625 | 3300005563 | Bacteria | 684 |
| 55 | Ga0070664_100023289 | 3300005564 | Bacteria | 5114 |
| 56 | Ga0070664_100064917 | 3300005564 | Bacteria | 3114 |
| 57 | Ga0070664_100137916 | 3300005564 | Unclassified | 2146 |
| 58 | Ga0068857_100000042 | 3300005577 | Bacteria | 69986 |
| 59 | Ga0068857_100000269 | 3300005577 | Bacteria | 35388 |
| 60 | Ga0068857_100014308 | 3300005577 | Bacteria | 6915 |
| 61 | Ga0068857_100057690 | 3300005577 | Bacteria | 3446 |
| 62 | Ga0068857_100066068 | 3300005577 | Unclassified | 3218 |
| 63 | Ga0068857_100284845 | 3300005577 | Bacteria | 1520 |
| 64 | Ga0068854_100035207 | 3300005578 | Bacteria | 3503 |
| 65 | Ga0068854_100061223 | 3300005578 | Unclassified | 2726 |
| 66 | Ga0068854_100228394 | 3300005578 | Unclassified | 1476 |
| 67 | Ga0068856_100009638 | 3300005614 | Bacteria | 9376 |
| 68 | Ga0068856_100011532 | 3300005614 | Bacteria | 8574 |
| 69 | Ga0068856_100013280 | 3300005614 | Bacteria | 7977 |
| 70 | Ga0068856_100029327 | 3300005614 | Bacteria | 5375 |
| 71 | Ga0068856_100059902 | 3300005614 | Unclassified | 3761 |
| 72 | Ga0068856_100070490 | 3300005614 | Bacteria | 3458 |
| 73 | Ga0068856_101160662 | 3300005614 | Bacteria | 789 |
| 74 | Ga0068852_100000032 | 3300005616 | Bacteria | 102480 |
| 75 | Ga0068852_100000319 | 3300005616 | Bacteria | 32685 |
| 76 | Ga0068852_100009904 | 3300005616 | Bacteria | 7095 |
| 77 | Ga0068852_100066156 | 3300005616 | Unclassified | 3156 |
| 78 | Ga0068852_100078121 | 3300005616 | Bacteria | 2928 |
| 79 | Ga0068852_100479980 | 3300005616 | Unclassified | 1235 |
| 80 | Ga0068852_100484753 | 3300005616 | Bacteria | 1229 |
| 81 | Ga0068852_100605779 | 3300005616 | Unclassified | 1100 |
| 82 | Ga0068852_100656015 | 3300005616 | Unclassified | 1057 |
| 83 | Ga0068859_100004094 | 3300005617 | Bacteria | 14872 |
| 84 | Ga0068859_100564340 | 3300005617 | Bacteria | 1232 |
| 85 | Ga0068864_100001547 | 3300005618 | Bacteria | 18969 |
| 86 | Ga0068851_10004917 | 3300005834 | Bacteria | 6058 |
| 87 | Ga0068851_10085075 | 3300005834 | Bacteria | 1657 |
| 88 | Ga0068851_10113383 | 3300005834 | Unclassified | 1450 |
| 89 | Ga0068851_10122165 | 3300005834 | Bacteria | 1400 |
| 90 | Ga0068851_10150188 | 3300005834 | Unclassified | 1273 |
| 91 | Ga0068851_10454785 | 3300005834 | Unclassified | 761 |
| 92 | Ga0068863_100000273 | 3300005841 | Bacteria | 53827 |
| 93 | Ga0068863_100614520 | 3300005841 | Bacteria | 1076 |
| 94 | Ga0068858_100296753 | 3300005842 | Bacteria | 1541 |
| 95 | Ga0068860_100000031 | 3300005843 | Bacteria | 255068 |
| 96 | Ga0068860_100067831 | 3300005843 | Bacteria | 3389 |
| 97 | Ga0068862_100113633 | 3300005844 | Bacteria | 2379 |
| 98 | Ga0070717_10213379 | 3300006028 | Bacteria | 1695 |
| 99 | Ga0070717_10954948 | 3300006028 | Bacteria | 781 |
| 100 | Ga0070716_100623085 | 3300006173 | Unclassified | 814 |
| 101 | Ga0097621_100000523 | 3300006237 | Bacteria | 26929 |
| 102 | Ga0068871_100000584 | 3300006358 | Bacteria | 25049 |
| 103 | Ga0068871_100024204 | 3300006358 | Bacteria | 4705 |
| 104 | Ga0068871_100060830 | 3300006358 | Bacteria | 3082 |
| 105 | Ga0097620_100004094 | 3300006931 | Bacteria | 14872 |
| 106 | Ga0097620_100564343 | 3300006931 | Bacteria | 1232 |
| 107 | Ga0105240_10000135 | 3300009093 | Bacteria | 151432 |
| 108 | Ga0105240_10000451 | 3300009093 | Bacteria | 75544 |
| 109 | Ga0105240_10001555 | 3300009093 | Bacteria | 38963 |
| 110 | Ga0105240_10003376 | 3300009093 | Bacteria | 24823 |
| 111 | Ga0105240_10003845 | 3300009093 | Bacteria | 23185 |
| 112 | Ga0105240_10005717 | 3300009093 | Bacteria | 18451 |
| 113 | Ga0105240_10007831 | 3300009093 | Bacteria | 15423 |
| 114 | Ga0105240_10148445 | 3300009093 | Bacteria | 2795 |
| 115 | Ga0105245_10001460 | 3300009098 | Bacteria | 21374 |
| 116 | Ga0105245_10117681 | 3300009098 | Bacteria | 2479 |
| 117 | Ga0105245_10571107 | 3300009098 | Bacteria | 1155 |
| 118 | Ga0105247_10004824 | 3300009101 | Bacteria | 8583 |
| 119 | Ga0105247_10041700 | 3300009101 | Bacteria | 2809 |
| 120 | Ga0105247_10168798 | 3300009101 | Bacteria | 1453 |
| 121 | Ga0105247_10189784 | 3300009101 | Unclassified | 1375 |
| 122 | Ga0105241_10000041 | 3300009174 | Bacteria | 107393 |
| 123 | Ga0105241_10000174 | 3300009174 | Bacteria | 47325 |
| 124 | Ga0105241_10000987 | 3300009174 | Bacteria | 21542 |
| 125 | Ga0105241_10030172 | 3300009174 | Bacteria | 4050 |
| 126 | Ga0105241_10104042 | 3300009174 | Bacteria | 2262 |
| 127 | Ga0105241_10701537 | 3300009174 | Bacteria | 924 |
| 128 | Ga0105241_10949016 | 3300009174 | Unclassified | 802 |
| 129 | Ga0105241_11004764 | 3300009174 | Bacteria | 780 |
| 130 | Ga0105242_10036455 | 3300009176 | Bacteria | 3945 |
| 131 | Ga0105248_10000904 | 3300009177 | Bacteria | 33191 |
| 132 | Ga0105248_10035674 | 3300009177 | Bacteria | 5563 |
| 133 | Ga0105248_11986463 | 3300009177 | Unclassified | 661 |
| 134 | Ga0105237_10002009 | 3300009545 | Bacteria | 25902 |
| 135 | Ga0105237_10004127 | 3300009545 | Bacteria | 16931 |
| 136 | Ga0105237_10049097 | 3300009545 | Bacteria | 4243 |
| 137 | Ga0105237_11052476 | 3300009545 | Bacteria | 820 |
| 138 | Ga0105237_11337185 | 3300009545 | Unclassified | 723 |
| 139 | Ga0105238_10000334 | 3300009551 | Bacteria | 51408 |
| 140 | Ga0105238_10000386 | 3300009551 | Bacteria | 47230 |
| 141 | Ga0105238_10002740 | 3300009551 | Bacteria | 17556 |
| 142 | Ga0105238_10024562 | 3300009551 | Bacteria | 6142 |
| 143 | Ga0105238_10063555 | 3300009551 | Unclassified | 3692 |
| 144 | Ga0105238_10114512 | 3300009551 | Bacteria | 2676 |
| 145 | Ga0105238_10155777 | 3300009551 | Bacteria | 2260 |
| 146 | Ga0105238_10913252 | 3300009551 | Unclassified | 897 |
| 147 | Ga0105249_10116360 | 3300009553 | Bacteria | 2534 |
| 148 | Ga0105239_10000673 | 3300010375 | Bacteria | 48672 |
| 149 | Ga0105239_10000909 | 3300010375 | Bacteria | 42107 |
| 150 | Ga0105239_10001496 | 3300010375 | Bacteria | 31060 |
| 151 | Ga0105239_10059851 | 3300010375 | Unclassified | 4180 |
| 152 | Ga0105239_10203618 | 3300010375 | Bacteria | 2217 |
| 153 | Ga0105239_10281101 | 3300010375 | Unclassified | 1874 |
| 154 | Ga0105239_10437623 | 3300010375 | Bacteria | 1482 |
| 155 | Ga0105239_10565183 | 3300010375 | Unclassified | 1296 |
| 156 | Ga0105239_12544599 | 3300010375 | Bacteria | 597 |
| 157 | Ga0105246_10000497 | 3300011119 | Bacteria | 21376 |
| 158 | Ga0105246_10223828 | 3300011119 | Bacteria | 1476 |
| 159 | Ga0157373_10017483 | 3300013100 | Bacteria | 5223 |
| 160 | Ga0157373_10029977 | 3300013100 | Unclassified | 3916 |
| 161 | Ga0157373_10082054 | 3300013100 | Bacteria | 2272 |
| 162 | Ga0157373_10083003 | 3300013100 | Unclassified | 2258 |
| 163 | Ga0157371_10773954 | 3300013102 | Unclassified | 722 |
| 164 | Ga0157370_10000023 | 3300013104 | Bacteria | 161359 |
| 165 | Ga0157370_10076421 | 3300013104 | Unclassified | 3154 |
| 166 | Ga0157370_10275163 | 3300013104 | Unclassified | 1555 |
| 167 | Ga0157370_10769108 | 3300013104 | Unclassified | 877 |
| 168 | Ga0157369_10000010 | 3300013105 | Bacteria | 273443 |
| 169 | Ga0157369_10001424 | 3300013105 | Bacteria | 29355 |
| 170 | Ga0157369_10018222 | 3300013105 | Bacteria | 7874 |
| 171 | Ga0157369_10033865 | 3300013105 | Bacteria | 5610 |
| 172 | Ga0157369_10037210 | 3300013105 | Bacteria | 5328 |
| 173 | Ga0157369_10062471 | 3300013105 | Bacteria | 4014 |
| 174 | Ga0157369_10084121 | 3300013105 | Bacteria | 3401 |
| 175 | Ga0157369_10091881 | 3300013105 | Bacteria | 3239 |
| 176 | Ga0157369_10183794 | 3300013105 | Unclassified | 2199 |
| 177 | Ga0157369_10236959 | 3300013105 | Unclassified | 1906 |
| 178 | Ga0157369_10975054 | 3300013105 | Unclassified | 868 |
| 179 | Ga0157374_10008343 | 3300013296 | Bacteria | 8844 |
| 180 | Ga0157374_10020079 | 3300013296 | Bacteria | 5924 |
| 181 | Ga0157374_10043969 | 3300013296 | Bacteria | 4127 |
| 182 | Ga0157374_10365742 | 3300013296 | Bacteria | 1435 |
| 183 | Ga0157374_11072377 | 3300013296 | Bacteria | 826 |
| 184 | Ga0157378_10004570 | 3300013297 | Bacteria | 12141 |
| 185 | Ga0157378_10005341 | 3300013297 | Bacteria | 11272 |
| 186 | Ga0157378_10030016 | 3300013297 | Bacteria | 4802 |
| 187 | Ga0157378_10428753 | 3300013297 | Bacteria | 1308 |
| 188 | Ga0157378_11269427 | 3300013297 | Bacteria | 777 |
| 189 | Ga0163162_10043302 | 3300013306 | Bacteria | 4508 |
| 190 | Ga0163162_10055045 | 3300013306 | Bacteria | 4004 |
| 191 | Ga0163162_10409792 | 3300013306 | Unclassified | 1488 |
| 192 | Ga0157372_10000055 | 3300013307 | Bacteria | 126308 |
| 193 | Ga0157372_10001858 | 3300013307 | Bacteria | 22895 |
| 194 | Ga0157372_10017416 | 3300013307 | Bacteria | 7711 |
| 195 | Ga0157372_10035033 | 3300013307 | Bacteria | 5523 |
| 196 | Ga0157372_10060647 | 3300013307 | Unclassified | 4233 |
| 197 | Ga0157372_10343411 | 3300013307 | Unclassified | 1739 |
| 198 | Ga0157372_10505817 | 3300013307 | Bacteria | 1409 |
| 199 | Ga0157372_10551087 | 3300013307 | Bacteria | 1344 |
| 200 | Ga0157372_11141849 | 3300013307 | Unclassified | 901 |
| 201 | Ga0157372_11474194 | 3300013307 | Bacteria | 784 |
| 202 | Ga0157375_10002348 | 3300013308 | Bacteria | 16343 |
| 203 | Ga0157375_10174218 | 3300013308 | Bacteria | 2300 |
| 204 | Ga0157375_11013932 | 3300013308 | Bacteria | 969 |
| 205 | Ga0163163_10000427 | 3300014325 | Bacteria | 38751 |
| 206 | Ga0163163_10136906 | 3300014325 | Bacteria | 2490 |
| 207 | Ga0163163_12967084 | 3300014325 | Unclassified | 529 |
| 208 | Ga0157379_10000330 | 3300014968 | Bacteria | 37889 |
| 209 | Ga0157379_10034921 | 3300014968 | Bacteria | 4482 |
| 210 | Ga0157379_10542504 | 3300014968 | Unclassified | 1081 |
| 211 | Ga0157376_10002011 | 3300014969 | Bacteria | 13630 |
| 212 | Ga0157376_10144355 | 3300014969 | Unclassified | 2139 |
| 213 | Ga0163161_10220016 | 3300017792 | Bacteria | 1470 |
| 214 | Ga0207656_10013820 | 3300025321 | Bacteria | 3096 |
| 215 | Ga0207656_10071353 | 3300025321 | Bacteria | 1544 |
| 216 | Ga0207656_10279940 | 3300025321 | Unclassified | 822 |
| 217 | Ga0207710_10000798 | 3300025900 | Bacteria | 17109 |
| 218 | Ga0207688_10363921 | 3300025901 | Unclassified | 893 |
| 219 | Ga0207647_10076463 | 3300025904 | Bacteria | 2014 |
| 220 | Ga0207699_10944384 | 3300025906 | Unclassified | 637 |
| 221 | Ga0207643_10368128 | 3300025908 | Unclassified | 904 |
| 222 | Ga0207705_10480867 | 3300025909 | Unclassified | 964 |
| 223 | Ga0207654_10000094 | 3300025911 | Bacteria | 59572 |
| 224 | Ga0207654_10000100 | 3300025911 | Bacteria | 57508 |
| 225 | Ga0207654_10000608 | 3300025911 | Bacteria | 20210 |
| 226 | Ga0207654_10095402 | 3300025911 | Unclassified | 1822 |
| 227 | Ga0207654_10188667 | 3300025911 | Unclassified | 1350 |
| 228 | Ga0207695_10000050 | 3300025913 | Bacteria | 405727 |
| 229 | Ga0207695_10000075 | 3300025913 | Bacteria | 308496 |
| 230 | Ga0207695_10000293 | 3300025913 | Bacteria | 123676 |
| 231 | Ga0207695_10000930 | 3300025913 | Bacteria | 52294 |
| 232 | Ga0207695_10014333 | 3300025913 | Bacteria | 9400 |
| 233 | Ga0207695_10037358 | 3300025913 | Bacteria | 5240 |
| 234 | Ga0207695_10109201 | 3300025913 | Bacteria | 2749 |
| 235 | Ga0207695_10131301 | 3300025913 | Bacteria | 2462 |
| 236 | Ga0207671_10000562 | 3300025914 | Bacteria | 49896 |
| 237 | Ga0207671_10001031 | 3300025914 | Bacteria | 33913 |
| 238 | Ga0207671_10126615 | 3300025914 | Bacteria | 1958 |
| 239 | Ga0207663_11107817 | 3300025916 | Unclassified | 636 |
| 240 | Ga0207663_11222475 | 3300025916 | Unclassified | 605 |
| 241 | Ga0207660_10963265 | 3300025917 | Unclassified | 696 |
| 242 | Ga0207657_10717280 | 3300025919 | Unclassified | 776 |
| 243 | Ga0207649_10009397 | 3300025920 | Bacteria | 5350 |
| 244 | Ga0207649_10073452 | 3300025920 | Unclassified | 2191 |
| 245 | Ga0207652_10158551 | 3300025921 | Bacteria | 2028 |
| 246 | Ga0207694_10000024 | 3300025924 | Bacteria | 259443 |
| 247 | Ga0207694_10000243 | 3300025924 | Bacteria | 52313 |
| 248 | Ga0207694_10002571 | 3300025924 | Bacteria | 14733 |
| 249 | Ga0207694_10081246 | 3300025924 | Bacteria | 2545 |
| 250 | Ga0207694_10179497 | 3300025924 | Unclassified | 1716 |
| 251 | Ga0207694_10217263 | 3300025924 | Unclassified | 1558 |
| 252 | Ga0207694_10787650 | 3300025924 | Unclassified | 803 |
| 253 | Ga0207687_10001748 | 3300025927 | Bacteria | 14937 |
| 254 | Ga0207687_10339721 | 3300025927 | Bacteria | 1221 |
| 255 | Ga0207687_10880203 | 3300025927 | Unclassified | 766 |
| 256 | Ga0207700_10673708 | 3300025928 | Bacteria | 923 |
| 257 | Ga0207644_10006631 | 3300025931 | Bacteria | 7543 |
| 258 | Ga0207644_10052549 | 3300025931 | Unclassified | 2929 |
| 259 | Ga0207644_10095817 | 3300025931 | Bacteria | 2220 |
| 260 | Ga0207644_10585956 | 3300025931 | Unclassified | 925 |
| 261 | Ga0207644_10798663 | 3300025931 | Unclassified | 789 |
| 262 | Ga0207690_10654954 | 3300025932 | Bacteria | 861 |
| 263 | Ga0207706_10002621 | 3300025933 | Bacteria | 17511 |
| 264 | Ga0207706_10065880 | 3300025933 | Unclassified | 3188 |
| 265 | Ga0207691_10059694 | 3300025940 | Unclassified | 3467 |
| 266 | Ga0207711_10003031 | 3300025941 | Bacteria | 14679 |
| 267 | Ga0207711_10014748 | 3300025941 | Bacteria | 6494 |
| 268 | Ga0207711_10159854 | 3300025941 | Bacteria | 2038 |
| 269 | Ga0207711_10896955 | 3300025941 | Unclassified | 824 |
| 270 | Ga0207689_10001421 | 3300025942 | Bacteria | 22850 |
| 271 | Ga0207661_10000069 | 3300025944 | Bacteria | 70656 |
| 272 | Ga0207661_10007620 | 3300025944 | Bacteria | 7700 |
| 273 | Ga0207661_10166792 | 3300025944 | Bacteria | 1914 |
| 274 | Ga0207661_10242974 | 3300025944 | Bacteria | 1598 |
| 275 | Ga0207661_10386175 | 3300025944 | Unclassified | 1268 |
| 276 | Ga0207679_10019496 | 3300025945 | Bacteria | 4557 |
| 277 | Ga0207679_10026408 | 3300025945 | Bacteria | 4003 |
| 278 | Ga0207679_10215880 | 3300025945 | Unclassified | 1611 |
| 279 | Ga0207679_10229938 | 3300025945 | Bacteria | 1565 |
| 280 | Ga0207667_10001350 | 3300025949 | Bacteria | 30798 |
| 281 | Ga0207667_10011007 | 3300025949 | Bacteria | 10540 |
| 282 | Ga0207667_10027188 | 3300025949 | Bacteria | 6234 |
| 283 | Ga0207667_10205048 | 3300025949 | Bacteria | 2022 |
| 284 | Ga0207667_10503778 | 3300025949 | Unclassified | 1228 |
| 285 | Ga0207651_10319825 | 3300025960 | Unclassified | 1297 |
| 286 | Ga0207668_10147007 | 3300025972 | Bacteria | 1820 |
| 287 | Ga0207640_10025731 | 3300025981 | Unclassified | 3566 |
| 288 | Ga0207658_10000135 | 3300025986 | Bacteria | 77651 |
| 289 | Ga0207658_10545841 | 3300025986 | Bacteria | 1037 |
| 290 | Ga0207677_10000034 | 3300026023 | Bacteria | 117922 |
| 291 | Ga0207703_10023319 | 3300026035 | Bacteria | 4860 |
| 292 | Ga0207639_10000378 | 3300026041 | Bacteria | 30715 |
| 293 | Ga0207639_10003497 | 3300026041 | Bacteria | 10564 |
| 294 | Ga0207639_10022170 | 3300026041 | Bacteria | 4572 |
| 295 | Ga0207639_10147463 | 3300026041 | Unclassified | 1967 |
| 296 | Ga0207678_10369969 | 3300026067 | Bacteria | 1238 |
| 297 | Ga0207702_10000109 | 3300026078 | Bacteria | 95381 |
| 298 | Ga0207702_10006915 | 3300026078 | Bacteria | 9713 |
| 299 | Ga0207702_10110936 | 3300026078 | Unclassified | 2438 |
| 300 | Ga0207702_10227774 | 3300026078 | Bacteria | 1740 |
| 301 | Ga0207702_10363731 | 3300026078 | Bacteria | 1387 |
| 302 | Ga0207702_10572635 | 3300026078 | Bacteria | 1106 |
| 303 | Ga0207641_10262124 | 3300026088 | Unclassified | 1619 |
| 304 | Ga0207648_10127123 | 3300026089 | Bacteria | 2242 |
| 305 | Ga0207676_10003127 | 3300026095 | Bacteria | 11818 |
| 306 | Ga0207676_10601766 | 3300026095 | Bacteria | 1056 |
| 307 | Ga0207674_10000515 | 3300026116 | Bacteria | 50714 |
| 308 | Ga0207674_10000968 | 3300026116 | Bacteria | 37588 |
| 309 | Ga0207674_10021506 | 3300026116 | Bacteria | 6946 |
| 310 | Ga0207674_10021919 | 3300026116 | Bacteria | 6870 |
| 311 | Ga0207674_10129643 | 3300026116 | Unclassified | 2486 |
| 312 | Ga0207683_10004224 | 3300026121 | Bacteria | 12408 |
| 313 | Ga0207698_10000008 | 3300026142 | Bacteria | 281991 |
| 314 | Ga0207698_10000127 | 3300026142 | Bacteria | 47741 |
| 315 | Ga0207698_10101756 | 3300026142 | Bacteria | 2383 |
| 316 | Ga0207698_10143571 | 3300026142 | Unclassified | 2060 |
| 317 | Ga0207698_10340411 | 3300026142 | Unclassified | 1413 |
| 318 | Ga0207698_10757643 | 3300026142 | Unclassified | 970 |
| 319 | Ga0268266_10234359 | 3300028379 | Bacteria | 1692 |
| 320 | Ga0268265_10452578 | 3300028380 | Bacteria | 1199 |
| 321 | Ga0268264_10000669 | 3300028381 | Bacteria | 40172 |
| 322 | Ga0268264_11834767 | 3300028381 | Unclassified | 616 |
| 323 | Ga0265338_10054701 | 3300028800 | Bacteria | 3556 |
| 324 | Ga0265338_10462850 | 3300028800 | Unclassified | 897 |
| 325 | Ga0265338_10928261 | 3300028800 | Unclassified | 592 |
| 326 | Ga0265324_10094313 | 3300029957 | Bacteria | 1018 |
| 327 | Ga0265328_10012491 | 3300031239 | Bacteria | 3379 |
| 328 | Ga0265325_10022446 | 3300031241 | Bacteria | 3457 |
| 329 | Ga0265340_10100285 | 3300031247 | Bacteria | 1346 |
| 330 | Ga0265339_10000023 | 3300031249 | Bacteria | 169980 |
| 331 | Ga0265339_10225764 | 3300031249 | Bacteria | 914 |
| 332 | Ga0265331_10040009 | 3300031250 | Bacteria | 2283 |
| 333 | Ga0265316_10012619 | 3300031344 | Bacteria | 7564 |
| 334 | Ga0265316_10070341 | 3300031344 | Bacteria | 2699 |
| 335 | Ga0265316_10352499 | 3300031344 | Unclassified | 1065 |
| 336 | Ga0265313_10095781 | 3300031595 | Unclassified | 1324 |
| 337 | Ga0265314_10050048 | 3300031711 | Bacteria | 2921 |
| 338 | Ga0265314_10290732 | 3300031711 | Unclassified | 920 |
| 339 | Ga0265342_10001386 | 3300031712 | Bacteria | 22665 |
| 340 | Ga0265342_10037539 | 3300031712 | Bacteria | 2954 |
| 341 | Ga0265342_10081046 | 3300031712 | Bacteria | 1874 |
| 342 | Ga0307410_10049993 | 3300031852 | Bacteria | 2809 |
| 343 | Ga0307409_100088437 | 3300031995 | Bacteria | 2529 |
| 344 | Ga0307416_101054011 | 3300032002 | Bacteria | 917 |
| 345 | Ga0307415_100673519 | 3300032126 | Unclassified | 930 |
| 346 | Ga0373955_0043974 | 3300035172 | Bacteria | 2404 |
| 347 | Ga0373933_0030401 | 3300035724 | Bacteria | 3127 |
| 348 | Ga0373947_0193587 | 3300035725 | Bacteria | 1328 |
| 349 | Ga0373937_0002687 | 3300036401 | Bacteria | 14840 |
| 350 | Ga0373937_1311563 | 3300036401 | Unclassified | 672 |
| 351 | Ga0373937_1370444 | 3300036401 | Unclassified | 655 |
| 352 | Ga0372808_055091 | 3300036459 | Unclassified | 570 |
| 353 | Ga0373925_0719191 | 3300037068 | Unclassified | 823 |
| 354 | Ga0395905_0049728 | 3300037471 | Bacteria | 3929 |
| 355 | Ga0395901_0688031 | 3300038443 | Unclassified | 1022 |
| 356 | Ga0451807_0579332 | 3300041486 | Unclassified | 765 |
| 357 | Ga0466961_0069644 | 3300044693 | Bacteria | 2233 |
| 358 | Ga0466961_0231513 | 3300044693 | Bacteria | 1137 |
| 359 | Ga0466963_0008146 | 3300044694 | Bacteria | 6276 |
| 360 | Ga0466963_0515878 | 3300044694 | Unclassified | 844 |
| 361 | Ga0466967_0023064 | 3300045976 | Bacteria | 5094 |
| 362 | Ga0495629_0040219 | 3300046459 | Bacteria | 3289 |
| 363 | Ga0495629_0352329 | 3300046459 | Bacteria | 1004 |
| 364 | Ga0495629_0943966 | 3300046459 | Bacteria | 564 |
| 365 | Ga0495580_0097459 | 3300046472 | Bacteria | 2045 |
| 366 | Ga0495580_0189260 | 3300046472 | Bacteria | 1420 |
| 367 | Ga0495580_0268302 | 3300046472 | Unclassified | 1166 |
| 368 | Ga0495582_0085807 | 3300046473 | Bacteria | 1752 |
| 369 | Ga0495608_0425414 | 3300046511 | Unclassified | 810 |
| 370 | Ga0495665_0035169 | 3300046531 | Bacteria | 2677 |
| 371 | Ga0495645_0090804 | 3300046543 | Bacteria | 2182 |
| 372 | Ga0495667_0227308 | 3300046559 | Bacteria | 1190 |
| 373 | Ga0495599_0246660 | 3300046678 | Unclassified | 1088 |
| 374 | Ga0495599_0617501 | 3300046678 | Unclassified | 630 |
| 375 | Ga0495623_0257094 | 3300046679 | Bacteria | 980 |
| 376 | Ga0495613_0096389 | 3300046689 | Bacteria | 2139 |
| 377 | Ga0495613_0166617 | 3300046689 | Bacteria | 1565 |
| 378 | Ga0495613_0325902 | 3300046689 | Bacteria | 1059 |
| 379 | Ga0495581_0082779 | 3300047315 | Bacteria | 1859 |
| 380 | Ga0495604_0238461 | 3300047317 | Bacteria | 1245 |
| 381 | Ga0495604_0331042 | 3300047317 | Bacteria | 1016 |
| 382 | Ga0495674_0391654 | 3300047319 | Bacteria | 1123 |
| 383 | Ga0495684_0139561 | 3300047471 | Bacteria | 1817 |
| 384 | Ga0495593_0288183 | 3300047673 | Unclassified | 821 |
| 385 | Ga0496100_0102586 | 3300048903 | Bacteria | 1974 |
| 386 | Ga0496100_0115408 | 3300048903 | Bacteria | 1872 |
| 387 | Ga0496101_0250306 | 3300048904 | Bacteria | 1380 |
| 388 | Ga0496104_0015418 | 3300048907 | Bacteria | 6921 |
| 389 | Ga0496105_0017016 | 3300048908 | Bacteria | 5819 |
| 390 | Ga0496105_0103449 | 3300048908 | Bacteria | 2352 |
| 391 | Ga0496107_0005099 | 3300048910 | Bacteria | 8955 |
| 392 | Ga0496114_0021625 | 3300048917 | Bacteria | 5235 |
| 393 | Ga0496114_0386205 | 3300048917 | Bacteria | 1240 |
| 394 | Ga0496115_0018297 | 3300048918 | Bacteria | 5376 |
| 395 | Ga0496115_0107947 | 3300048918 | Bacteria | 2285 |
| 396 | Ga0496115_0622304 | 3300048918 | Unclassified | 856 |
| 397 | nmdc:mga05p37_428837_c1 | 3300050507 | Bacteria | 1536 |
| 398 | Ga0495595_0170270 | 3300053084 | Bacteria | 1078 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050507 | nmdc:mga05p37_428837_c1 | nmdc:mga05p37_428837_c1_382_822 | 126 |
| 2 | 3300005614 | Ga0068856_101160662 | Ga0068856_1011606621 | 132 |
| 3 | 3300013296 | Ga0157374_11072377 | Ga0157374_110723771 | 132 |
| 4 | 3300014969 | Ga0157376_10144355 | Ga0157376_101443552 | 132 |
| 5 | 3300036401 | Ga0373937_1311563 | Ga0373937_1311563_149_628 | 132 |
| 6 | 3300046459 | Ga0495629_0040219 | Ga0495629_0040219_62_541 | 132 |
| 7 | 3300046531 | Ga0495665_0035169 | Ga0495665_0035169_186_665 | 132 |
| 8 | 3300046689 | Ga0495613_0096389 | Ga0495613_0096389_64_543 | 132 |
| 9 | 3300047315 | Ga0495581_0082779 | Ga0495581_0082779_1341_1820 | 132 |
| 10 | 3300047673 | Ga0495593_0288183 | Ga0495593_0288183_65_544 | 132 |
| 11 | 3300048903 | Ga0496100_0115408 | Ga0496100_0115408_247_726 | 132 |
| 12 | 3300048904 | Ga0496101_0250306 | Ga0496101_0250306_191_670 | 132 |
| 13 | 3300048907 | Ga0496104_0015418 | Ga0496104_0015418_3908_4387 | 132 |
| 14 | 3300048908 | Ga0496105_0017016 | Ga0496105_0017016_1714_2193 | 132 |
| 15 | 3300048917 | Ga0496114_0021625 | Ga0496114_0021625_4560_5039 | 132 |
| 16 | 3300048918 | Ga0496115_0107947 | Ga0496115_0107947_1727_2206 | 132 |
| 17 | 3300046679 | Ga0495623_0257094 | Ga0495623_0257094_94_573 | 133 |
| 18 | 3300047317 | Ga0495604_0238461 | Ga0495604_0238461_252_731 | 133 |
| 19 | 3300009101 | Ga0105247_10189784 | Ga0105247_101897842 | 134 |
| 20 | 3300014325 | Ga0163163_12967084 | Ga0163163_129670841 | 134 |
| 21 | 3300048903 | Ga0496100_0102586 | Ga0496100_0102586_1331_1810 | 134 |
| 22 | 3300048910 | Ga0496107_0005099 | Ga0496107_0005099_4177_4656 | 134 |
| 23 | 3300048918 | Ga0496115_0018297 | Ga0496115_0018297_4518_4997 | 134 |
| 24 | 3300003320 | rootH2_10257385 | rootH2_102573851 | 135 |
| 25 | 3300025908 | Ga0207643_10368128 | Ga0207643_103681282 | 135 |
| 26 | 3300003320 | rootH2_10219196 | rootH2_102191962 | 136 |
| 27 | 3300005439 | Ga0070711_101437335 | Ga0070711_1014373351 | 136 |
| 28 | 3300006173 | Ga0070716_100623085 | Ga0070716_1006230852 | 136 |
| 29 | 3300013297 | Ga0157378_11269427 | Ga0157378_112694272 | 136 |
| 30 | 3300025906 | Ga0207699_10944384 | Ga0207699_109443842 | 136 |
| 31 | 3300025916 | Ga0207663_11222475 | Ga0207663_112224751 | 136 |
| 32 | 3300025927 | Ga0207687_10339721 | Ga0207687_103397211 | 136 |
| 33 | 3300035725 | Ga0373947_0193587 | Ga0373947_0193587_349_777 | 137 |
| 34 | 3300036459 | Ga0372808_055091 | Ga0372808_055091_59_526 | 137 |
| 35 | 3300037068 | Ga0373925_0719191 | Ga0373925_0719191_89_517 | 137 |
| 36 | 3300044693 | Ga0466961_0231513 | Ga0466961_0231513_523_936 | 137 |
| 37 | 3300047317 | Ga0495604_0331042 | Ga0495604_0331042_16_429 | 137 |
| 38 | 3300005336 | Ga0070680_100328356 | Ga0070680_1003283562 | 138 |
| 39 | 3300005339 | Ga0070660_100914736 | Ga0070660_1009147362 | 138 |
| 40 | 3300005344 | Ga0070661_100022794 | Ga0070661_1000227943 | 138 |
| 41 | 3300005457 | Ga0070662_100250304 | Ga0070662_1002503042 | 138 |
| 42 | 3300005457 | Ga0070662_100347475 | Ga0070662_1003474752 | 138 |
| 43 | 3300005458 | Ga0070681_11074260 | Ga0070681_110742601 | 138 |
| 44 | 3300005539 | Ga0068853_100037487 | Ga0068853_1000374874 | 138 |
| 45 | 3300005545 | Ga0070695_101539666 | Ga0070695_1015396661 | 138 |
| 46 | 3300005564 | Ga0070664_100023289 | Ga0070664_1000232895 | 138 |
| 47 | 3300005577 | Ga0068857_100066068 | Ga0068857_1000660682 | 138 |
| 48 | 3300005616 | Ga0068852_100605779 | Ga0068852_1006057792 | 138 |
| 49 | 3300005834 | Ga0068851_10150188 | Ga0068851_101501882 | 138 |
| 50 | 3300009176 | Ga0105242_10036455 | Ga0105242_100364552 | 138 |
| 51 | 3300013100 | Ga0157373_10017483 | Ga0157373_100174834 | 138 |
| 52 | 3300013100 | Ga0157373_10083003 | Ga0157373_100830032 | 138 |
| 53 | 3300013102 | Ga0157371_10773954 | Ga0157371_107739541 | 138 |
| 54 | 3300013104 | Ga0157370_10769108 | Ga0157370_107691082 | 138 |
| 55 | 3300013105 | Ga0157369_10183794 | Ga0157369_101837942 | 138 |
| 56 | 3300013307 | Ga0157372_10035033 | Ga0157372_100350335 | 138 |
| 57 | 3300013307 | Ga0157372_11141849 | Ga0157372_111418491 | 138 |
| 58 | 3300025321 | Ga0207656_10279940 | Ga0207656_102799402 | 138 |
| 59 | 3300025917 | Ga0207660_10963265 | Ga0207660_109632651 | 138 |
| 60 | 3300025919 | Ga0207657_10717280 | Ga0207657_107172802 | 138 |
| 61 | 3300025920 | Ga0207649_10073452 | Ga0207649_100734523 | 138 |
| 62 | 3300025921 | Ga0207652_10158551 | Ga0207652_101585513 | 138 |
| 63 | 3300025932 | Ga0207690_10654954 | Ga0207690_106549542 | 138 |
| 64 | 3300025933 | Ga0207706_10065880 | Ga0207706_100658803 | 138 |
| 65 | 3300025945 | Ga0207679_10019496 | Ga0207679_100194963 | 138 |
| 66 | 3300025945 | Ga0207679_10215880 | Ga0207679_102158802 | 138 |
| 67 | 3300026041 | Ga0207639_10003497 | Ga0207639_100034974 | 138 |
| 68 | 3300026089 | Ga0207648_10127123 | Ga0207648_101271232 | 138 |
| 69 | 3300026116 | Ga0207674_10129643 | Ga0207674_101296433 | 138 |
| 70 | 3300031711 | Ga0265314_10290732 | Ga0265314_102907321 | 138 |
| 71 | 3300037471 | Ga0395905_0049728 | Ga0395905_0049728_2057_2485 | 138 |
| 72 | 3300038443 | Ga0395901_0688031 | Ga0395901_0688031_266_694 | 138 |
| 73 | 3300031995 | Ga0307409_100088437 | Ga0307409_1000884373 | 139 |
| 74 | 3300032126 | Ga0307415_100673519 | Ga0307415_1006735192 | 139 |
| 75 | 3300005563 | Ga0068855_101532625 | Ga0068855_1015326251 | 140 |
| 76 | 3300005614 | Ga0068856_100059902 | Ga0068856_1000599022 | 141 |
| 77 | 3300005616 | Ga0068852_100484753 | Ga0068852_1004847532 | 141 |
| 78 | 3300009093 | Ga0105240_10007831 | Ga0105240_100078316 | 141 |
| 79 | 3300009551 | Ga0105238_10114512 | Ga0105238_101145122 | 141 |
| 80 | 3300013105 | Ga0157369_10018222 | Ga0157369_100182228 | 141 |
| 81 | 3300013307 | Ga0157372_10017416 | Ga0157372_100174166 | 141 |
| 82 | 3300025913 | Ga0207695_10037358 | Ga0207695_100373584 | 141 |
| 83 | 3300025949 | Ga0207667_10027188 | Ga0207667_100271881 | 141 |
| 84 | 3300026078 | Ga0207702_10110936 | Ga0207702_101109362 | 141 |
| 85 | 3300025901 | Ga0207688_10363921 | Ga0207688_103639211 | 142 |
| 86 | 3300025931 | Ga0207644_10095817 | Ga0207644_100958171 | 142 |
| 87 | 3300031852 | Ga0307410_10049993 | Ga0307410_100499934 | 142 |
| 88 | 3300032002 | Ga0307416_101054011 | Ga0307416_1010540111 | 142 |
| 89 | 3300035172 | Ga0373955_0043974 | Ga0373955_0043974_1076_1528 | 145 |
| 90 | 3300035724 | Ga0373933_0030401 | Ga0373933_0030401_1220_1672 | 145 |
| 91 | 3300036401 | Ga0373937_0002687 | Ga0373937_0002687_3472_3924 | 145 |
| 92 | 3300003320 | rootH2_10266853 | rootH2_102668531 | 147 |
| 93 | 3300013296 | Ga0157374_10365742 | Ga0157374_103657422 | 147 |
| 94 | 3300009174 | Ga0105241_10949016 | Ga0105241_109490162 | 148 |
| 95 | 3300028800 | Ga0265338_10462850 | Ga0265338_104628502 | 148 |
| 96 | 3300028800 | Ga0265338_10928261 | Ga0265338_109282611 | 148 |
| 97 | 3300031241 | Ga0265325_10022446 | Ga0265325_100224463 | 148 |
| 98 | 3300031249 | Ga0265339_10225764 | Ga0265339_102257642 | 148 |
| 99 | 3300031250 | Ga0265331_10040009 | Ga0265331_100400092 | 148 |
| 100 | 3300031595 | Ga0265313_10095781 | Ga0265313_100957811 | 148 |
| 101 | 3300031712 | Ga0265342_10081046 | Ga0265342_100810462 | 148 |
| 102 | 3300046472 | Ga0495580_0097459 | Ga0495580_0097459_344_823 | 148 |
| 103 | 3300046559 | Ga0495667_0227308 | Ga0495667_0227308_688_1167 | 148 |
| 104 | 3300046678 | Ga0495599_0246660 | Ga0495599_0246660_507_986 | 148 |
| 105 | 3300046689 | Ga0495613_0325902 | Ga0495613_0325902_340_819 | 148 |
| 106 | 3300047319 | Ga0495674_0391654 | Ga0495674_0391654_250_729 | 148 |
| 107 | 3300005439 | Ga0070711_101030933 | Ga0070711_1010309331 | 149 |
| 108 | 3300005535 | Ga0070684_100003264 | Ga0070684_1000032642 | 149 |
| 109 | 3300006028 | Ga0070717_10213379 | Ga0070717_102133792 | 149 |
| 110 | 3300006028 | Ga0070717_10954948 | Ga0070717_109549482 | 149 |
| 111 | 3300009177 | Ga0105248_11986463 | Ga0105248_119864631 | 149 |
| 112 | 3300013105 | Ga0157369_10033865 | Ga0157369_100338656 | 149 |
| 113 | 3300013307 | Ga0157372_10551087 | Ga0157372_105510872 | 149 |
| 114 | 3300025916 | Ga0207663_11107817 | Ga0207663_111078171 | 149 |
| 115 | 3300025928 | Ga0207700_10673708 | Ga0207700_106737081 | 149 |
| 116 | 3300025944 | Ga0207661_10007620 | Ga0207661_100076206 | 149 |
| 117 | 3300025944 | Ga0207661_10386175 | Ga0207661_103861752 | 149 |
| 118 | 3300025949 | Ga0207667_10205048 | Ga0207667_102050482 | 149 |
| 119 | 3300028800 | Ga0265338_10054701 | Ga0265338_100547013 | 149 |
| 120 | 3300031239 | Ga0265328_10012491 | Ga0265328_100124913 | 149 |
| 121 | 3300031247 | Ga0265340_10100285 | Ga0265340_101002852 | 149 |
| 122 | 3300031249 | Ga0265339_10000023 | Ga0265339_1000002337 | 149 |
| 123 | 3300031344 | Ga0265316_10070341 | Ga0265316_100703412 | 149 |
| 124 | 3300031712 | Ga0265342_10001386 | Ga0265342_100013864 | 149 |
| 125 | 3300044693 | Ga0466961_0069644 | Ga0466961_0069644_1343_1801 | 149 |
| 126 | 3300046459 | Ga0495629_0943966 | Ga0495629_0943966_47_511 | 149 |
| 127 | 3300046472 | Ga0495580_0268302 | Ga0495580_0268302_569_1033 | 149 |
| 128 | 3300048908 | Ga0496105_0103449 | Ga0496105_0103449_549_1013 | 149 |
| 129 | 3300048917 | Ga0496114_0386205 | Ga0496114_0386205_490_954 | 149 |
| 130 | 3300005329 | Ga0070683_100141754 | Ga0070683_1001417543 | 150 |
| 131 | 3300005331 | Ga0070670_100071176 | Ga0070670_1000711763 | 150 |
| 132 | 3300005335 | Ga0070666_10010947 | Ga0070666_100109473 | 150 |
| 133 | 3300005344 | Ga0070661_101437920 | Ga0070661_1014379201 | 150 |
| 134 | 3300005347 | Ga0070668_101071381 | Ga0070668_1010713811 | 150 |
| 135 | 3300005355 | Ga0070671_100056214 | Ga0070671_1000562143 | 150 |
| 136 | 3300005356 | Ga0070674_100683323 | Ga0070674_1006833232 | 150 |
| 137 | 3300005365 | Ga0070688_100880252 | Ga0070688_1008802521 | 150 |
| 138 | 3300005366 | Ga0070659_100363466 | Ga0070659_1003634662 | 150 |
| 139 | 3300005367 | Ga0070667_100105275 | Ga0070667_1001052752 | 150 |
| 140 | 3300005436 | Ga0070713_100419319 | Ga0070713_1004193192 | 150 |
| 141 | 3300005455 | Ga0070663_100308521 | Ga0070663_1003085212 | 150 |
| 142 | 3300005456 | Ga0070678_100043179 | Ga0070678_1000431793 | 150 |
| 143 | 3300005535 | Ga0070684_100792061 | Ga0070684_1007920612 | 150 |
| 144 | 3300005539 | Ga0068853_100419038 | Ga0068853_1004190381 | 150 |
| 145 | 3300005539 | Ga0068853_100821791 | Ga0068853_1008217912 | 150 |
| 146 | 3300005563 | Ga0068855_100027394 | Ga0068855_1000273946 | 150 |
| 147 | 3300005577 | Ga0068857_100057690 | Ga0068857_1000576902 | 150 |
| 148 | 3300005578 | Ga0068854_100228394 | Ga0068854_1002283943 | 150 |
| 149 | 3300005616 | Ga0068852_100000032 | Ga0068852_10000003231 | 150 |
| 150 | 3300005616 | Ga0068852_100066156 | Ga0068852_1000661562 | 150 |
| 151 | 3300005834 | Ga0068851_10113383 | Ga0068851_101133832 | 150 |
| 152 | 3300005841 | Ga0068863_100614520 | Ga0068863_1006145202 | 150 |
| 153 | 3300005843 | Ga0068860_100067831 | Ga0068860_1000678312 | 150 |
| 154 | 3300006358 | Ga0068871_100024204 | Ga0068871_1000242043 | 150 |
| 155 | 3300009093 | Ga0105240_10000135 | Ga0105240_1000013570 | 150 |
| 156 | 3300009093 | Ga0105240_10148445 | Ga0105240_101484452 | 150 |
| 157 | 3300009098 | Ga0105245_10117681 | Ga0105245_101176813 | 150 |
| 158 | 3300009101 | Ga0105247_10168798 | Ga0105247_101687982 | 150 |
| 159 | 3300009174 | Ga0105241_10701537 | Ga0105241_107015372 | 150 |
| 160 | 3300009545 | Ga0105237_10049097 | Ga0105237_100490971 | 150 |
| 161 | 3300009551 | Ga0105238_10024562 | Ga0105238_100245622 | 150 |
| 162 | 3300009551 | Ga0105238_10913252 | Ga0105238_109132522 | 150 |
| 163 | 3300009553 | Ga0105249_10116360 | Ga0105249_101163602 | 150 |
| 164 | 3300010375 | Ga0105239_10203618 | Ga0105239_102036183 | 150 |
| 165 | 3300010375 | Ga0105239_10565183 | Ga0105239_105651832 | 150 |
| 166 | 3300013100 | Ga0157373_10082054 | Ga0157373_100820541 | 150 |
| 167 | 3300013104 | Ga0157370_10000023 | Ga0157370_1000002361 | 150 |
| 168 | 3300013105 | Ga0157369_10000010 | Ga0157369_10000010138 | 150 |
| 169 | 3300013105 | Ga0157369_10062471 | Ga0157369_100624717 | 150 |
| 170 | 3300013105 | Ga0157369_10975054 | Ga0157369_109750541 | 150 |
| 171 | 3300013297 | Ga0157378_10030016 | Ga0157378_100300165 | 150 |
| 172 | 3300013306 | Ga0163162_10409792 | Ga0163162_104097921 | 150 |
| 173 | 3300013307 | Ga0157372_10000055 | Ga0157372_1000005573 | 150 |
| 174 | 3300013307 | Ga0157372_11474194 | Ga0157372_114741941 | 150 |
| 175 | 3300013308 | Ga0157375_10174218 | Ga0157375_101742181 | 150 |
| 176 | 3300013308 | Ga0157375_11013932 | Ga0157375_110139321 | 150 |
| 177 | 3300014325 | Ga0163163_10136906 | Ga0163163_101369062 | 150 |
| 178 | 3300014968 | Ga0157379_10034921 | Ga0157379_100349213 | 150 |
| 179 | 3300017792 | Ga0163161_10220016 | Ga0163161_102200162 | 150 |
| 180 | 3300025904 | Ga0207647_10076463 | Ga0207647_100764632 | 150 |
| 181 | 3300025913 | Ga0207695_10000050 | Ga0207695_1000005074 | 150 |
| 182 | 3300025913 | Ga0207695_10109201 | Ga0207695_101092012 | 150 |
| 183 | 3300025914 | Ga0207671_10126615 | Ga0207671_101266153 | 150 |
| 184 | 3300025924 | Ga0207694_10081246 | Ga0207694_100812462 | 150 |
| 185 | 3300025924 | Ga0207694_10787650 | Ga0207694_107876501 | 150 |
| 186 | 3300025931 | Ga0207644_10585956 | Ga0207644_105859562 | 150 |
| 187 | 3300025931 | Ga0207644_10798663 | Ga0207644_107986631 | 150 |
| 188 | 3300025933 | Ga0207706_10002621 | Ga0207706_100026218 | 150 |
| 189 | 3300025940 | Ga0207691_10059694 | Ga0207691_100596942 | 150 |
| 190 | 3300025941 | Ga0207711_10896955 | Ga0207711_108969552 | 150 |
| 191 | 3300025944 | Ga0207661_10166792 | Ga0207661_101667922 | 150 |
| 192 | 3300025949 | Ga0207667_10001350 | Ga0207667_1000135023 | 150 |
| 193 | 3300025960 | Ga0207651_10319825 | Ga0207651_103198252 | 150 |
| 194 | 3300025972 | Ga0207668_10147007 | Ga0207668_101470072 | 150 |
| 195 | 3300025986 | Ga0207658_10545841 | Ga0207658_105458412 | 150 |
| 196 | 3300026041 | Ga0207639_10147463 | Ga0207639_101474632 | 150 |
| 197 | 3300026067 | Ga0207678_10369969 | Ga0207678_103699691 | 150 |
| 198 | 3300026088 | Ga0207641_10262124 | Ga0207641_102621242 | 150 |
| 199 | 3300026095 | Ga0207676_10601766 | Ga0207676_106017662 | 150 |
| 200 | 3300026121 | Ga0207683_10004224 | Ga0207683_100042245 | 150 |
| 201 | 3300026142 | Ga0207698_10000008 | Ga0207698_10000008198 | 150 |
| 202 | 3300026142 | Ga0207698_10143571 | Ga0207698_101435712 | 150 |
| 203 | 3300028379 | Ga0268266_10234359 | Ga0268266_102343592 | 150 |
| 204 | 3300028381 | Ga0268264_11834767 | Ga0268264_118347671 | 150 |
| 205 | 3300031344 | Ga0265316_10012619 | Ga0265316_100126193 | 150 |
| 206 | 3300036401 | Ga0373937_1370444 | Ga0373937_1370444_79_531 | 150 |
| 207 | 3300041486 | Ga0451807_0579332 | Ga0451807_0579332_208_660 | 150 |
| 208 | 3300046459 | Ga0495629_0352329 | Ga0495629_0352329_422_874 | 150 |
| 209 | 3300046472 | Ga0495580_0189260 | Ga0495580_0189260_643_1095 | 150 |
| 210 | 3300046473 | Ga0495582_0085807 | Ga0495582_0085807_1148_1600 | 150 |
| 211 | 3300046511 | Ga0495608_0425414 | Ga0495608_0425414_84_536 | 150 |
| 212 | 3300046543 | Ga0495645_0090804 | Ga0495645_0090804_1182_1634 | 150 |
| 213 | 3300046678 | Ga0495599_0617501 | Ga0495599_0617501_106_558 | 150 |
| 214 | 3300046689 | Ga0495613_0166617 | Ga0495613_0166617_266_718 | 150 |
| 215 | 3300047471 | Ga0495684_0139561 | Ga0495684_0139561_739_1191 | 150 |
| 216 | 3300048918 | Ga0496115_0622304 | Ga0496115_0622304_71_523 | 150 |
| 217 | 3300053084 | Ga0495595_0170270 | Ga0495595_0170270_331_783 | 150 |
| 218 | 3300025927 | Ga0207687_10880203 | Ga0207687_108802031 | 152 |
| 219 | 3300025941 | Ga0207711_10014748 | Ga0207711_100147485 | 152 |
| 220 | 3300031344 | Ga0265316_10352499 | Ga0265316_103524992 | 152 |
| 221 | 3300031712 | Ga0265342_10037539 | Ga0265342_100375392 | 152 |
| 222 | 3300044694 | Ga0466963_0515878 | Ga0466963_0515878_296_766 | 153 |
| 223 | 3300009174 | Ga0105241_10000041 | Ga0105241_1000004138 | 154 |
| 224 | 3300013105 | Ga0157369_10037210 | Ga0157369_100372104 | 154 |
| 225 | 3300025911 | Ga0207654_10000094 | Ga0207654_1000009416 | 154 |
| 226 | 3300029957 | Ga0265324_10094313 | Ga0265324_100943132 | 154 |
| 227 | 3300031711 | Ga0265314_10050048 | Ga0265314_100500483 | 154 |
| 228 | 3300044694 | Ga0466963_0008146 | Ga0466963_0008146_5769_6242 | 154 |
| 229 | 3300045976 | Ga0466967_0023064 | Ga0466967_0023064_4125_4598 | 154 |
| 230 | 3300003323 | rootH1_10153212 | rootH1_101532126 | 155 |
| 231 | 3300005329 | Ga0070683_100325307 | Ga0070683_1003253071 | 155 |
| 232 | 3300005337 | Ga0070682_100655873 | Ga0070682_1006558731 | 155 |
| 233 | 3300005344 | Ga0070661_100013224 | Ga0070661_1000132244 | 155 |
| 234 | 3300005344 | Ga0070661_100897893 | Ga0070661_1008978932 | 155 |
| 235 | 3300005355 | Ga0070671_100069786 | Ga0070671_1000697864 | 155 |
| 236 | 3300005436 | Ga0070713_100536036 | Ga0070713_1005360361 | 155 |
| 237 | 3300005535 | Ga0070684_100139466 | Ga0070684_1001394662 | 155 |
| 238 | 3300005539 | Ga0068853_100000052 | Ga0068853_10000005232 | 155 |
| 239 | 3300005548 | Ga0070665_100003053 | Ga0070665_1000030539 | 155 |
| 240 | 3300005563 | Ga0068855_100007110 | Ga0068855_10000711011 | 155 |
| 241 | 3300005563 | Ga0068855_100068712 | Ga0068855_1000687122 | 155 |
| 242 | 3300005563 | Ga0068855_101162694 | Ga0068855_1011626941 | 155 |
| 243 | 3300005564 | Ga0070664_100064917 | Ga0070664_1000649172 | 155 |
| 244 | 3300005577 | Ga0068857_100000042 | Ga0068857_10000004262 | 155 |
| 245 | 3300005577 | Ga0068857_100014308 | Ga0068857_1000143087 | 155 |
| 246 | 3300005577 | Ga0068857_100284845 | Ga0068857_1002848452 | 155 |
| 247 | 3300005578 | Ga0068854_100035207 | Ga0068854_1000352072 | 155 |
| 248 | 3300005578 | Ga0068854_100061223 | Ga0068854_1000612232 | 155 |
| 249 | 3300005614 | Ga0068856_100009638 | Ga0068856_1000096389 | 155 |
| 250 | 3300005614 | Ga0068856_100013280 | Ga0068856_1000132805 | 155 |
| 251 | 3300005614 | Ga0068856_100029327 | Ga0068856_1000293274 | 155 |
| 252 | 3300005614 | Ga0068856_100070490 | Ga0068856_1000704905 | 155 |
| 253 | 3300005616 | Ga0068852_100000319 | Ga0068852_10000031919 | 155 |
| 254 | 3300005616 | Ga0068852_100078121 | Ga0068852_1000781212 | 155 |
| 255 | 3300005616 | Ga0068852_100479980 | Ga0068852_1004799802 | 155 |
| 256 | 3300005616 | Ga0068852_100656015 | Ga0068852_1006560152 | 155 |
| 257 | 3300005617 | Ga0068859_100564340 | Ga0068859_1005643401 | 155 |
| 258 | 3300005834 | Ga0068851_10004917 | Ga0068851_100049171 | 155 |
| 259 | 3300005834 | Ga0068851_10122165 | Ga0068851_101221652 | 155 |
| 260 | 3300005834 | Ga0068851_10454785 | Ga0068851_104547851 | 155 |
| 261 | 3300006358 | Ga0068871_100060830 | Ga0068871_1000608305 | 155 |
| 262 | 3300006931 | Ga0097620_100564343 | Ga0097620_1005643431 | 155 |
| 263 | 3300009093 | Ga0105240_10001555 | Ga0105240_1000155524 | 155 |
| 264 | 3300009093 | Ga0105240_10003376 | Ga0105240_1000337618 | 155 |
| 265 | 3300009093 | Ga0105240_10003845 | Ga0105240_1000384517 | 155 |
| 266 | 3300009093 | Ga0105240_10005717 | Ga0105240_1000571717 | 155 |
| 267 | 3300009098 | Ga0105245_10571107 | Ga0105245_105711072 | 155 |
| 268 | 3300009101 | Ga0105247_10041700 | Ga0105247_100417002 | 155 |
| 269 | 3300009174 | Ga0105241_10000174 | Ga0105241_1000017417 | 155 |
| 270 | 3300009174 | Ga0105241_10030172 | Ga0105241_100301724 | 155 |
| 271 | 3300009174 | Ga0105241_10104042 | Ga0105241_101040422 | 155 |
| 272 | 3300009174 | Ga0105241_11004764 | Ga0105241_110047641 | 155 |
| 273 | 3300009177 | Ga0105248_10000904 | Ga0105248_1000090430 | 155 |
| 274 | 3300009545 | Ga0105237_10002009 | Ga0105237_100020092 | 155 |
| 275 | 3300009545 | Ga0105237_11052476 | Ga0105237_110524762 | 155 |
| 276 | 3300009545 | Ga0105237_11337185 | Ga0105237_113371851 | 155 |
| 277 | 3300009551 | Ga0105238_10000386 | Ga0105238_1000038617 | 155 |
| 278 | 3300009551 | Ga0105238_10002740 | Ga0105238_100027404 | 155 |
| 279 | 3300009551 | Ga0105238_10063555 | Ga0105238_100635552 | 155 |
| 280 | 3300009551 | Ga0105238_10155777 | Ga0105238_101557775 | 155 |
| 281 | 3300010375 | Ga0105239_10000673 | Ga0105239_1000067325 | 155 |
| 282 | 3300010375 | Ga0105239_10000909 | Ga0105239_1000090917 | 155 |
| 283 | 3300010375 | Ga0105239_10059851 | Ga0105239_100598516 | 155 |
| 284 | 3300010375 | Ga0105239_10437623 | Ga0105239_104376232 | 155 |
| 285 | 3300010375 | Ga0105239_12544599 | Ga0105239_125445991 | 155 |
| 286 | 3300011119 | Ga0105246_10223828 | Ga0105246_102238282 | 155 |
| 287 | 3300013100 | Ga0157373_10029977 | Ga0157373_100299775 | 155 |
| 288 | 3300013104 | Ga0157370_10076421 | Ga0157370_100764211 | 155 |
| 289 | 3300013104 | Ga0157370_10275163 | Ga0157370_102751632 | 155 |
| 290 | 3300013105 | Ga0157369_10001424 | Ga0157369_1000142425 | 155 |
| 291 | 3300013105 | Ga0157369_10091881 | Ga0157369_100918815 | 155 |
| 292 | 3300013105 | Ga0157369_10236959 | Ga0157369_102369591 | 155 |
| 293 | 3300013296 | Ga0157374_10008343 | Ga0157374_100083439 | 155 |
| 294 | 3300013297 | Ga0157378_10004570 | Ga0157378_100045704 | 155 |
| 295 | 3300013297 | Ga0157378_10428753 | Ga0157378_104287532 | 155 |
| 296 | 3300013306 | Ga0163162_10055045 | Ga0163162_100550453 | 155 |
| 297 | 3300013307 | Ga0157372_10001858 | Ga0157372_1000185821 | 155 |
| 298 | 3300013307 | Ga0157372_10060647 | Ga0157372_100606476 | 155 |
| 299 | 3300013307 | Ga0157372_10343411 | Ga0157372_103434112 | 155 |
| 300 | 3300013307 | Ga0157372_10505817 | Ga0157372_105058172 | 155 |
| 301 | 3300025321 | Ga0207656_10071353 | Ga0207656_100713532 | 155 |
| 302 | 3300025911 | Ga0207654_10000100 | Ga0207654_1000010019 | 155 |
| 303 | 3300025911 | Ga0207654_10095402 | Ga0207654_100954022 | 155 |
| 304 | 3300025911 | Ga0207654_10188667 | Ga0207654_101886672 | 155 |
| 305 | 3300025913 | Ga0207695_10000293 | Ga0207695_1000029333 | 155 |
| 306 | 3300025913 | Ga0207695_10000930 | Ga0207695_1000093017 | 155 |
| 307 | 3300025913 | Ga0207695_10014333 | Ga0207695_100143333 | 155 |
| 308 | 3300025913 | Ga0207695_10131301 | Ga0207695_101313013 | 155 |
| 309 | 3300025914 | Ga0207671_10000562 | Ga0207671_1000056218 | 155 |
| 310 | 3300025920 | Ga0207649_10009397 | Ga0207649_100093977 | 155 |
| 311 | 3300025924 | Ga0207694_10000243 | Ga0207694_1000024329 | 155 |
| 312 | 3300025924 | Ga0207694_10002571 | Ga0207694_1000257111 | 155 |
| 313 | 3300025924 | Ga0207694_10179497 | Ga0207694_101794971 | 155 |
| 314 | 3300025924 | Ga0207694_10217263 | Ga0207694_102172632 | 155 |
| 315 | 3300025931 | Ga0207644_10052549 | Ga0207644_100525494 | 155 |
| 316 | 3300025941 | Ga0207711_10003031 | Ga0207711_1000303113 | 155 |
| 317 | 3300025944 | Ga0207661_10242974 | Ga0207661_102429742 | 155 |
| 318 | 3300025945 | Ga0207679_10229938 | Ga0207679_102299381 | 155 |
| 319 | 3300025949 | Ga0207667_10011007 | Ga0207667_100110074 | 155 |
| 320 | 3300025949 | Ga0207667_10503778 | Ga0207667_105037782 | 155 |
| 321 | 3300025981 | Ga0207640_10025731 | Ga0207640_100257312 | 155 |
| 322 | 3300026041 | Ga0207639_10000378 | Ga0207639_100003784 | 155 |
| 323 | 3300026078 | Ga0207702_10006915 | Ga0207702_1000691512 | 155 |
| 324 | 3300026078 | Ga0207702_10227774 | Ga0207702_102277741 | 155 |
| 325 | 3300026078 | Ga0207702_10363731 | Ga0207702_103637312 | 155 |
| 326 | 3300026078 | Ga0207702_10572635 | Ga0207702_105726352 | 155 |
| 327 | 3300026116 | Ga0207674_10000515 | Ga0207674_1000051511 | 155 |
| 328 | 3300026116 | Ga0207674_10021506 | Ga0207674_100215062 | 155 |
| 329 | 3300026116 | Ga0207674_10021919 | Ga0207674_100219196 | 155 |
| 330 | 3300026142 | Ga0207698_10000127 | Ga0207698_1000012725 | 155 |
| 331 | 3300026142 | Ga0207698_10101756 | Ga0207698_101017562 | 155 |
| 332 | 3300026142 | Ga0207698_10340411 | Ga0207698_103404111 | 155 |
| 333 | 3300026142 | Ga0207698_10757643 | Ga0207698_107576432 | 155 |
| 334 | 3300001991 | JGI24743J22301_10039416 | JGI24743J22301_100394162 | 158 |
| 335 | 3300005327 | Ga0070658_10627441 | Ga0070658_106274412 | 158 |
| 336 | 3300005329 | Ga0070683_100000097 | Ga0070683_10000009743 | 158 |
| 337 | 3300005334 | Ga0068869_100000207 | Ga0068869_1000002078 | 158 |
| 338 | 3300005338 | Ga0068868_100000210 | Ga0068868_10000021016 | 158 |
| 339 | 3300005355 | Ga0070671_100002109 | Ga0070671_10000210911 | 158 |
| 340 | 3300005367 | Ga0070667_100000592 | Ga0070667_10000059214 | 158 |
| 341 | 3300005535 | Ga0070684_100000031 | Ga0070684_10000003130 | 158 |
| 342 | 3300005539 | Ga0068853_100023546 | Ga0068853_1000235462 | 158 |
| 343 | 3300005564 | Ga0070664_100137916 | Ga0070664_1001379163 | 158 |
| 344 | 3300005577 | Ga0068857_100000269 | Ga0068857_1000002691 | 158 |
| 345 | 3300005614 | Ga0068856_100011532 | Ga0068856_1000115328 | 158 |
| 346 | 3300005616 | Ga0068852_100009904 | Ga0068852_1000099048 | 158 |
| 347 | 3300005617 | Ga0068859_100004094 | Ga0068859_10000409413 | 158 |
| 348 | 3300005618 | Ga0068864_100001547 | Ga0068864_1000015474 | 158 |
| 349 | 3300005834 | Ga0068851_10085075 | Ga0068851_100850752 | 158 |
| 350 | 3300005841 | Ga0068863_100000273 | Ga0068863_10000027336 | 158 |
| 351 | 3300005842 | Ga0068858_100296753 | Ga0068858_1002967532 | 158 |
| 352 | 3300005843 | Ga0068860_100000031 | Ga0068860_10000003143 | 158 |
| 353 | 3300005844 | Ga0068862_100113633 | Ga0068862_1001136332 | 158 |
| 354 | 3300006237 | Ga0097621_100000523 | Ga0097621_10000052324 | 158 |
| 355 | 3300006358 | Ga0068871_100000584 | Ga0068871_1000005848 | 158 |
| 356 | 3300006931 | Ga0097620_100004094 | Ga0097620_10000409413 | 158 |
| 357 | 3300009093 | Ga0105240_10000451 | Ga0105240_1000045142 | 158 |
| 358 | 3300009098 | Ga0105245_10001460 | Ga0105245_1000146013 | 158 |
| 359 | 3300009101 | Ga0105247_10004824 | Ga0105247_100048241 | 158 |
| 360 | 3300009174 | Ga0105241_10000987 | Ga0105241_1000098713 | 158 |
| 361 | 3300009177 | Ga0105248_10035674 | Ga0105248_100356744 | 158 |
| 362 | 3300009545 | Ga0105237_10004127 | Ga0105237_100041278 | 158 |
| 363 | 3300009551 | Ga0105238_10000334 | Ga0105238_1000033433 | 158 |
| 364 | 3300010375 | Ga0105239_10001496 | Ga0105239_1000149623 | 158 |
| 365 | 3300010375 | Ga0105239_10281101 | Ga0105239_102811012 | 158 |
| 366 | 3300011119 | Ga0105246_10000497 | Ga0105246_1000049713 | 158 |
| 367 | 3300013105 | Ga0157369_10084121 | Ga0157369_100841212 | 158 |
| 368 | 3300013296 | Ga0157374_10020079 | Ga0157374_100200792 | 158 |
| 369 | 3300013296 | Ga0157374_10043969 | Ga0157374_100439693 | 158 |
| 370 | 3300013297 | Ga0157378_10005341 | Ga0157378_100053414 | 158 |
| 371 | 3300013306 | Ga0163162_10043302 | Ga0163162_100433022 | 158 |
| 372 | 3300013308 | Ga0157375_10002348 | Ga0157375_100023487 | 158 |
| 373 | 3300014325 | Ga0163163_10000427 | Ga0163163_1000042724 | 158 |
| 374 | 3300014968 | Ga0157379_10000330 | Ga0157379_1000033018 | 158 |
| 375 | 3300014968 | Ga0157379_10542504 | Ga0157379_105425041 | 158 |
| 376 | 3300014969 | Ga0157376_10002011 | Ga0157376_1000201110 | 158 |
| 377 | 3300025321 | Ga0207656_10013820 | Ga0207656_100138206 | 158 |
| 378 | 3300025900 | Ga0207710_10000798 | Ga0207710_100007986 | 158 |
| 379 | 3300025909 | Ga0207705_10480867 | Ga0207705_104808672 | 158 |
| 380 | 3300025911 | Ga0207654_10000608 | Ga0207654_1000060817 | 158 |
| 381 | 3300025913 | Ga0207695_10000075 | Ga0207695_10000075217 | 158 |
| 382 | 3300025914 | Ga0207671_10001031 | Ga0207671_1000103126 | 158 |
| 383 | 3300025924 | Ga0207694_10000024 | Ga0207694_1000002428 | 158 |
| 384 | 3300025927 | Ga0207687_10001748 | Ga0207687_100017482 | 158 |
| 385 | 3300025931 | Ga0207644_10006631 | Ga0207644_100066316 | 158 |
| 386 | 3300025941 | Ga0207711_10159854 | Ga0207711_101598542 | 158 |
| 387 | 3300025942 | Ga0207689_10001421 | Ga0207689_100014216 | 158 |
| 388 | 3300025944 | Ga0207661_10000069 | Ga0207661_1000006948 | 158 |
| 389 | 3300025945 | Ga0207679_10026408 | Ga0207679_100264086 | 158 |
| 390 | 3300025986 | Ga0207658_10000135 | Ga0207658_1000013576 | 158 |
| 391 | 3300026023 | Ga0207677_10000034 | Ga0207677_1000003487 | 158 |
| 392 | 3300026035 | Ga0207703_10023319 | Ga0207703_100233196 | 158 |
| 393 | 3300026041 | Ga0207639_10022170 | Ga0207639_100221702 | 158 |
| 394 | 3300026078 | Ga0207702_10000109 | Ga0207702_1000010978 | 158 |
| 395 | 3300026095 | Ga0207676_10003127 | Ga0207676_1000312711 | 158 |
| 396 | 3300026116 | Ga0207674_10000968 | Ga0207674_100009684 | 158 |
| 397 | 3300028380 | Ga0268265_10452578 | Ga0268265_104525781 | 158 |
| 398 | 3300028381 | Ga0268264_10000669 | Ga0268264_100006694 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3b7c-assembly1.cif.gz_A-2 | crystal structure of a ntf-2 like protein of unknown function (so_0125) from shewanella oneidensis mr-1 at 1.70 a resolution | 0.9262 | 33 | 158 |
| 3b7c-assembly1.cif.gz_A-2 | crystal structure of a ntf-2 like protein of unknown function (so_0125) from shewanella oneidensis mr-1 at 1.70 a resolution | 0.8968 | 33 | 158 |
| 6d63-assembly4.cif.gz_G | the structure of atzh: a little known member of the atrazine breakdown pathway | 0.8245 | 31 | 158 |
| 6d63-assembly5.cif.gz_I | the structure of atzh: a little known member of the atrazine breakdown pathway | 0.8167 | 31 | 158 |
| 6d63-assembly3.cif.gz_E | the structure of atzh: a little known member of the atrazine breakdown pathway | 0.8158 | 31 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3b7cA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9146 | 33 | 158 | 3.10.450.50 |
| 3b7cA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8919 | 33 | 158 | 3.10.450.50 |
| af_A0A078BPG0_5_119_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8246 | 34 | 158 | 3.10.450.50 |
| 6d63G00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8245 | 31 | 158 | 3.10.450.50 |
| af_F4IZV9_103_223_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8204 | 31 | 154 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A372IM16-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9581 | 29 | 157 |
|
| AF-I4VWC2-F1-model_v4 | DUF4440 domain-containing protein | 0.9487 | 18 | 158 |
|
| AF-A0A370K9B0-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9455 | 16 | 158 |
|
| AF-A0A7X2TUZ3-F1-model_v4 | DUF4440 domain-containing protein | 0.9176 | 21 | 157 |
|
| AF-A0A7D7X682-F1-model_v4 | DUF4440 domain-containing protein | 0.9141 | 20 | 157 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar