F434040

General Info

Members Datasets Scaffolds Average Seq Length
398 167 398 152

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10551087|Ga0157372_105510872
Length 163
Sequence LQKIHFPGGTAVRRKTLLYVLLISLACFARAQSPSGDEAQIRAAMAAQTAAWNHGDIPGFMQSYEDSPDTTFIGATLRKGFQPILKRYQQAYSNSAQMGTLTFSDLDVRVLPGACGKAEIALVTGKFHLERSEKGEAKKDDGIFSLVWRKGPQGWKIVLDHTS

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.27
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10039416 3300001991 Unclassified 946
2 rootH2_10219196 3300003320 Bacteria 1257
3 rootH2_10257385 3300003320 Unclassified 3093
4 rootH2_10266853 3300003320 Bacteria 1099
5 rootH1_10153212 3300003323 Unclassified 4329
6 Ga0070658_10627441 3300005327 Unclassified 932
7 Ga0070683_100000097 3300005329 Bacteria 57304
8 Ga0070683_100141754 3300005329 Bacteria 2277
9 Ga0070683_100325307 3300005329 Unclassified 1463
10 Ga0070670_100071176 3300005331 Bacteria 2986
11 Ga0068869_100000207 3300005334 Bacteria 30679
12 Ga0070666_10010947 3300005335 Bacteria 5683
13 Ga0070680_100328356 3300005336 Unclassified 1299
14 Ga0070682_100655873 3300005337 Unclassified 836
15 Ga0068868_100000210 3300005338 Bacteria 39514
16 Ga0070660_100914736 3300005339 Unclassified 740
17 Ga0070661_100013224 3300005344 Bacteria 5793
18 Ga0070661_100022794 3300005344 Unclassified 4484
19 Ga0070661_100897893 3300005344 Unclassified 731
20 Ga0070661_101437920 3300005344 Unclassified 580
21 Ga0070668_101071381 3300005347 Unclassified 727
22 Ga0070671_100002109 3300005355 Bacteria 15334
23 Ga0070671_100056214 3300005355 Bacteria 3274
24 Ga0070671_100069786 3300005355 Unclassified 2931
25 Ga0070674_100683323 3300005356 Bacteria 876
26 Ga0070688_100880252 3300005365 Unclassified 705
27 Ga0070659_100363466 3300005366 Bacteria 1216
28 Ga0070667_100000592 3300005367 Bacteria 35570
29 Ga0070667_100105275 3300005367 Bacteria 2441
30 Ga0070713_100419319 3300005436 Bacteria 1253
31 Ga0070713_100536036 3300005436 Unclassified 1107
32 Ga0070711_101030933 3300005439 Unclassified 707
33 Ga0070711_101437335 3300005439 Unclassified 601
34 Ga0070663_100308521 3300005455 Bacteria 1269
35 Ga0070678_100043179 3300005456 Bacteria 3209
36 Ga0070662_100250304 3300005457 Unclassified 1424
37 Ga0070662_100347475 3300005457 Unclassified 1214
38 Ga0070681_11074260 3300005458 Unclassified 725
39 Ga0070684_100000031 3300005535 Bacteria 106109
40 Ga0070684_100003264 3300005535 Bacteria 12146
41 Ga0070684_100139466 3300005535 Unclassified 2192
42 Ga0070684_100792061 3300005535 Unclassified 886
43 Ga0068853_100000052 3300005539 Bacteria 86096
44 Ga0068853_100023546 3300005539 Bacteria 5157
45 Ga0068853_100037487 3300005539 Bacteria 4125
46 Ga0068853_100419038 3300005539 Bacteria 1255
47 Ga0068853_100821791 3300005539 Unclassified 890
48 Ga0070695_101539666 3300005545 Unclassified 554
49 Ga0070665_100003053 3300005548 Bacteria 18030
50 Ga0068855_100007110 3300005563 Bacteria 13577
51 Ga0068855_100027394 3300005563 Bacteria 6817
52 Ga0068855_100068712 3300005563 Bacteria 4124
53 Ga0068855_101162694 3300005563 Unclassified 804
54 Ga0068855_101532625 3300005563 Bacteria 684
55 Ga0070664_100023289 3300005564 Bacteria 5114
56 Ga0070664_100064917 3300005564 Bacteria 3114
57 Ga0070664_100137916 3300005564 Unclassified 2146
58 Ga0068857_100000042 3300005577 Bacteria 69986
59 Ga0068857_100000269 3300005577 Bacteria 35388
60 Ga0068857_100014308 3300005577 Bacteria 6915
61 Ga0068857_100057690 3300005577 Bacteria 3446
62 Ga0068857_100066068 3300005577 Unclassified 3218
63 Ga0068857_100284845 3300005577 Bacteria 1520
64 Ga0068854_100035207 3300005578 Bacteria 3503
65 Ga0068854_100061223 3300005578 Unclassified 2726
66 Ga0068854_100228394 3300005578 Unclassified 1476
67 Ga0068856_100009638 3300005614 Bacteria 9376
68 Ga0068856_100011532 3300005614 Bacteria 8574
69 Ga0068856_100013280 3300005614 Bacteria 7977
70 Ga0068856_100029327 3300005614 Bacteria 5375
71 Ga0068856_100059902 3300005614 Unclassified 3761
72 Ga0068856_100070490 3300005614 Bacteria 3458
73 Ga0068856_101160662 3300005614 Bacteria 789
74 Ga0068852_100000032 3300005616 Bacteria 102480
75 Ga0068852_100000319 3300005616 Bacteria 32685
76 Ga0068852_100009904 3300005616 Bacteria 7095
77 Ga0068852_100066156 3300005616 Unclassified 3156
78 Ga0068852_100078121 3300005616 Bacteria 2928
79 Ga0068852_100479980 3300005616 Unclassified 1235
80 Ga0068852_100484753 3300005616 Bacteria 1229
81 Ga0068852_100605779 3300005616 Unclassified 1100
82 Ga0068852_100656015 3300005616 Unclassified 1057
83 Ga0068859_100004094 3300005617 Bacteria 14872
84 Ga0068859_100564340 3300005617 Bacteria 1232
85 Ga0068864_100001547 3300005618 Bacteria 18969
86 Ga0068851_10004917 3300005834 Bacteria 6058
87 Ga0068851_10085075 3300005834 Bacteria 1657
88 Ga0068851_10113383 3300005834 Unclassified 1450
89 Ga0068851_10122165 3300005834 Bacteria 1400
90 Ga0068851_10150188 3300005834 Unclassified 1273
91 Ga0068851_10454785 3300005834 Unclassified 761
92 Ga0068863_100000273 3300005841 Bacteria 53827
93 Ga0068863_100614520 3300005841 Bacteria 1076
94 Ga0068858_100296753 3300005842 Bacteria 1541
95 Ga0068860_100000031 3300005843 Bacteria 255068
96 Ga0068860_100067831 3300005843 Bacteria 3389
97 Ga0068862_100113633 3300005844 Bacteria 2379
98 Ga0070717_10213379 3300006028 Bacteria 1695
99 Ga0070717_10954948 3300006028 Bacteria 781
100 Ga0070716_100623085 3300006173 Unclassified 814
101 Ga0097621_100000523 3300006237 Bacteria 26929
102 Ga0068871_100000584 3300006358 Bacteria 25049
103 Ga0068871_100024204 3300006358 Bacteria 4705
104 Ga0068871_100060830 3300006358 Bacteria 3082
105 Ga0097620_100004094 3300006931 Bacteria 14872
106 Ga0097620_100564343 3300006931 Bacteria 1232
107 Ga0105240_10000135 3300009093 Bacteria 151432
108 Ga0105240_10000451 3300009093 Bacteria 75544
109 Ga0105240_10001555 3300009093 Bacteria 38963
110 Ga0105240_10003376 3300009093 Bacteria 24823
111 Ga0105240_10003845 3300009093 Bacteria 23185
112 Ga0105240_10005717 3300009093 Bacteria 18451
113 Ga0105240_10007831 3300009093 Bacteria 15423
114 Ga0105240_10148445 3300009093 Bacteria 2795
115 Ga0105245_10001460 3300009098 Bacteria 21374
116 Ga0105245_10117681 3300009098 Bacteria 2479
117 Ga0105245_10571107 3300009098 Bacteria 1155
118 Ga0105247_10004824 3300009101 Bacteria 8583
119 Ga0105247_10041700 3300009101 Bacteria 2809
120 Ga0105247_10168798 3300009101 Bacteria 1453
121 Ga0105247_10189784 3300009101 Unclassified 1375
122 Ga0105241_10000041 3300009174 Bacteria 107393
123 Ga0105241_10000174 3300009174 Bacteria 47325
124 Ga0105241_10000987 3300009174 Bacteria 21542
125 Ga0105241_10030172 3300009174 Bacteria 4050
126 Ga0105241_10104042 3300009174 Bacteria 2262
127 Ga0105241_10701537 3300009174 Bacteria 924
128 Ga0105241_10949016 3300009174 Unclassified 802
129 Ga0105241_11004764 3300009174 Bacteria 780
130 Ga0105242_10036455 3300009176 Bacteria 3945
131 Ga0105248_10000904 3300009177 Bacteria 33191
132 Ga0105248_10035674 3300009177 Bacteria 5563
133 Ga0105248_11986463 3300009177 Unclassified 661
134 Ga0105237_10002009 3300009545 Bacteria 25902
135 Ga0105237_10004127 3300009545 Bacteria 16931
136 Ga0105237_10049097 3300009545 Bacteria 4243
137 Ga0105237_11052476 3300009545 Bacteria 820
138 Ga0105237_11337185 3300009545 Unclassified 723
139 Ga0105238_10000334 3300009551 Bacteria 51408
140 Ga0105238_10000386 3300009551 Bacteria 47230
141 Ga0105238_10002740 3300009551 Bacteria 17556
142 Ga0105238_10024562 3300009551 Bacteria 6142
143 Ga0105238_10063555 3300009551 Unclassified 3692
144 Ga0105238_10114512 3300009551 Bacteria 2676
145 Ga0105238_10155777 3300009551 Bacteria 2260
146 Ga0105238_10913252 3300009551 Unclassified 897
147 Ga0105249_10116360 3300009553 Bacteria 2534
148 Ga0105239_10000673 3300010375 Bacteria 48672
149 Ga0105239_10000909 3300010375 Bacteria 42107
150 Ga0105239_10001496 3300010375 Bacteria 31060
151 Ga0105239_10059851 3300010375 Unclassified 4180
152 Ga0105239_10203618 3300010375 Bacteria 2217
153 Ga0105239_10281101 3300010375 Unclassified 1874
154 Ga0105239_10437623 3300010375 Bacteria 1482
155 Ga0105239_10565183 3300010375 Unclassified 1296
156 Ga0105239_12544599 3300010375 Bacteria 597
157 Ga0105246_10000497 3300011119 Bacteria 21376
158 Ga0105246_10223828 3300011119 Bacteria 1476
159 Ga0157373_10017483 3300013100 Bacteria 5223
160 Ga0157373_10029977 3300013100 Unclassified 3916
161 Ga0157373_10082054 3300013100 Bacteria 2272
162 Ga0157373_10083003 3300013100 Unclassified 2258
163 Ga0157371_10773954 3300013102 Unclassified 722
164 Ga0157370_10000023 3300013104 Bacteria 161359
165 Ga0157370_10076421 3300013104 Unclassified 3154
166 Ga0157370_10275163 3300013104 Unclassified 1555
167 Ga0157370_10769108 3300013104 Unclassified 877
168 Ga0157369_10000010 3300013105 Bacteria 273443
169 Ga0157369_10001424 3300013105 Bacteria 29355
170 Ga0157369_10018222 3300013105 Bacteria 7874
171 Ga0157369_10033865 3300013105 Bacteria 5610
172 Ga0157369_10037210 3300013105 Bacteria 5328
173 Ga0157369_10062471 3300013105 Bacteria 4014
174 Ga0157369_10084121 3300013105 Bacteria 3401
175 Ga0157369_10091881 3300013105 Bacteria 3239
176 Ga0157369_10183794 3300013105 Unclassified 2199
177 Ga0157369_10236959 3300013105 Unclassified 1906
178 Ga0157369_10975054 3300013105 Unclassified 868
179 Ga0157374_10008343 3300013296 Bacteria 8844
180 Ga0157374_10020079 3300013296 Bacteria 5924
181 Ga0157374_10043969 3300013296 Bacteria 4127
182 Ga0157374_10365742 3300013296 Bacteria 1435
183 Ga0157374_11072377 3300013296 Bacteria 826
184 Ga0157378_10004570 3300013297 Bacteria 12141
185 Ga0157378_10005341 3300013297 Bacteria 11272
186 Ga0157378_10030016 3300013297 Bacteria 4802
187 Ga0157378_10428753 3300013297 Bacteria 1308
188 Ga0157378_11269427 3300013297 Bacteria 777
189 Ga0163162_10043302 3300013306 Bacteria 4508
190 Ga0163162_10055045 3300013306 Bacteria 4004
191 Ga0163162_10409792 3300013306 Unclassified 1488
192 Ga0157372_10000055 3300013307 Bacteria 126308
193 Ga0157372_10001858 3300013307 Bacteria 22895
194 Ga0157372_10017416 3300013307 Bacteria 7711
195 Ga0157372_10035033 3300013307 Bacteria 5523
196 Ga0157372_10060647 3300013307 Unclassified 4233
197 Ga0157372_10343411 3300013307 Unclassified 1739
198 Ga0157372_10505817 3300013307 Bacteria 1409
199 Ga0157372_10551087 3300013307 Bacteria 1344
200 Ga0157372_11141849 3300013307 Unclassified 901
201 Ga0157372_11474194 3300013307 Bacteria 784
202 Ga0157375_10002348 3300013308 Bacteria 16343
203 Ga0157375_10174218 3300013308 Bacteria 2300
204 Ga0157375_11013932 3300013308 Bacteria 969
205 Ga0163163_10000427 3300014325 Bacteria 38751
206 Ga0163163_10136906 3300014325 Bacteria 2490
207 Ga0163163_12967084 3300014325 Unclassified 529
208 Ga0157379_10000330 3300014968 Bacteria 37889
209 Ga0157379_10034921 3300014968 Bacteria 4482
210 Ga0157379_10542504 3300014968 Unclassified 1081
211 Ga0157376_10002011 3300014969 Bacteria 13630
212 Ga0157376_10144355 3300014969 Unclassified 2139
213 Ga0163161_10220016 3300017792 Bacteria 1470
214 Ga0207656_10013820 3300025321 Bacteria 3096
215 Ga0207656_10071353 3300025321 Bacteria 1544
216 Ga0207656_10279940 3300025321 Unclassified 822
217 Ga0207710_10000798 3300025900 Bacteria 17109
218 Ga0207688_10363921 3300025901 Unclassified 893
219 Ga0207647_10076463 3300025904 Bacteria 2014
220 Ga0207699_10944384 3300025906 Unclassified 637
221 Ga0207643_10368128 3300025908 Unclassified 904
222 Ga0207705_10480867 3300025909 Unclassified 964
223 Ga0207654_10000094 3300025911 Bacteria 59572
224 Ga0207654_10000100 3300025911 Bacteria 57508
225 Ga0207654_10000608 3300025911 Bacteria 20210
226 Ga0207654_10095402 3300025911 Unclassified 1822
227 Ga0207654_10188667 3300025911 Unclassified 1350
228 Ga0207695_10000050 3300025913 Bacteria 405727
229 Ga0207695_10000075 3300025913 Bacteria 308496
230 Ga0207695_10000293 3300025913 Bacteria 123676
231 Ga0207695_10000930 3300025913 Bacteria 52294
232 Ga0207695_10014333 3300025913 Bacteria 9400
233 Ga0207695_10037358 3300025913 Bacteria 5240
234 Ga0207695_10109201 3300025913 Bacteria 2749
235 Ga0207695_10131301 3300025913 Bacteria 2462
236 Ga0207671_10000562 3300025914 Bacteria 49896
237 Ga0207671_10001031 3300025914 Bacteria 33913
238 Ga0207671_10126615 3300025914 Bacteria 1958
239 Ga0207663_11107817 3300025916 Unclassified 636
240 Ga0207663_11222475 3300025916 Unclassified 605
241 Ga0207660_10963265 3300025917 Unclassified 696
242 Ga0207657_10717280 3300025919 Unclassified 776
243 Ga0207649_10009397 3300025920 Bacteria 5350
244 Ga0207649_10073452 3300025920 Unclassified 2191
245 Ga0207652_10158551 3300025921 Bacteria 2028
246 Ga0207694_10000024 3300025924 Bacteria 259443
247 Ga0207694_10000243 3300025924 Bacteria 52313
248 Ga0207694_10002571 3300025924 Bacteria 14733
249 Ga0207694_10081246 3300025924 Bacteria 2545
250 Ga0207694_10179497 3300025924 Unclassified 1716
251 Ga0207694_10217263 3300025924 Unclassified 1558
252 Ga0207694_10787650 3300025924 Unclassified 803
253 Ga0207687_10001748 3300025927 Bacteria 14937
254 Ga0207687_10339721 3300025927 Bacteria 1221
255 Ga0207687_10880203 3300025927 Unclassified 766
256 Ga0207700_10673708 3300025928 Bacteria 923
257 Ga0207644_10006631 3300025931 Bacteria 7543
258 Ga0207644_10052549 3300025931 Unclassified 2929
259 Ga0207644_10095817 3300025931 Bacteria 2220
260 Ga0207644_10585956 3300025931 Unclassified 925
261 Ga0207644_10798663 3300025931 Unclassified 789
262 Ga0207690_10654954 3300025932 Bacteria 861
263 Ga0207706_10002621 3300025933 Bacteria 17511
264 Ga0207706_10065880 3300025933 Unclassified 3188
265 Ga0207691_10059694 3300025940 Unclassified 3467
266 Ga0207711_10003031 3300025941 Bacteria 14679
267 Ga0207711_10014748 3300025941 Bacteria 6494
268 Ga0207711_10159854 3300025941 Bacteria 2038
269 Ga0207711_10896955 3300025941 Unclassified 824
270 Ga0207689_10001421 3300025942 Bacteria 22850
271 Ga0207661_10000069 3300025944 Bacteria 70656
272 Ga0207661_10007620 3300025944 Bacteria 7700
273 Ga0207661_10166792 3300025944 Bacteria 1914
274 Ga0207661_10242974 3300025944 Bacteria 1598
275 Ga0207661_10386175 3300025944 Unclassified 1268
276 Ga0207679_10019496 3300025945 Bacteria 4557
277 Ga0207679_10026408 3300025945 Bacteria 4003
278 Ga0207679_10215880 3300025945 Unclassified 1611
279 Ga0207679_10229938 3300025945 Bacteria 1565
280 Ga0207667_10001350 3300025949 Bacteria 30798
281 Ga0207667_10011007 3300025949 Bacteria 10540
282 Ga0207667_10027188 3300025949 Bacteria 6234
283 Ga0207667_10205048 3300025949 Bacteria 2022
284 Ga0207667_10503778 3300025949 Unclassified 1228
285 Ga0207651_10319825 3300025960 Unclassified 1297
286 Ga0207668_10147007 3300025972 Bacteria 1820
287 Ga0207640_10025731 3300025981 Unclassified 3566
288 Ga0207658_10000135 3300025986 Bacteria 77651
289 Ga0207658_10545841 3300025986 Bacteria 1037
290 Ga0207677_10000034 3300026023 Bacteria 117922
291 Ga0207703_10023319 3300026035 Bacteria 4860
292 Ga0207639_10000378 3300026041 Bacteria 30715
293 Ga0207639_10003497 3300026041 Bacteria 10564
294 Ga0207639_10022170 3300026041 Bacteria 4572
295 Ga0207639_10147463 3300026041 Unclassified 1967
296 Ga0207678_10369969 3300026067 Bacteria 1238
297 Ga0207702_10000109 3300026078 Bacteria 95381
298 Ga0207702_10006915 3300026078 Bacteria 9713
299 Ga0207702_10110936 3300026078 Unclassified 2438
300 Ga0207702_10227774 3300026078 Bacteria 1740
301 Ga0207702_10363731 3300026078 Bacteria 1387
302 Ga0207702_10572635 3300026078 Bacteria 1106
303 Ga0207641_10262124 3300026088 Unclassified 1619
304 Ga0207648_10127123 3300026089 Bacteria 2242
305 Ga0207676_10003127 3300026095 Bacteria 11818
306 Ga0207676_10601766 3300026095 Bacteria 1056
307 Ga0207674_10000515 3300026116 Bacteria 50714
308 Ga0207674_10000968 3300026116 Bacteria 37588
309 Ga0207674_10021506 3300026116 Bacteria 6946
310 Ga0207674_10021919 3300026116 Bacteria 6870
311 Ga0207674_10129643 3300026116 Unclassified 2486
312 Ga0207683_10004224 3300026121 Bacteria 12408
313 Ga0207698_10000008 3300026142 Bacteria 281991
314 Ga0207698_10000127 3300026142 Bacteria 47741
315 Ga0207698_10101756 3300026142 Bacteria 2383
316 Ga0207698_10143571 3300026142 Unclassified 2060
317 Ga0207698_10340411 3300026142 Unclassified 1413
318 Ga0207698_10757643 3300026142 Unclassified 970
319 Ga0268266_10234359 3300028379 Bacteria 1692
320 Ga0268265_10452578 3300028380 Bacteria 1199
321 Ga0268264_10000669 3300028381 Bacteria 40172
322 Ga0268264_11834767 3300028381 Unclassified 616
323 Ga0265338_10054701 3300028800 Bacteria 3556
324 Ga0265338_10462850 3300028800 Unclassified 897
325 Ga0265338_10928261 3300028800 Unclassified 592
326 Ga0265324_10094313 3300029957 Bacteria 1018
327 Ga0265328_10012491 3300031239 Bacteria 3379
328 Ga0265325_10022446 3300031241 Bacteria 3457
329 Ga0265340_10100285 3300031247 Bacteria 1346
330 Ga0265339_10000023 3300031249 Bacteria 169980
331 Ga0265339_10225764 3300031249 Bacteria 914
332 Ga0265331_10040009 3300031250 Bacteria 2283
333 Ga0265316_10012619 3300031344 Bacteria 7564
334 Ga0265316_10070341 3300031344 Bacteria 2699
335 Ga0265316_10352499 3300031344 Unclassified 1065
336 Ga0265313_10095781 3300031595 Unclassified 1324
337 Ga0265314_10050048 3300031711 Bacteria 2921
338 Ga0265314_10290732 3300031711 Unclassified 920
339 Ga0265342_10001386 3300031712 Bacteria 22665
340 Ga0265342_10037539 3300031712 Bacteria 2954
341 Ga0265342_10081046 3300031712 Bacteria 1874
342 Ga0307410_10049993 3300031852 Bacteria 2809
343 Ga0307409_100088437 3300031995 Bacteria 2529
344 Ga0307416_101054011 3300032002 Bacteria 917
345 Ga0307415_100673519 3300032126 Unclassified 930
346 Ga0373955_0043974 3300035172 Bacteria 2404
347 Ga0373933_0030401 3300035724 Bacteria 3127
348 Ga0373947_0193587 3300035725 Bacteria 1328
349 Ga0373937_0002687 3300036401 Bacteria 14840
350 Ga0373937_1311563 3300036401 Unclassified 672
351 Ga0373937_1370444 3300036401 Unclassified 655
352 Ga0372808_055091 3300036459 Unclassified 570
353 Ga0373925_0719191 3300037068 Unclassified 823
354 Ga0395905_0049728 3300037471 Bacteria 3929
355 Ga0395901_0688031 3300038443 Unclassified 1022
356 Ga0451807_0579332 3300041486 Unclassified 765
357 Ga0466961_0069644 3300044693 Bacteria 2233
358 Ga0466961_0231513 3300044693 Bacteria 1137
359 Ga0466963_0008146 3300044694 Bacteria 6276
360 Ga0466963_0515878 3300044694 Unclassified 844
361 Ga0466967_0023064 3300045976 Bacteria 5094
362 Ga0495629_0040219 3300046459 Bacteria 3289
363 Ga0495629_0352329 3300046459 Bacteria 1004
364 Ga0495629_0943966 3300046459 Bacteria 564
365 Ga0495580_0097459 3300046472 Bacteria 2045
366 Ga0495580_0189260 3300046472 Bacteria 1420
367 Ga0495580_0268302 3300046472 Unclassified 1166
368 Ga0495582_0085807 3300046473 Bacteria 1752
369 Ga0495608_0425414 3300046511 Unclassified 810
370 Ga0495665_0035169 3300046531 Bacteria 2677
371 Ga0495645_0090804 3300046543 Bacteria 2182
372 Ga0495667_0227308 3300046559 Bacteria 1190
373 Ga0495599_0246660 3300046678 Unclassified 1088
374 Ga0495599_0617501 3300046678 Unclassified 630
375 Ga0495623_0257094 3300046679 Bacteria 980
376 Ga0495613_0096389 3300046689 Bacteria 2139
377 Ga0495613_0166617 3300046689 Bacteria 1565
378 Ga0495613_0325902 3300046689 Bacteria 1059
379 Ga0495581_0082779 3300047315 Bacteria 1859
380 Ga0495604_0238461 3300047317 Bacteria 1245
381 Ga0495604_0331042 3300047317 Bacteria 1016
382 Ga0495674_0391654 3300047319 Bacteria 1123
383 Ga0495684_0139561 3300047471 Bacteria 1817
384 Ga0495593_0288183 3300047673 Unclassified 821
385 Ga0496100_0102586 3300048903 Bacteria 1974
386 Ga0496100_0115408 3300048903 Bacteria 1872
387 Ga0496101_0250306 3300048904 Bacteria 1380
388 Ga0496104_0015418 3300048907 Bacteria 6921
389 Ga0496105_0017016 3300048908 Bacteria 5819
390 Ga0496105_0103449 3300048908 Bacteria 2352
391 Ga0496107_0005099 3300048910 Bacteria 8955
392 Ga0496114_0021625 3300048917 Bacteria 5235
393 Ga0496114_0386205 3300048917 Bacteria 1240
394 Ga0496115_0018297 3300048918 Bacteria 5376
395 Ga0496115_0107947 3300048918 Bacteria 2285
396 Ga0496115_0622304 3300048918 Unclassified 856
397 nmdc:mga05p37_428837_c1 3300050507 Bacteria 1536
398 Ga0495595_0170270 3300053084 Bacteria 1078

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_428837_c1 nmdc:mga05p37_428837_c1_382_822 126
2 3300005614 Ga0068856_101160662 Ga0068856_1011606621 132
3 3300013296 Ga0157374_11072377 Ga0157374_110723771 132
4 3300014969 Ga0157376_10144355 Ga0157376_101443552 132
5 3300036401 Ga0373937_1311563 Ga0373937_1311563_149_628 132
6 3300046459 Ga0495629_0040219 Ga0495629_0040219_62_541 132
7 3300046531 Ga0495665_0035169 Ga0495665_0035169_186_665 132
8 3300046689 Ga0495613_0096389 Ga0495613_0096389_64_543 132
9 3300047315 Ga0495581_0082779 Ga0495581_0082779_1341_1820 132
10 3300047673 Ga0495593_0288183 Ga0495593_0288183_65_544 132
11 3300048903 Ga0496100_0115408 Ga0496100_0115408_247_726 132
12 3300048904 Ga0496101_0250306 Ga0496101_0250306_191_670 132
13 3300048907 Ga0496104_0015418 Ga0496104_0015418_3908_4387 132
14 3300048908 Ga0496105_0017016 Ga0496105_0017016_1714_2193 132
15 3300048917 Ga0496114_0021625 Ga0496114_0021625_4560_5039 132
16 3300048918 Ga0496115_0107947 Ga0496115_0107947_1727_2206 132
17 3300046679 Ga0495623_0257094 Ga0495623_0257094_94_573 133
18 3300047317 Ga0495604_0238461 Ga0495604_0238461_252_731 133
19 3300009101 Ga0105247_10189784 Ga0105247_101897842 134
20 3300014325 Ga0163163_12967084 Ga0163163_129670841 134
21 3300048903 Ga0496100_0102586 Ga0496100_0102586_1331_1810 134
22 3300048910 Ga0496107_0005099 Ga0496107_0005099_4177_4656 134
23 3300048918 Ga0496115_0018297 Ga0496115_0018297_4518_4997 134
24 3300003320 rootH2_10257385 rootH2_102573851 135
25 3300025908 Ga0207643_10368128 Ga0207643_103681282 135
26 3300003320 rootH2_10219196 rootH2_102191962 136
27 3300005439 Ga0070711_101437335 Ga0070711_1014373351 136
28 3300006173 Ga0070716_100623085 Ga0070716_1006230852 136
29 3300013297 Ga0157378_11269427 Ga0157378_112694272 136
30 3300025906 Ga0207699_10944384 Ga0207699_109443842 136
31 3300025916 Ga0207663_11222475 Ga0207663_112224751 136
32 3300025927 Ga0207687_10339721 Ga0207687_103397211 136
33 3300035725 Ga0373947_0193587 Ga0373947_0193587_349_777 137
34 3300036459 Ga0372808_055091 Ga0372808_055091_59_526 137
35 3300037068 Ga0373925_0719191 Ga0373925_0719191_89_517 137
36 3300044693 Ga0466961_0231513 Ga0466961_0231513_523_936 137
37 3300047317 Ga0495604_0331042 Ga0495604_0331042_16_429 137
38 3300005336 Ga0070680_100328356 Ga0070680_1003283562 138
39 3300005339 Ga0070660_100914736 Ga0070660_1009147362 138
40 3300005344 Ga0070661_100022794 Ga0070661_1000227943 138
41 3300005457 Ga0070662_100250304 Ga0070662_1002503042 138
42 3300005457 Ga0070662_100347475 Ga0070662_1003474752 138
43 3300005458 Ga0070681_11074260 Ga0070681_110742601 138
44 3300005539 Ga0068853_100037487 Ga0068853_1000374874 138
45 3300005545 Ga0070695_101539666 Ga0070695_1015396661 138
46 3300005564 Ga0070664_100023289 Ga0070664_1000232895 138
47 3300005577 Ga0068857_100066068 Ga0068857_1000660682 138
48 3300005616 Ga0068852_100605779 Ga0068852_1006057792 138
49 3300005834 Ga0068851_10150188 Ga0068851_101501882 138
50 3300009176 Ga0105242_10036455 Ga0105242_100364552 138
51 3300013100 Ga0157373_10017483 Ga0157373_100174834 138
52 3300013100 Ga0157373_10083003 Ga0157373_100830032 138
53 3300013102 Ga0157371_10773954 Ga0157371_107739541 138
54 3300013104 Ga0157370_10769108 Ga0157370_107691082 138
55 3300013105 Ga0157369_10183794 Ga0157369_101837942 138
56 3300013307 Ga0157372_10035033 Ga0157372_100350335 138
57 3300013307 Ga0157372_11141849 Ga0157372_111418491 138
58 3300025321 Ga0207656_10279940 Ga0207656_102799402 138
59 3300025917 Ga0207660_10963265 Ga0207660_109632651 138
60 3300025919 Ga0207657_10717280 Ga0207657_107172802 138
61 3300025920 Ga0207649_10073452 Ga0207649_100734523 138
62 3300025921 Ga0207652_10158551 Ga0207652_101585513 138
63 3300025932 Ga0207690_10654954 Ga0207690_106549542 138
64 3300025933 Ga0207706_10065880 Ga0207706_100658803 138
65 3300025945 Ga0207679_10019496 Ga0207679_100194963 138
66 3300025945 Ga0207679_10215880 Ga0207679_102158802 138
67 3300026041 Ga0207639_10003497 Ga0207639_100034974 138
68 3300026089 Ga0207648_10127123 Ga0207648_101271232 138
69 3300026116 Ga0207674_10129643 Ga0207674_101296433 138
70 3300031711 Ga0265314_10290732 Ga0265314_102907321 138
71 3300037471 Ga0395905_0049728 Ga0395905_0049728_2057_2485 138
72 3300038443 Ga0395901_0688031 Ga0395901_0688031_266_694 138
73 3300031995 Ga0307409_100088437 Ga0307409_1000884373 139
74 3300032126 Ga0307415_100673519 Ga0307415_1006735192 139
75 3300005563 Ga0068855_101532625 Ga0068855_1015326251 140
76 3300005614 Ga0068856_100059902 Ga0068856_1000599022 141
77 3300005616 Ga0068852_100484753 Ga0068852_1004847532 141
78 3300009093 Ga0105240_10007831 Ga0105240_100078316 141
79 3300009551 Ga0105238_10114512 Ga0105238_101145122 141
80 3300013105 Ga0157369_10018222 Ga0157369_100182228 141
81 3300013307 Ga0157372_10017416 Ga0157372_100174166 141
82 3300025913 Ga0207695_10037358 Ga0207695_100373584 141
83 3300025949 Ga0207667_10027188 Ga0207667_100271881 141
84 3300026078 Ga0207702_10110936 Ga0207702_101109362 141
85 3300025901 Ga0207688_10363921 Ga0207688_103639211 142
86 3300025931 Ga0207644_10095817 Ga0207644_100958171 142
87 3300031852 Ga0307410_10049993 Ga0307410_100499934 142
88 3300032002 Ga0307416_101054011 Ga0307416_1010540111 142
89 3300035172 Ga0373955_0043974 Ga0373955_0043974_1076_1528 145
90 3300035724 Ga0373933_0030401 Ga0373933_0030401_1220_1672 145
91 3300036401 Ga0373937_0002687 Ga0373937_0002687_3472_3924 145
92 3300003320 rootH2_10266853 rootH2_102668531 147
93 3300013296 Ga0157374_10365742 Ga0157374_103657422 147
94 3300009174 Ga0105241_10949016 Ga0105241_109490162 148
95 3300028800 Ga0265338_10462850 Ga0265338_104628502 148
96 3300028800 Ga0265338_10928261 Ga0265338_109282611 148
97 3300031241 Ga0265325_10022446 Ga0265325_100224463 148
98 3300031249 Ga0265339_10225764 Ga0265339_102257642 148
99 3300031250 Ga0265331_10040009 Ga0265331_100400092 148
100 3300031595 Ga0265313_10095781 Ga0265313_100957811 148
101 3300031712 Ga0265342_10081046 Ga0265342_100810462 148
102 3300046472 Ga0495580_0097459 Ga0495580_0097459_344_823 148
103 3300046559 Ga0495667_0227308 Ga0495667_0227308_688_1167 148
104 3300046678 Ga0495599_0246660 Ga0495599_0246660_507_986 148
105 3300046689 Ga0495613_0325902 Ga0495613_0325902_340_819 148
106 3300047319 Ga0495674_0391654 Ga0495674_0391654_250_729 148
107 3300005439 Ga0070711_101030933 Ga0070711_1010309331 149
108 3300005535 Ga0070684_100003264 Ga0070684_1000032642 149
109 3300006028 Ga0070717_10213379 Ga0070717_102133792 149
110 3300006028 Ga0070717_10954948 Ga0070717_109549482 149
111 3300009177 Ga0105248_11986463 Ga0105248_119864631 149
112 3300013105 Ga0157369_10033865 Ga0157369_100338656 149
113 3300013307 Ga0157372_10551087 Ga0157372_105510872 149
114 3300025916 Ga0207663_11107817 Ga0207663_111078171 149
115 3300025928 Ga0207700_10673708 Ga0207700_106737081 149
116 3300025944 Ga0207661_10007620 Ga0207661_100076206 149
117 3300025944 Ga0207661_10386175 Ga0207661_103861752 149
118 3300025949 Ga0207667_10205048 Ga0207667_102050482 149
119 3300028800 Ga0265338_10054701 Ga0265338_100547013 149
120 3300031239 Ga0265328_10012491 Ga0265328_100124913 149
121 3300031247 Ga0265340_10100285 Ga0265340_101002852 149
122 3300031249 Ga0265339_10000023 Ga0265339_1000002337 149
123 3300031344 Ga0265316_10070341 Ga0265316_100703412 149
124 3300031712 Ga0265342_10001386 Ga0265342_100013864 149
125 3300044693 Ga0466961_0069644 Ga0466961_0069644_1343_1801 149
126 3300046459 Ga0495629_0943966 Ga0495629_0943966_47_511 149
127 3300046472 Ga0495580_0268302 Ga0495580_0268302_569_1033 149
128 3300048908 Ga0496105_0103449 Ga0496105_0103449_549_1013 149
129 3300048917 Ga0496114_0386205 Ga0496114_0386205_490_954 149
130 3300005329 Ga0070683_100141754 Ga0070683_1001417543 150
131 3300005331 Ga0070670_100071176 Ga0070670_1000711763 150
132 3300005335 Ga0070666_10010947 Ga0070666_100109473 150
133 3300005344 Ga0070661_101437920 Ga0070661_1014379201 150
134 3300005347 Ga0070668_101071381 Ga0070668_1010713811 150
135 3300005355 Ga0070671_100056214 Ga0070671_1000562143 150
136 3300005356 Ga0070674_100683323 Ga0070674_1006833232 150
137 3300005365 Ga0070688_100880252 Ga0070688_1008802521 150
138 3300005366 Ga0070659_100363466 Ga0070659_1003634662 150
139 3300005367 Ga0070667_100105275 Ga0070667_1001052752 150
140 3300005436 Ga0070713_100419319 Ga0070713_1004193192 150
141 3300005455 Ga0070663_100308521 Ga0070663_1003085212 150
142 3300005456 Ga0070678_100043179 Ga0070678_1000431793 150
143 3300005535 Ga0070684_100792061 Ga0070684_1007920612 150
144 3300005539 Ga0068853_100419038 Ga0068853_1004190381 150
145 3300005539 Ga0068853_100821791 Ga0068853_1008217912 150
146 3300005563 Ga0068855_100027394 Ga0068855_1000273946 150
147 3300005577 Ga0068857_100057690 Ga0068857_1000576902 150
148 3300005578 Ga0068854_100228394 Ga0068854_1002283943 150
149 3300005616 Ga0068852_100000032 Ga0068852_10000003231 150
150 3300005616 Ga0068852_100066156 Ga0068852_1000661562 150
151 3300005834 Ga0068851_10113383 Ga0068851_101133832 150
152 3300005841 Ga0068863_100614520 Ga0068863_1006145202 150
153 3300005843 Ga0068860_100067831 Ga0068860_1000678312 150
154 3300006358 Ga0068871_100024204 Ga0068871_1000242043 150
155 3300009093 Ga0105240_10000135 Ga0105240_1000013570 150
156 3300009093 Ga0105240_10148445 Ga0105240_101484452 150
157 3300009098 Ga0105245_10117681 Ga0105245_101176813 150
158 3300009101 Ga0105247_10168798 Ga0105247_101687982 150
159 3300009174 Ga0105241_10701537 Ga0105241_107015372 150
160 3300009545 Ga0105237_10049097 Ga0105237_100490971 150
161 3300009551 Ga0105238_10024562 Ga0105238_100245622 150
162 3300009551 Ga0105238_10913252 Ga0105238_109132522 150
163 3300009553 Ga0105249_10116360 Ga0105249_101163602 150
164 3300010375 Ga0105239_10203618 Ga0105239_102036183 150
165 3300010375 Ga0105239_10565183 Ga0105239_105651832 150
166 3300013100 Ga0157373_10082054 Ga0157373_100820541 150
167 3300013104 Ga0157370_10000023 Ga0157370_1000002361 150
168 3300013105 Ga0157369_10000010 Ga0157369_10000010138 150
169 3300013105 Ga0157369_10062471 Ga0157369_100624717 150
170 3300013105 Ga0157369_10975054 Ga0157369_109750541 150
171 3300013297 Ga0157378_10030016 Ga0157378_100300165 150
172 3300013306 Ga0163162_10409792 Ga0163162_104097921 150
173 3300013307 Ga0157372_10000055 Ga0157372_1000005573 150
174 3300013307 Ga0157372_11474194 Ga0157372_114741941 150
175 3300013308 Ga0157375_10174218 Ga0157375_101742181 150
176 3300013308 Ga0157375_11013932 Ga0157375_110139321 150
177 3300014325 Ga0163163_10136906 Ga0163163_101369062 150
178 3300014968 Ga0157379_10034921 Ga0157379_100349213 150
179 3300017792 Ga0163161_10220016 Ga0163161_102200162 150
180 3300025904 Ga0207647_10076463 Ga0207647_100764632 150
181 3300025913 Ga0207695_10000050 Ga0207695_1000005074 150
182 3300025913 Ga0207695_10109201 Ga0207695_101092012 150
183 3300025914 Ga0207671_10126615 Ga0207671_101266153 150
184 3300025924 Ga0207694_10081246 Ga0207694_100812462 150
185 3300025924 Ga0207694_10787650 Ga0207694_107876501 150
186 3300025931 Ga0207644_10585956 Ga0207644_105859562 150
187 3300025931 Ga0207644_10798663 Ga0207644_107986631 150
188 3300025933 Ga0207706_10002621 Ga0207706_100026218 150
189 3300025940 Ga0207691_10059694 Ga0207691_100596942 150
190 3300025941 Ga0207711_10896955 Ga0207711_108969552 150
191 3300025944 Ga0207661_10166792 Ga0207661_101667922 150
192 3300025949 Ga0207667_10001350 Ga0207667_1000135023 150
193 3300025960 Ga0207651_10319825 Ga0207651_103198252 150
194 3300025972 Ga0207668_10147007 Ga0207668_101470072 150
195 3300025986 Ga0207658_10545841 Ga0207658_105458412 150
196 3300026041 Ga0207639_10147463 Ga0207639_101474632 150
197 3300026067 Ga0207678_10369969 Ga0207678_103699691 150
198 3300026088 Ga0207641_10262124 Ga0207641_102621242 150
199 3300026095 Ga0207676_10601766 Ga0207676_106017662 150
200 3300026121 Ga0207683_10004224 Ga0207683_100042245 150
201 3300026142 Ga0207698_10000008 Ga0207698_10000008198 150
202 3300026142 Ga0207698_10143571 Ga0207698_101435712 150
203 3300028379 Ga0268266_10234359 Ga0268266_102343592 150
204 3300028381 Ga0268264_11834767 Ga0268264_118347671 150
205 3300031344 Ga0265316_10012619 Ga0265316_100126193 150
206 3300036401 Ga0373937_1370444 Ga0373937_1370444_79_531 150
207 3300041486 Ga0451807_0579332 Ga0451807_0579332_208_660 150
208 3300046459 Ga0495629_0352329 Ga0495629_0352329_422_874 150
209 3300046472 Ga0495580_0189260 Ga0495580_0189260_643_1095 150
210 3300046473 Ga0495582_0085807 Ga0495582_0085807_1148_1600 150
211 3300046511 Ga0495608_0425414 Ga0495608_0425414_84_536 150
212 3300046543 Ga0495645_0090804 Ga0495645_0090804_1182_1634 150
213 3300046678 Ga0495599_0617501 Ga0495599_0617501_106_558 150
214 3300046689 Ga0495613_0166617 Ga0495613_0166617_266_718 150
215 3300047471 Ga0495684_0139561 Ga0495684_0139561_739_1191 150
216 3300048918 Ga0496115_0622304 Ga0496115_0622304_71_523 150
217 3300053084 Ga0495595_0170270 Ga0495595_0170270_331_783 150
218 3300025927 Ga0207687_10880203 Ga0207687_108802031 152
219 3300025941 Ga0207711_10014748 Ga0207711_100147485 152
220 3300031344 Ga0265316_10352499 Ga0265316_103524992 152
221 3300031712 Ga0265342_10037539 Ga0265342_100375392 152
222 3300044694 Ga0466963_0515878 Ga0466963_0515878_296_766 153
223 3300009174 Ga0105241_10000041 Ga0105241_1000004138 154
224 3300013105 Ga0157369_10037210 Ga0157369_100372104 154
225 3300025911 Ga0207654_10000094 Ga0207654_1000009416 154
226 3300029957 Ga0265324_10094313 Ga0265324_100943132 154
227 3300031711 Ga0265314_10050048 Ga0265314_100500483 154
228 3300044694 Ga0466963_0008146 Ga0466963_0008146_5769_6242 154
229 3300045976 Ga0466967_0023064 Ga0466967_0023064_4125_4598 154
230 3300003323 rootH1_10153212 rootH1_101532126 155
231 3300005329 Ga0070683_100325307 Ga0070683_1003253071 155
232 3300005337 Ga0070682_100655873 Ga0070682_1006558731 155
233 3300005344 Ga0070661_100013224 Ga0070661_1000132244 155
234 3300005344 Ga0070661_100897893 Ga0070661_1008978932 155
235 3300005355 Ga0070671_100069786 Ga0070671_1000697864 155
236 3300005436 Ga0070713_100536036 Ga0070713_1005360361 155
237 3300005535 Ga0070684_100139466 Ga0070684_1001394662 155
238 3300005539 Ga0068853_100000052 Ga0068853_10000005232 155
239 3300005548 Ga0070665_100003053 Ga0070665_1000030539 155
240 3300005563 Ga0068855_100007110 Ga0068855_10000711011 155
241 3300005563 Ga0068855_100068712 Ga0068855_1000687122 155
242 3300005563 Ga0068855_101162694 Ga0068855_1011626941 155
243 3300005564 Ga0070664_100064917 Ga0070664_1000649172 155
244 3300005577 Ga0068857_100000042 Ga0068857_10000004262 155
245 3300005577 Ga0068857_100014308 Ga0068857_1000143087 155
246 3300005577 Ga0068857_100284845 Ga0068857_1002848452 155
247 3300005578 Ga0068854_100035207 Ga0068854_1000352072 155
248 3300005578 Ga0068854_100061223 Ga0068854_1000612232 155
249 3300005614 Ga0068856_100009638 Ga0068856_1000096389 155
250 3300005614 Ga0068856_100013280 Ga0068856_1000132805 155
251 3300005614 Ga0068856_100029327 Ga0068856_1000293274 155
252 3300005614 Ga0068856_100070490 Ga0068856_1000704905 155
253 3300005616 Ga0068852_100000319 Ga0068852_10000031919 155
254 3300005616 Ga0068852_100078121 Ga0068852_1000781212 155
255 3300005616 Ga0068852_100479980 Ga0068852_1004799802 155
256 3300005616 Ga0068852_100656015 Ga0068852_1006560152 155
257 3300005617 Ga0068859_100564340 Ga0068859_1005643401 155
258 3300005834 Ga0068851_10004917 Ga0068851_100049171 155
259 3300005834 Ga0068851_10122165 Ga0068851_101221652 155
260 3300005834 Ga0068851_10454785 Ga0068851_104547851 155
261 3300006358 Ga0068871_100060830 Ga0068871_1000608305 155
262 3300006931 Ga0097620_100564343 Ga0097620_1005643431 155
263 3300009093 Ga0105240_10001555 Ga0105240_1000155524 155
264 3300009093 Ga0105240_10003376 Ga0105240_1000337618 155
265 3300009093 Ga0105240_10003845 Ga0105240_1000384517 155
266 3300009093 Ga0105240_10005717 Ga0105240_1000571717 155
267 3300009098 Ga0105245_10571107 Ga0105245_105711072 155
268 3300009101 Ga0105247_10041700 Ga0105247_100417002 155
269 3300009174 Ga0105241_10000174 Ga0105241_1000017417 155
270 3300009174 Ga0105241_10030172 Ga0105241_100301724 155
271 3300009174 Ga0105241_10104042 Ga0105241_101040422 155
272 3300009174 Ga0105241_11004764 Ga0105241_110047641 155
273 3300009177 Ga0105248_10000904 Ga0105248_1000090430 155
274 3300009545 Ga0105237_10002009 Ga0105237_100020092 155
275 3300009545 Ga0105237_11052476 Ga0105237_110524762 155
276 3300009545 Ga0105237_11337185 Ga0105237_113371851 155
277 3300009551 Ga0105238_10000386 Ga0105238_1000038617 155
278 3300009551 Ga0105238_10002740 Ga0105238_100027404 155
279 3300009551 Ga0105238_10063555 Ga0105238_100635552 155
280 3300009551 Ga0105238_10155777 Ga0105238_101557775 155
281 3300010375 Ga0105239_10000673 Ga0105239_1000067325 155
282 3300010375 Ga0105239_10000909 Ga0105239_1000090917 155
283 3300010375 Ga0105239_10059851 Ga0105239_100598516 155
284 3300010375 Ga0105239_10437623 Ga0105239_104376232 155
285 3300010375 Ga0105239_12544599 Ga0105239_125445991 155
286 3300011119 Ga0105246_10223828 Ga0105246_102238282 155
287 3300013100 Ga0157373_10029977 Ga0157373_100299775 155
288 3300013104 Ga0157370_10076421 Ga0157370_100764211 155
289 3300013104 Ga0157370_10275163 Ga0157370_102751632 155
290 3300013105 Ga0157369_10001424 Ga0157369_1000142425 155
291 3300013105 Ga0157369_10091881 Ga0157369_100918815 155
292 3300013105 Ga0157369_10236959 Ga0157369_102369591 155
293 3300013296 Ga0157374_10008343 Ga0157374_100083439 155
294 3300013297 Ga0157378_10004570 Ga0157378_100045704 155
295 3300013297 Ga0157378_10428753 Ga0157378_104287532 155
296 3300013306 Ga0163162_10055045 Ga0163162_100550453 155
297 3300013307 Ga0157372_10001858 Ga0157372_1000185821 155
298 3300013307 Ga0157372_10060647 Ga0157372_100606476 155
299 3300013307 Ga0157372_10343411 Ga0157372_103434112 155
300 3300013307 Ga0157372_10505817 Ga0157372_105058172 155
301 3300025321 Ga0207656_10071353 Ga0207656_100713532 155
302 3300025911 Ga0207654_10000100 Ga0207654_1000010019 155
303 3300025911 Ga0207654_10095402 Ga0207654_100954022 155
304 3300025911 Ga0207654_10188667 Ga0207654_101886672 155
305 3300025913 Ga0207695_10000293 Ga0207695_1000029333 155
306 3300025913 Ga0207695_10000930 Ga0207695_1000093017 155
307 3300025913 Ga0207695_10014333 Ga0207695_100143333 155
308 3300025913 Ga0207695_10131301 Ga0207695_101313013 155
309 3300025914 Ga0207671_10000562 Ga0207671_1000056218 155
310 3300025920 Ga0207649_10009397 Ga0207649_100093977 155
311 3300025924 Ga0207694_10000243 Ga0207694_1000024329 155
312 3300025924 Ga0207694_10002571 Ga0207694_1000257111 155
313 3300025924 Ga0207694_10179497 Ga0207694_101794971 155
314 3300025924 Ga0207694_10217263 Ga0207694_102172632 155
315 3300025931 Ga0207644_10052549 Ga0207644_100525494 155
316 3300025941 Ga0207711_10003031 Ga0207711_1000303113 155
317 3300025944 Ga0207661_10242974 Ga0207661_102429742 155
318 3300025945 Ga0207679_10229938 Ga0207679_102299381 155
319 3300025949 Ga0207667_10011007 Ga0207667_100110074 155
320 3300025949 Ga0207667_10503778 Ga0207667_105037782 155
321 3300025981 Ga0207640_10025731 Ga0207640_100257312 155
322 3300026041 Ga0207639_10000378 Ga0207639_100003784 155
323 3300026078 Ga0207702_10006915 Ga0207702_1000691512 155
324 3300026078 Ga0207702_10227774 Ga0207702_102277741 155
325 3300026078 Ga0207702_10363731 Ga0207702_103637312 155
326 3300026078 Ga0207702_10572635 Ga0207702_105726352 155
327 3300026116 Ga0207674_10000515 Ga0207674_1000051511 155
328 3300026116 Ga0207674_10021506 Ga0207674_100215062 155
329 3300026116 Ga0207674_10021919 Ga0207674_100219196 155
330 3300026142 Ga0207698_10000127 Ga0207698_1000012725 155
331 3300026142 Ga0207698_10101756 Ga0207698_101017562 155
332 3300026142 Ga0207698_10340411 Ga0207698_103404111 155
333 3300026142 Ga0207698_10757643 Ga0207698_107576432 155
334 3300001991 JGI24743J22301_10039416 JGI24743J22301_100394162 158
335 3300005327 Ga0070658_10627441 Ga0070658_106274412 158
336 3300005329 Ga0070683_100000097 Ga0070683_10000009743 158
337 3300005334 Ga0068869_100000207 Ga0068869_1000002078 158
338 3300005338 Ga0068868_100000210 Ga0068868_10000021016 158
339 3300005355 Ga0070671_100002109 Ga0070671_10000210911 158
340 3300005367 Ga0070667_100000592 Ga0070667_10000059214 158
341 3300005535 Ga0070684_100000031 Ga0070684_10000003130 158
342 3300005539 Ga0068853_100023546 Ga0068853_1000235462 158
343 3300005564 Ga0070664_100137916 Ga0070664_1001379163 158
344 3300005577 Ga0068857_100000269 Ga0068857_1000002691 158
345 3300005614 Ga0068856_100011532 Ga0068856_1000115328 158
346 3300005616 Ga0068852_100009904 Ga0068852_1000099048 158
347 3300005617 Ga0068859_100004094 Ga0068859_10000409413 158
348 3300005618 Ga0068864_100001547 Ga0068864_1000015474 158
349 3300005834 Ga0068851_10085075 Ga0068851_100850752 158
350 3300005841 Ga0068863_100000273 Ga0068863_10000027336 158
351 3300005842 Ga0068858_100296753 Ga0068858_1002967532 158
352 3300005843 Ga0068860_100000031 Ga0068860_10000003143 158
353 3300005844 Ga0068862_100113633 Ga0068862_1001136332 158
354 3300006237 Ga0097621_100000523 Ga0097621_10000052324 158
355 3300006358 Ga0068871_100000584 Ga0068871_1000005848 158
356 3300006931 Ga0097620_100004094 Ga0097620_10000409413 158
357 3300009093 Ga0105240_10000451 Ga0105240_1000045142 158
358 3300009098 Ga0105245_10001460 Ga0105245_1000146013 158
359 3300009101 Ga0105247_10004824 Ga0105247_100048241 158
360 3300009174 Ga0105241_10000987 Ga0105241_1000098713 158
361 3300009177 Ga0105248_10035674 Ga0105248_100356744 158
362 3300009545 Ga0105237_10004127 Ga0105237_100041278 158
363 3300009551 Ga0105238_10000334 Ga0105238_1000033433 158
364 3300010375 Ga0105239_10001496 Ga0105239_1000149623 158
365 3300010375 Ga0105239_10281101 Ga0105239_102811012 158
366 3300011119 Ga0105246_10000497 Ga0105246_1000049713 158
367 3300013105 Ga0157369_10084121 Ga0157369_100841212 158
368 3300013296 Ga0157374_10020079 Ga0157374_100200792 158
369 3300013296 Ga0157374_10043969 Ga0157374_100439693 158
370 3300013297 Ga0157378_10005341 Ga0157378_100053414 158
371 3300013306 Ga0163162_10043302 Ga0163162_100433022 158
372 3300013308 Ga0157375_10002348 Ga0157375_100023487 158
373 3300014325 Ga0163163_10000427 Ga0163163_1000042724 158
374 3300014968 Ga0157379_10000330 Ga0157379_1000033018 158
375 3300014968 Ga0157379_10542504 Ga0157379_105425041 158
376 3300014969 Ga0157376_10002011 Ga0157376_1000201110 158
377 3300025321 Ga0207656_10013820 Ga0207656_100138206 158
378 3300025900 Ga0207710_10000798 Ga0207710_100007986 158
379 3300025909 Ga0207705_10480867 Ga0207705_104808672 158
380 3300025911 Ga0207654_10000608 Ga0207654_1000060817 158
381 3300025913 Ga0207695_10000075 Ga0207695_10000075217 158
382 3300025914 Ga0207671_10001031 Ga0207671_1000103126 158
383 3300025924 Ga0207694_10000024 Ga0207694_1000002428 158
384 3300025927 Ga0207687_10001748 Ga0207687_100017482 158
385 3300025931 Ga0207644_10006631 Ga0207644_100066316 158
386 3300025941 Ga0207711_10159854 Ga0207711_101598542 158
387 3300025942 Ga0207689_10001421 Ga0207689_100014216 158
388 3300025944 Ga0207661_10000069 Ga0207661_1000006948 158
389 3300025945 Ga0207679_10026408 Ga0207679_100264086 158
390 3300025986 Ga0207658_10000135 Ga0207658_1000013576 158
391 3300026023 Ga0207677_10000034 Ga0207677_1000003487 158
392 3300026035 Ga0207703_10023319 Ga0207703_100233196 158
393 3300026041 Ga0207639_10022170 Ga0207639_100221702 158
394 3300026078 Ga0207702_10000109 Ga0207702_1000010978 158
395 3300026095 Ga0207676_10003127 Ga0207676_1000312711 158
396 3300026116 Ga0207674_10000968 Ga0207674_100009684 158
397 3300028380 Ga0268265_10452578 Ga0268265_104525781 158
398 3300028381 Ga0268264_10000669 Ga0268264_100006694 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

41

157

0.86

PF13474

SnoaL_3

SnoaL-like domain

41

163

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b7c-assembly1.cif.gz_A-2 crystal structure of a ntf-2 like protein of unknown function (so_0125) from shewanella oneidensis mr-1 at 1.70 a resolution 0.9262 33 158
3b7c-assembly1.cif.gz_A-2 crystal structure of a ntf-2 like protein of unknown function (so_0125) from shewanella oneidensis mr-1 at 1.70 a resolution 0.8968 33 158
6d63-assembly4.cif.gz_G the structure of atzh: a little known member of the atrazine breakdown pathway 0.8245 31 158
6d63-assembly5.cif.gz_I the structure of atzh: a little known member of the atrazine breakdown pathway 0.8167 31 158
6d63-assembly3.cif.gz_E the structure of atzh: a little known member of the atrazine breakdown pathway 0.8158 31 158
ID Description Score Start End Superfamily
3b7cA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9146 33 158 3.10.450.50
3b7cA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8919 33 158 3.10.450.50
af_A0A078BPG0_5_119_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8246 34 158 3.10.450.50
6d63G00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8245 31 158 3.10.450.50
af_F4IZV9_103_223_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8204 31 154 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A372IM16-F1-model_v4 Nuclear transport factor 2 family protein 0.9581 29 157
AF-I4VWC2-F1-model_v4 DUF4440 domain-containing protein 0.9487 18 158
AF-A0A370K9B0-F1-model_v4 Nuclear transport factor 2 family protein 0.9455 16 158
AF-A0A7X2TUZ3-F1-model_v4 DUF4440 domain-containing protein 0.9176 21 157
AF-A0A7D7X682-F1-model_v4 DUF4440 domain-containing protein 0.9141 20 157

Feature Viewer

pLDDT pTM Quality
86.09 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map