F434053

General Info

Members Datasets Scaffolds Average Seq Length
398 234 397 145

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10007796|Ga0207699_100077962
Length 174
Sequence MEIGSVPSVPGFTFVLHHEQPVKWEIPVYMNVQEQIKEYIASQPEPKRSNMQELHRLTLQVLPGCKLWFHDGKDSKGHTVSNPNIGYGSHTIRYASGKTREFYQIGMSANTTGISVYILGLKDKTYLAKTYRKKLGKASVTGYCIKFKTLKDINIDVLEGAIRHGFEASSKTVS

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
176 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
177 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
225 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
226 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
231 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
232 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
233 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.03
Nodule 0
Rhizoplane 1.51
Rhizosphere 90.7
Stem 0
Stem Tuber 0
Unclassified 2.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1000870 3300002741 Bacteria 14626
2 JGI25406J46586_10003469 3300003203 Bacteria 7412
3 rootL2_10014031 3300003322 Bacteria 7760
4 JGI25405J52794_10022187 3300003911 Bacteria 1287
5 Ga0065714_10071504 3300005288 Bacteria 3556
6 Ga0065714_10092403 3300005288 Bacteria 1878
7 Ga0065704_10511686 3300005289 Bacteria 612
8 Ga0065712_10007470 3300005290 Bacteria 3089
9 Ga0065712_10145195 3300005290 Unclassified 1415
10 Ga0065712_10396412 3300005290 Bacteria 736
11 Ga0065715_10076199 3300005293 Bacteria 595
12 Ga0065715_10123969 3300005293 Bacteria 2154
13 Ga0070683_100284881 3300005329 Bacteria 1572
14 Ga0070683_100734894 3300005329 Bacteria 945
15 Ga0070690_100031003 3300005330 Bacteria 3327
16 Ga0070690_100142351 3300005330 Bacteria 1629
17 Ga0070690_100249006 3300005330 Bacteria 1256
18 Ga0070677_10195924 3300005333 Bacteria 972
19 Ga0068869_100609992 3300005334 Bacteria 923
20 Ga0070666_10053260 3300005335 Bacteria 2729
21 Ga0070680_100378126 3300005336 Bacteria 1206
22 Ga0070680_100988228 3300005336 Bacteria 727
23 Ga0070682_100475382 3300005337 Bacteria 963
24 Ga0068868_100412909 3300005338 Bacteria 1167
25 Ga0070660_100351470 3300005339 Bacteria 1214
26 Ga0070689_100202222 3300005340 Bacteria 1622
27 Ga0070689_100289176 3300005340 Bacteria 1361
28 Ga0070689_101710379 3300005340 Bacteria 572
29 Ga0070661_100001575 3300005344 Bacteria 15817
30 Ga0070668_100215886 3300005347 Bacteria 1580
31 Ga0070669_100278803 3300005353 Bacteria 1339
32 Ga0070675_100027986 3300005354 Bacteria 4532
33 Ga0070675_100185352 3300005354 Bacteria 1801
34 Ga0070675_100264364 3300005354 Bacteria 1508
35 Ga0070673_100079681 3300005364 Bacteria 2652
36 Ga0070673_100816646 3300005364 Bacteria 862
37 Ga0070673_101067731 3300005364 Bacteria 754
38 Ga0070673_101070441 3300005364 Bacteria 753
39 Ga0070688_100036385 3300005365 Bacteria 2994
40 Ga0070688_100138252 3300005365 Bacteria 1652
41 Ga0070688_100797098 3300005365 Bacteria 738
42 Ga0070659_101051070 3300005366 Bacteria 716
43 Ga0070667_100044210 3300005367 Bacteria 3739
44 Ga0070667_100117111 3300005367 Bacteria 2314
45 Ga0070667_100200409 3300005367 Bacteria 1771
46 Ga0070667_100204519 3300005367 Bacteria 1753
47 Ga0070667_100410363 3300005367 Bacteria 1234
48 Ga0070709_10013523 3300005434 Bacteria 4592
49 Ga0070709_10235279 3300005434 Bacteria 1313
50 Ga0070714_100448146 3300005435 Bacteria 1226
51 Ga0070701_10085013 3300005438 Bacteria 1722
52 Ga0070705_100877394 3300005440 Bacteria 720
53 Ga0070678_101330320 3300005456 Bacteria 669
54 Ga0070662_100001104 3300005457 Bacteria 16452
55 Ga0070662_100061435 3300005457 Bacteria 2743
56 Ga0070681_10247459 3300005458 Bacteria 1696
57 Ga0068867_100043892 3300005459 Bacteria 3273
58 Ga0068867_100231219 3300005459 Bacteria 1495
59 Ga0070685_10005193 3300005466 Bacteria 6601
60 Ga0070685_10033538 3300005466 Bacteria 2886
61 Ga0070685_10358074 3300005466 Bacteria 999
62 Ga0070685_10448084 3300005466 Bacteria 904
63 Ga0070685_10936539 3300005466 Bacteria 647
64 Ga0070706_101449445 3300005467 Bacteria 628
65 Ga0070698_100000061 3300005471 Bacteria 78637
66 Ga0070698_100003096 3300005471 Bacteria 18338
67 Ga0070684_100021664 3300005535 Bacteria 5353
68 Ga0068853_100001770 3300005539 Bacteria 15876
69 Ga0068853_100045747 3300005539 Bacteria 3750
70 Ga0068853_100488905 3300005539 Bacteria 1161
71 Ga0068853_100876221 3300005539 Bacteria 862
72 Ga0070672_100120680 3300005543 Bacteria 2145
73 Ga0070672_100223460 3300005543 Bacteria 1580
74 Ga0070672_100270464 3300005543 Bacteria 1435
75 Ga0070672_100405153 3300005543 Bacteria 1169
76 Ga0070686_100009483 3300005544 Bacteria 5473
77 Ga0070695_100514760 3300005545 Bacteria 927
78 Ga0070693_100094283 3300005547 Bacteria 1811
79 Ga0070693_100182343 3300005547 Bacteria 1352
80 Ga0070665_100489538 3300005548 Bacteria 1241
81 Ga0070704_100182066 3300005549 Bacteria 1681
82 Ga0070704_101185231 3300005549 Bacteria 696
83 Ga0068855_100110197 3300005563 Bacteria 3160
84 Ga0068855_100571388 3300005563 Bacteria 1222
85 Ga0070664_100204154 3300005564 Bacteria 1764
86 Ga0068857_100049348 3300005577 Bacteria 3734
87 Ga0068854_100097800 3300005578 Bacteria 2195
88 Ga0068854_101233593 3300005578 Bacteria 671
89 Ga0068856_100011656 3300005614 Bacteria 8528
90 Ga0068856_100083934 3300005614 Bacteria 3164
91 Ga0068856_100918966 3300005614 Bacteria 894
92 Ga0068852_100074222 3300005616 Bacteria 2995
93 Ga0068852_100171397 3300005616 Bacteria 2035
94 Ga0068852_100486698 3300005616 Bacteria 1227
95 Ga0068859_100103841 3300005617 Bacteria 2900
96 Ga0068859_100941143 3300005617 Bacteria 948
97 Ga0068864_100073460 3300005618 Unclassified 2982
98 Ga0068864_100096861 3300005618 Bacteria 2611
99 Ga0068864_100320150 3300005618 Bacteria 1456
100 Ga0068864_100614936 3300005618 Bacteria 1055
101 Ga0068866_10188136 3300005718 Bacteria 1225
102 Ga0068861_100964673 3300005719 Bacteria 812
103 Ga0068870_10178881 3300005840 Bacteria 1272
104 Ga0068863_100041998 3300005841 Unclassified 4346
105 Ga0068863_100102124 3300005841 Bacteria 2726
106 Ga0068863_100176002 3300005841 Bacteria 2054
107 Ga0068863_101429110 3300005841 Bacteria 700
108 Ga0068858_100688736 3300005842 Bacteria 994
109 Ga0068858_100747767 3300005842 Bacteria 953
110 Ga0068860_100009610 3300005843 Bacteria 9610
111 Ga0068860_101078359 3300005843 Bacteria 822
112 Ga0068860_101513815 3300005843 Bacteria 693
113 Ga0068862_100168486 3300005844 Bacteria 1959
114 Ga0068862_100236643 3300005844 Bacteria 1658
115 Ga0068862_100571400 3300005844 Bacteria 1082
116 Ga0068862_100778795 3300005844 Bacteria 933
117 Ga0081455_10090268 3300005937 Bacteria 2485
118 Ga0081540_1116297 3300005983 Bacteria 1119
119 Ga0081539_10000345 3300005985 Bacteria 102083
120 Ga0070717_11048258 3300006028 Bacteria 743
121 Ga0075365_10043076 3300006038 Bacteria 2954
122 Ga0075364_10005700 3300006051 Bacteria 7263
123 Ga0075366_10001232 3300006195 Bacteria 12699
124 Ga0075366_10099807 3300006195 Bacteria 1742
125 Ga0097621_100006899 3300006237 Bacteria 8081
126 Ga0097621_100141137 3300006237 Bacteria 2058
127 Ga0097621_100682396 3300006237 Bacteria 944
128 Ga0068871_100037551 3300006358 Bacteria 3864
129 Ga0068871_100136536 3300006358 Bacteria 2083
130 Ga0068871_100252427 3300006358 Bacteria 1536
131 Ga0068871_100347499 3300006358 Bacteria 1311
132 Ga0068871_100394385 3300006358 Bacteria 1232
133 Ga0075428_100090426 3300006844 Bacteria 3339
134 Ga0075428_100876751 3300006844 Bacteria 952
135 Ga0075430_100006345 3300006846 Bacteria 9974
136 Ga0075431_100105332 3300006847 Bacteria 2910
137 Ga0075431_100528399 3300006847 Bacteria 1168
138 Ga0075433_10068011 3300006852 Bacteria 3126
139 Ga0075434_100717691 3300006871 Bacteria 1017
140 Ga0075429_100010254 3300006880 Bacteria 8110
141 Ga0075429_100328773 3300006880 Bacteria 1338
142 Ga0068865_100016915 3300006881 Bacteria 4679
143 Ga0068865_100105410 3300006881 Bacteria 2071
144 Ga0068865_100164549 3300006881 Bacteria 1695
145 Ga0097620_100103839 3300006931 Bacteria 2900
146 Ga0097620_100941183 3300006931 Bacteria 948
147 Ga0105240_10006255 3300009093 Bacteria 17514
148 Ga0105240_10055504 3300009093 Unclassified 4959
149 Ga0105240_10772102 3300009093 Unclassified 1043
150 Ga0111539_10482628 3300009094 Bacteria 1444
151 Ga0105245_10679598 3300009098 Bacteria 1061
152 Ga0105247_10275285 3300009101 Bacteria 1159
153 Ga0105247_10980314 3300009101 Bacteria 659
154 Ga0105243_10463231 3300009148 Bacteria 1192
155 Ga0105241_11483066 3300009174 Bacteria 652
156 Ga0105242_10066940 3300009176 Bacteria 2968
157 Ga0105242_10232512 3300009176 Bacteria 1653
158 Ga0105242_11401046 3300009176 Bacteria 726
159 Ga0105237_10003970 3300009545 Bacteria 17302
160 Ga0105238_11703809 3300009551 Bacteria 661
161 Ga0105249_10024400 3300009553 Bacteria 5434
162 Ga0105249_10029039 3300009553 Bacteria 4994
163 Ga0105249_10089376 3300009553 Bacteria 2879
164 Ga0105249_10808876 3300009553 Bacteria 1001
165 Ga0105249_11544834 3300009553 Bacteria 736
166 Ga0105249_11877640 3300009553 Bacteria 672
167 Ga0105239_10000142 3300010375 Bacteria 101628
168 Ga0105239_10246983 3300010375 Bacteria 2004
169 Ga0105239_10286441 3300010375 Bacteria 1855
170 Ga0105246_10211885 3300011119 Bacteria 1513
171 Ga0157321_1005899 3300012487 Unclassified 818
172 Ga0157373_10079301 3300013100 Bacteria 2316
173 Ga0157373_10111261 3300013100 Bacteria 1925
174 Ga0157371_10633433 3300013102 Bacteria 797
175 Ga0157369_11296461 3300013105 Bacteria 742
176 Ga0157374_10112517 3300013296 Bacteria 2619
177 Ga0157374_10276895 3300013296 Bacteria 1656
178 Ga0157374_10505396 3300013296 Bacteria 1213
179 Ga0157374_10715696 3300013296 Bacteria 1015
180 Ga0157378_10005675 3300013297 Bacteria 10919
181 Ga0157378_10044490 3300013297 Bacteria 3943
182 Ga0157378_10327423 3300013297 Bacteria 1490
183 Ga0157378_10441024 3300013297 Bacteria 1291
184 Ga0157378_11400606 3300013297 Bacteria 742
185 Ga0163162_10057844 3300013306 Bacteria 3905
186 Ga0163162_10102589 3300013306 Bacteria 2954
187 Ga0163162_10137676 3300013306 Bacteria 2553
188 Ga0163162_10603117 3300013306 Bacteria 1224
189 Ga0157372_10020339 3300013307 Bacteria 7160
190 Ga0157372_10298717 3300013307 Bacteria 1873
191 Ga0157372_10372072 3300013307 Bacteria 1665
192 Ga0157372_11539273 3300013307 Bacteria 766
193 Ga0157375_10001560 3300013308 Bacteria 19726
194 Ga0157375_10002645 3300013308 Bacteria 15517
195 Ga0157375_10005935 3300013308 Bacteria 10644
196 Ga0157375_10112012 3300013308 Bacteria 2828
197 Ga0157375_10157998 3300013308 Bacteria 2407
198 Ga0157375_10661456 3300013308 Bacteria 1200
199 Ga0157375_11410810 3300013308 Bacteria 821
200 Ga0157375_11520796 3300013308 Bacteria 790
201 Ga0157375_12215856 3300013308 Bacteria 655
202 Ga0157375_12543315 3300013308 Bacteria 611
203 Ga0163163_11303986 3300014325 Bacteria 788
204 Ga0163163_11488025 3300014325 Bacteria 738
205 Ga0157380_10094623 3300014326 Bacteria 2473
206 Ga0157380_10199833 3300014326 Bacteria 1773
207 Ga0157380_10451825 3300014326 Bacteria 1234
208 Ga0157377_10086610 3300014745 Bacteria 1841
209 Ga0157379_10080137 3300014968 Bacteria 2925
210 Ga0157376_10421317 3300014969 Bacteria 1296
211 Ga0157376_10451864 3300014969 Bacteria 1253
212 Ga0157376_10538146 3300014969 Bacteria 1154
213 Ga0163161_10040981 3300017792 Bacteria 3327
214 Ga0163161_10266362 3300017792 Bacteria 1339
215 Ga0163161_11625343 3300017792 Bacteria 570
216 Ga0213876_10002163 3300021384 Bacteria 11619
217 Ga0207672_1007189 3300025223 Bacteria 647
218 Ga0209674_100457 3300025226 Bacteria 18594
219 Ga0209258_117488 3300025242 Bacteria 786
220 Ga0209026_1000090 3300025250 Bacteria 172829
221 Ga0209759_1013062 3300025256 Bacteria 2266
222 Ga0207682_10384630 3300025893 Bacteria 663
223 Ga0207688_10674730 3300025901 Bacteria 653
224 Ga0207699_10007796 3300025906 Bacteria 5246
225 Ga0207643_10036046 3300025908 Bacteria 2774
226 Ga0207707_10048146 3300025912 Bacteria 3713
227 Ga0207695_10012635 3300025913 Bacteria 10115
228 Ga0207695_10039899 3300025913 Bacteria 5042
229 Ga0207695_10593039 3300025913 Unclassified 989
230 Ga0207693_10926572 3300025915 Bacteria 668
231 Ga0207657_10332079 3300025919 Bacteria 1201
232 Ga0207649_10006218 3300025920 Bacteria 6484
233 Ga0207681_10752613 3300025923 Bacteria 812
234 Ga0207650_11056724 3300025925 Bacteria 691
235 Ga0207659_10093884 3300025926 Bacteria 2247
236 Ga0207659_10292481 3300025926 Bacteria 1335
237 Ga0207659_10625071 3300025926 Bacteria 919
238 Ga0207659_10977709 3300025926 Bacteria 728
239 Ga0207644_10108948 3300025931 Bacteria 2092
240 Ga0207644_10372718 3300025931 Bacteria 1163
241 Ga0207690_10209033 3300025932 Bacteria 1487
242 Ga0207706_10001112 3300025933 Bacteria 27374
243 Ga0207706_10096937 3300025933 Bacteria 2593
244 Ga0207686_10000793 3300025934 Bacteria 19399
245 Ga0207686_10431727 3300025934 Bacteria 1010
246 Ga0207686_11233629 3300025934 Bacteria 613
247 Ga0207670_10082266 3300025936 Bacteria 2256
248 Ga0207670_10481435 3300025936 Bacteria 1005
249 Ga0207670_10543863 3300025936 Bacteria 948
250 Ga0207669_10059912 3300025937 Bacteria 2331
251 Ga0207704_10044522 3300025938 Bacteria 2630
252 Ga0207704_10125611 3300025938 Bacteria 1766
253 Ga0207691_10041540 3300025940 Bacteria 4245
254 Ga0207691_10047317 3300025940 Bacteria 3947
255 Ga0207711_10023809 3300025941 Bacteria 5126
256 Ga0207711_10201266 3300025941 Bacteria 1817
257 Ga0207689_10653725 3300025942 Bacteria 886
258 Ga0207679_10044094 3300025945 Bacteria 3216
259 Ga0207679_10265907 3300025945 Bacteria 1465
260 Ga0207667_10576266 3300025949 Bacteria 1136
261 Ga0207651_10230684 3300025960 Bacteria 1503
262 Ga0207651_10576228 3300025960 Bacteria 981
263 Ga0207712_10038242 3300025961 Bacteria 3280
264 Ga0207712_10051779 3300025961 Bacteria 2873
265 Ga0207712_10259975 3300025961 Bacteria 1407
266 Ga0207712_11840778 3300025961 Bacteria 542
267 Ga0207668_10287604 3300025972 Bacteria 1351
268 Ga0207640_10405862 3300025981 Bacteria 1111
269 Ga0207658_10147678 3300025986 Bacteria 1911
270 Ga0207658_10264586 3300025986 Unclassified 1467
271 Ga0207703_10029684 3300026035 Bacteria 4316
272 Ga0207703_10309572 3300026035 Bacteria 1443
273 Ga0207703_11017360 3300026035 Bacteria 795
274 Ga0207639_10020930 3300026041 Bacteria 4692
275 Ga0207639_10055215 3300026041 Bacteria 3039
276 Ga0207639_10141435 3300026041 Bacteria 2005
277 Ga0207639_10428411 3300026041 Bacteria 1197
278 Ga0207708_10419945 3300026075 Bacteria 1109
279 Ga0207708_10919164 3300026075 Bacteria 758
280 Ga0207708_11620143 3300026075 Bacteria 569
281 Ga0207702_10172335 3300026078 Bacteria 1985
282 Ga0207702_11548735 3300026078 Bacteria 656
283 Ga0207641_10018275 3300026088 Bacteria 5746
284 Ga0207641_10099023 3300026088 Unclassified 2564
285 Ga0207641_10227265 3300026088 Bacteria 1733
286 Ga0207641_11714827 3300026088 Bacteria 630
287 Ga0207648_10336410 3300026089 Bacteria 1359
288 Ga0207676_10072759 3300026095 Bacteria 2764
289 Ga0207676_10080641 3300026095 Bacteria 2642
290 Ga0207674_10034538 3300026116 Bacteria 5284
291 Ga0207674_10193260 3300026116 Bacteria 1985
292 Ga0207698_10544916 3300026142 Bacteria 1136
293 Ga0207698_12022064 3300026142 Bacteria 590
294 Ga0209969_1037992 3300027360 Bacteria 745
295 Ga0209967_1051670 3300027364 Bacteria 632
296 Ga0209995_1022652 3300027471 Bacteria 1043
297 Ga0209968_1000820 3300027526 Bacteria 4821
298 Ga0210002_1002403 3300027617 Bacteria 2699
299 Ga0209974_10006839 3300027876 Bacteria 3957
300 Ga0268264_10034334 3300028381 Bacteria 4172
301 Ga0268264_11030417 3300028381 Bacteria 830
302 Ga0307515_10000684 3300028794 Bacteria 78055
303 Ga0307515_10000790 3300028794 Bacteria 72891
304 Ga0307515_10578776 3300028794 Bacteria 733
305 Ga0265338_10005369 3300028800 Bacteria 16754
306 Ga0265338_10044535 3300028800 Bacteria 4096
307 Ga0265325_10000050 3300031241 Bacteria 80443
308 Ga0265339_10007701 3300031249 Bacteria 6928
309 Ga0265314_10000027 3300031711 Bacteria 278331
310 Ga0265314_10139707 3300031711 Bacteria 1499
311 Ga0265342_10026033 3300031712 Bacteria 3670
312 Ga0307411_11096825 3300032005 Bacteria 717
313 Ga0307510_10005458 3300033180 Bacteria 15148
314 Ga0373927_0059974 3300035695 Bacteria 2461
315 Ga0373947_0160622 3300035725 Bacteria 1453
316 Ga0373937_0350451 3300036401 Bacteria 1398
317 Ga0395900_0033220 3300037418 Bacteria 5311
318 Ga0395898_1216698 3300037466 Bacteria 684
319 Ga0395901_0014803 3300038443 Bacteria 7926
320 Ga0436365_0589010 3300039437 Bacteria 11619
321 Ga0436360_0628197 3300039438 Bacteria 646
322 Ga0436361_1023825 3300039447 Bacteria 8591
323 Ga0436362_1211113 3300039453 Bacteria 898
324 Ga0451804_0236151 3300041463 Bacteria 518
325 Ga0451841_0850043 3300041498 Bacteria 838
326 Ga0439441_156068 3300042001 Bacteria 540
327 Ga0453684_0382179 3300044712 Bacteria 1581
328 Ga0453684_0406135 3300044712 Bacteria 1524
329 Ga0451576_1501511 3300045051 Bacteria 700
330 Ga0495582_0530416 3300046473 Bacteria 681
331 Ga0495606_0008859 3300046507 Bacteria 8624
332 Ga0495628_0017613 3300046516 Bacteria 5942
333 Ga0495630_0100432 3300046517 Bacteria 2189
334 Ga0495648_0131573 3300046524 Bacteria 1330
335 Ga0495642_0085183 3300046528 Bacteria 1334
336 Ga0495652_0321529 3300046529 Bacteria 1118
337 Ga0495640_0374012 3300046533 Bacteria 877
338 Ga0495586_0043647 3300046535 Bacteria 2415
339 Ga0495598_0031328 3300046537 Bacteria 1496
340 Ga0495598_0184727 3300046537 Bacteria 746
341 Ga0495621_0032789 3300046539 Bacteria 1788
342 Ga0495667_0183794 3300046559 Bacteria 1341
343 Ga0495668_0008040 3300046616 Bacteria 6641
344 Ga0495634_0672147 3300046642 Bacteria 597
345 Ga0495611_0032199 3300046648 Bacteria 2311
346 Ga0495625_0000628 3300046660 Bacteria 51089
347 Ga0495625_0029028 3300046660 Bacteria 4141
348 Ga0495625_0046915 3300046660 Bacteria 3116
349 Ga0495661_0228712 3300046665 Bacteria 960
350 Ga0495623_0202732 3300046679 Bacteria 1140
351 Ga0495670_0085635 3300046691 Bacteria 1609
352 Ga0495604_0482034 3300047317 Bacteria 807
353 Ga0495636_0000005 3300047318 Bacteria 108853
354 Ga0495676_0269361 3300047321 Bacteria 1156
355 Ga0495687_016963 3300047443 Bacteria 3647
356 Ga0495684_0162720 3300047471 Bacteria 1664
357 Ga0496105_0896048 3300048908 Bacteria 669
358 Ga0496111_0665921 3300048914 Bacteria 759
359 Ga0496112_0841940 3300048915 Bacteria 841
360 Ga0496113_0320777 3300048916 Bacteria 1242
361 Ga0496114_0477050 3300048917 Unclassified 1104
362 Ga0501034_0820308 3300049571 Bacteria 822
363 Ga0501047_0778223 3300049581 Bacteria 772
364 Ga0501048_0735453 3300049582 Bacteria 709
365 Ga0501072_0038927 3300049588 Bacteria 3733
366 Ga0501221_056501 3300049704 Bacteria 897
367 Ga0501079_0517046 3300049741 Unclassified 939
368 Ga0501044_0440502 3300049823 Bacteria 1211
369 nmdc:mga0k408_424_c1 3300050493 Bacteria 23079
370 nmdc:mga0k408_95302_c1 3300050493 Bacteria 1751
371 nmdc:mga05p37_110003_c1 3300050507 Bacteria 3390
372 nmdc:mga09592_8533_c1 3300050508 Bacteria 8335
373 nmdc:mga09592_921548_c1 3300050508 Bacteria 734
374 nmdc:mga09592_937564_c1 3300050508 Bacteria 726
375 nmdc:mga0qj67_77243_c1 3300050509 Bacteria 2664
376 nmdc:mga0qj67_922131_c1 3300050509 Bacteria 688
377 nmdc:mga0qj67_986563_c1 3300050509 Bacteria 661
378 nmdc:mga06r32_103035_c1 3300050510 Bacteria 2802
379 nmdc:mga06r32_264991_c1 3300050510 Bacteria 1706
380 nmdc:mga06r32_484813_c1 3300050510 Bacteria 1214
381 nmdc:mga08y16_49845_c1 3300050511 Bacteria 4381
382 nmdc:mga08y16_953991_c1 3300050511 Bacteria 841
383 nmdc:mga0n895_263339_c1 3300050512 Bacteria 1749
384 nmdc:mga0a205_107379_c1 3300050515 Bacteria 2689
385 Ga0500643_140032 3300053087 Bacteria 650
386 Ga0500651_0631458 3300053093 Bacteria 578
387 Ga0500641_0007357 3300053096 Bacteria 3924
388 Ga0500559_0093957 3300053136 Bacteria 1376
389 Ga0500559_0268393 3300053136 Bacteria 803
390 Ga0500589_193591 3300053147 Bacteria 787
391 Ga0500616_0000378 3300053153 Bacteria 62462
392 Ga0500616_0002964 3300053153 Bacteria 13469
393 Ga0500622_0004583 3300053156 Bacteria 8607
394 Ga0500639_098162 3300053163 Bacteria 1447
395 Ga0500636_0003330 3300053177 Bacteria 9025
396 Ga0500661_001774 3300055283 Bacteria 4068
397 Ga0501082_0541671 3300060353 Bacteria 1018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_101051070 Ga0070659_1010510702 137
2 iso_pu_bacteria 2513020052 2513233270 138
3 3300006038 Ga0075365_10043076 Ga0075365_100430765 139
4 3300006051 Ga0075364_10005700 Ga0075364_1000570011 139
5 3300009545 Ga0105237_10003970 Ga0105237_1000397012 139
6 3300013308 Ga0157375_10002645 Ga0157375_1000264510 139
7 3300006847 Ga0075431_100528399 Ga0075431_1005283992 140
8 3300014325 Ga0163163_11303986 Ga0163163_113039862 140
9 3300014969 Ga0157376_10421317 Ga0157376_104213171 140
10 3300017792 Ga0163161_10040981 Ga0163161_100409816 140
11 3300026095 Ga0207676_10080641 Ga0207676_100806412 140
12 3300031241 Ga0265325_10000050 Ga0265325_100000502 140
13 3300031712 Ga0265342_10026033 Ga0265342_100260336 140
14 3300037418 Ga0395900_0033220 Ga0395900_0033220_3622_4044 140
15 3300037466 Ga0395898_1216698 Ga0395898_1216698_220_642 140
16 3300046507 Ga0495606_0008859 Ga0495606_0008859_3082_3504 140
17 3300050510 nmdc:mga06r32_484813_c1 nmdc:mga06r32_484813_c1_277_699 140
18 3300053087 Ga0500643_140032 Ga0500643_140032_28_450 140
19 3300053156 Ga0500622_0004583 Ga0500622_0004583_4493_4915 140
20 3300003322 rootL2_10014031 rootL2_100140313 141
21 3300003911 JGI25405J52794_10022187 JGI25405J52794_100221872 141
22 3300005293 Ga0065715_10123969 Ga0065715_101239693 141
23 3300005367 Ga0070667_100117111 Ga0070667_1001171112 141
24 3300005456 Ga0070678_101330320 Ga0070678_1013303202 141
25 3300005459 Ga0068867_100231219 Ga0068867_1002312192 141
26 3300005543 Ga0070672_100270464 Ga0070672_1002704642 141
27 3300005614 Ga0068856_100011656 Ga0068856_1000116568 141
28 3300005842 Ga0068858_100688736 Ga0068858_1006887362 141
29 3300005937 Ga0081455_10090268 Ga0081455_100902681 141
30 3300005983 Ga0081540_1116297 Ga0081540_11162972 141
31 3300006844 Ga0075428_100876751 Ga0075428_1008767512 141
32 3300006852 Ga0075433_10068011 Ga0075433_100680113 141
33 3300006871 Ga0075434_100717691 Ga0075434_1007176911 141
34 3300006880 Ga0075429_100328773 Ga0075429_1003287732 141
35 3300009094 Ga0111539_10482628 Ga0111539_104826281 141
36 3300009553 Ga0105249_11544834 Ga0105249_115448342 141
37 3300013297 Ga0157378_11400606 Ga0157378_114006062 141
38 3300013307 Ga0157372_11539273 Ga0157372_115392732 141
39 3300014326 Ga0157380_10451825 Ga0157380_104518251 141
40 3300025940 Ga0207691_10047317 Ga0207691_100473172 141
41 3300025961 Ga0207712_10259975 Ga0207712_102599751 141
42 3300025986 Ga0207658_10264586 Ga0207658_102645862 141
43 3300026035 Ga0207703_11017360 Ga0207703_110173602 141
44 3300026075 Ga0207708_11620143 Ga0207708_116201431 141
45 3300026116 Ga0207674_10193260 Ga0207674_101932602 141
46 3300028794 Ga0307515_10578776 Ga0307515_105787761 141
47 3300028800 Ga0265338_10044535 Ga0265338_100445354 141
48 3300042001 Ga0439441_156068 Ga0439441_156068_11_436 141
49 3300048908 Ga0496105_0896048 Ga0496105_0896048_36_461 141
50 3300049571 Ga0501034_0820308 Ga0501034_0820308_288_713 141
51 3300049582 Ga0501048_0735453 Ga0501048_0735453_247_672 141
52 3300049588 Ga0501072_0038927 Ga0501072_0038927_3252_3677 141
53 3300049823 Ga0501044_0440502 Ga0501044_0440502_530_955 141
54 3300050507 nmdc:mga05p37_110003_c1 nmdc:mga05p37_110003_c1_101_526 141
55 3300050508 nmdc:mga09592_921548_c1 nmdc:mga09592_921548_c1_280_705 141
56 3300050509 nmdc:mga0qj67_922131_c1 nmdc:mga0qj67_922131_c1_183_608 141
57 3300050510 nmdc:mga06r32_264991_c1 nmdc:mga06r32_264991_c1_1221_1646 141
58 3300050511 nmdc:mga08y16_953991_c1 nmdc:mga08y16_953991_c1_379_804 141
59 3300050512 nmdc:mga0n895_263339_c1 nmdc:mga0n895_263339_c1_380_805 141
60 3300050515 nmdc:mga0a205_107379_c1 nmdc:mga0a205_107379_c1_672_1097 141
61 3300053136 Ga0500559_0268393 Ga0500559_0268393_196_621 141
62 3300053177 Ga0500636_0003330 Ga0500636_0003330_1598_2023 141
63 3300060353 Ga0501082_0541671 Ga0501082_0541671_390_815 141
64 3300002741 JGI25157J39369_1000870 JGI25157J39369_100087014 142
65 3300003203 JGI25406J46586_10003469 JGI25406J46586_100034697 142
66 3300005288 Ga0065714_10071504 Ga0065714_100715043 142
67 3300005288 Ga0065714_10092403 Ga0065714_100924032 142
68 3300005289 Ga0065704_10511686 Ga0065704_105116862 142
69 3300005290 Ga0065712_10007470 Ga0065712_100074704 142
70 3300005290 Ga0065712_10145195 Ga0065712_101451952 142
71 3300005290 Ga0065712_10396412 Ga0065712_103964121 142
72 3300005293 Ga0065715_10076199 Ga0065715_100761991 142
73 3300005329 Ga0070683_100284881 Ga0070683_1002848811 142
74 3300005329 Ga0070683_100734894 Ga0070683_1007348941 142
75 3300005330 Ga0070690_100031003 Ga0070690_1000310035 142
76 3300005330 Ga0070690_100142351 Ga0070690_1001423513 142
77 3300005330 Ga0070690_100249006 Ga0070690_1002490061 142
78 3300005333 Ga0070677_10195924 Ga0070677_101959241 142
79 3300005334 Ga0068869_100609992 Ga0068869_1006099921 142
80 3300005335 Ga0070666_10053260 Ga0070666_100532605 142
81 3300005336 Ga0070680_100378126 Ga0070680_1003781262 142
82 3300005336 Ga0070680_100988228 Ga0070680_1009882282 142
83 3300005337 Ga0070682_100475382 Ga0070682_1004753821 142
84 3300005338 Ga0068868_100412909 Ga0068868_1004129091 142
85 3300005339 Ga0070660_100351470 Ga0070660_1003514702 142
86 3300005340 Ga0070689_100202222 Ga0070689_1002022222 142
87 3300005340 Ga0070689_100289176 Ga0070689_1002891762 142
88 3300005340 Ga0070689_101710379 Ga0070689_1017103791 142
89 3300005344 Ga0070661_100001575 Ga0070661_10000157511 142
90 3300005347 Ga0070668_100215886 Ga0070668_1002158862 142
91 3300005353 Ga0070669_100278803 Ga0070669_1002788031 142
92 3300005354 Ga0070675_100027986 Ga0070675_1000279863 142
93 3300005354 Ga0070675_100185352 Ga0070675_1001853522 142
94 3300005354 Ga0070675_100264364 Ga0070675_1002643642 142
95 3300005364 Ga0070673_100079681 Ga0070673_1000796815 142
96 3300005364 Ga0070673_100816646 Ga0070673_1008166461 142
97 3300005364 Ga0070673_101067731 Ga0070673_1010677312 142
98 3300005364 Ga0070673_101070441 Ga0070673_1010704411 142
99 3300005365 Ga0070688_100036385 Ga0070688_1000363854 142
100 3300005365 Ga0070688_100138252 Ga0070688_1001382523 142
101 3300005365 Ga0070688_100797098 Ga0070688_1007970981 142
102 3300005367 Ga0070667_100044210 Ga0070667_1000442102 142
103 3300005367 Ga0070667_100200409 Ga0070667_1002004092 142
104 3300005367 Ga0070667_100204519 Ga0070667_1002045192 142
105 3300005367 Ga0070667_100410363 Ga0070667_1004103632 142
106 3300005434 Ga0070709_10013523 Ga0070709_100135233 142
107 3300005434 Ga0070709_10235279 Ga0070709_102352791 142
108 3300005435 Ga0070714_100448146 Ga0070714_1004481463 142
109 3300005438 Ga0070701_10085013 Ga0070701_100850132 142
110 3300005440 Ga0070705_100877394 Ga0070705_1008773941 142
111 3300005457 Ga0070662_100001104 Ga0070662_1000011043 142
112 3300005457 Ga0070662_100061435 Ga0070662_1000614354 142
113 3300005458 Ga0070681_10247459 Ga0070681_102474593 142
114 3300005459 Ga0068867_100043892 Ga0068867_1000438924 142
115 3300005466 Ga0070685_10005193 Ga0070685_1000519310 142
116 3300005466 Ga0070685_10033538 Ga0070685_100335384 142
117 3300005466 Ga0070685_10358074 Ga0070685_103580741 142
118 3300005466 Ga0070685_10448084 Ga0070685_104480841 142
119 3300005466 Ga0070685_10936539 Ga0070685_109365391 142
120 3300005467 Ga0070706_101449445 Ga0070706_1014494451 142
121 3300005471 Ga0070698_100000061 Ga0070698_10000006174 142
122 3300005471 Ga0070698_100003096 Ga0070698_10000309614 142
123 3300005535 Ga0070684_100021664 Ga0070684_1000216645 142
124 3300005539 Ga0068853_100001770 Ga0068853_10000177015 142
125 3300005539 Ga0068853_100045747 Ga0068853_1000457472 142
126 3300005539 Ga0068853_100488905 Ga0068853_1004889052 142
127 3300005539 Ga0068853_100876221 Ga0068853_1008762212 142
128 3300005543 Ga0070672_100120680 Ga0070672_1001206802 142
129 3300005543 Ga0070672_100223460 Ga0070672_1002234602 142
130 3300005543 Ga0070672_100405153 Ga0070672_1004051531 142
131 3300005544 Ga0070686_100009483 Ga0070686_1000094839 142
132 3300005545 Ga0070695_100514760 Ga0070695_1005147602 142
133 3300005547 Ga0070693_100094283 Ga0070693_1000942831 142
134 3300005547 Ga0070693_100182343 Ga0070693_1001823432 142
135 3300005548 Ga0070665_100489538 Ga0070665_1004895382 142
136 3300005549 Ga0070704_100182066 Ga0070704_1001820662 142
137 3300005549 Ga0070704_101185231 Ga0070704_1011852311 142
138 3300005563 Ga0068855_100110197 Ga0068855_1001101973 142
139 3300005563 Ga0068855_100571388 Ga0068855_1005713882 142
140 3300005564 Ga0070664_100204154 Ga0070664_1002041542 142
141 3300005577 Ga0068857_100049348 Ga0068857_1000493483 142
142 3300005578 Ga0068854_100097800 Ga0068854_1000978001 142
143 3300005578 Ga0068854_101233593 Ga0068854_1012335931 142
144 3300005614 Ga0068856_100083934 Ga0068856_1000839342 142
145 3300005614 Ga0068856_100918966 Ga0068856_1009189662 142
146 3300005616 Ga0068852_100074222 Ga0068852_1000742222 142
147 3300005616 Ga0068852_100171397 Ga0068852_1001713972 142
148 3300005616 Ga0068852_100486698 Ga0068852_1004866981 142
149 3300005617 Ga0068859_100103841 Ga0068859_1001038414 142
150 3300005617 Ga0068859_100941143 Ga0068859_1009411432 142
151 3300005618 Ga0068864_100073460 Ga0068864_1000734604 142
152 3300005618 Ga0068864_100096861 Ga0068864_1000968613 142
153 3300005618 Ga0068864_100320150 Ga0068864_1003201502 142
154 3300005618 Ga0068864_100614936 Ga0068864_1006149362 142
155 3300005718 Ga0068866_10188136 Ga0068866_101881362 142
156 3300005719 Ga0068861_100964673 Ga0068861_1009646731 142
157 3300005840 Ga0068870_10178881 Ga0068870_101788811 142
158 3300005841 Ga0068863_100041998 Ga0068863_1000419982 142
159 3300005841 Ga0068863_100102124 Ga0068863_1001021242 142
160 3300005841 Ga0068863_100176002 Ga0068863_1001760021 142
161 3300005841 Ga0068863_101429110 Ga0068863_1014291102 142
162 3300005842 Ga0068858_100747767 Ga0068858_1007477672 142
163 3300005843 Ga0068860_100009610 Ga0068860_1000096105 142
164 3300005843 Ga0068860_101078359 Ga0068860_1010783591 142
165 3300005843 Ga0068860_101513815 Ga0068860_1015138151 142
166 3300005844 Ga0068862_100168486 Ga0068862_1001684862 142
167 3300005844 Ga0068862_100236643 Ga0068862_1002366431 142
168 3300005844 Ga0068862_100571400 Ga0068862_1005714002 142
169 3300005844 Ga0068862_100778795 Ga0068862_1007787952 142
170 3300005985 Ga0081539_10000345 Ga0081539_1000034514 142
171 3300006028 Ga0070717_11048258 Ga0070717_110482582 142
172 3300006195 Ga0075366_10001232 Ga0075366_100012328 142
173 3300006195 Ga0075366_10099807 Ga0075366_100998072 142
174 3300006237 Ga0097621_100006899 Ga0097621_10000689911 142
175 3300006237 Ga0097621_100141137 Ga0097621_1001411374 142
176 3300006237 Ga0097621_100682396 Ga0097621_1006823962 142
177 3300006358 Ga0068871_100037551 Ga0068871_1000375513 142
178 3300006358 Ga0068871_100136536 Ga0068871_1001365363 142
179 3300006358 Ga0068871_100252427 Ga0068871_1002524271 142
180 3300006358 Ga0068871_100347499 Ga0068871_1003474991 142
181 3300006358 Ga0068871_100394385 Ga0068871_1003943852 142
182 3300006844 Ga0075428_100090426 Ga0075428_1000904265 142
183 3300006846 Ga0075430_100006345 Ga0075430_1000063454 142
184 3300006847 Ga0075431_100105332 Ga0075431_1001053322 142
185 3300006880 Ga0075429_100010254 Ga0075429_1000102549 142
186 3300006881 Ga0068865_100016915 Ga0068865_1000169154 142
187 3300006881 Ga0068865_100105410 Ga0068865_1001054102 142
188 3300006881 Ga0068865_100164549 Ga0068865_1001645492 142
189 3300006931 Ga0097620_100103839 Ga0097620_1001038394 142
190 3300006931 Ga0097620_100941183 Ga0097620_1009411832 142
191 3300009093 Ga0105240_10006255 Ga0105240_1000625510 142
192 3300009093 Ga0105240_10055504 Ga0105240_100555044 142
193 3300009093 Ga0105240_10772102 Ga0105240_107721022 142
194 3300009098 Ga0105245_10679598 Ga0105245_106795982 142
195 3300009101 Ga0105247_10275285 Ga0105247_102752852 142
196 3300009101 Ga0105247_10980314 Ga0105247_109803141 142
197 3300009148 Ga0105243_10463231 Ga0105243_104632312 142
198 3300009174 Ga0105241_11483066 Ga0105241_114830661 142
199 3300009176 Ga0105242_10066940 Ga0105242_100669402 142
200 3300009176 Ga0105242_10232512 Ga0105242_102325122 142
201 3300009176 Ga0105242_11401046 Ga0105242_114010462 142
202 3300009551 Ga0105238_11703809 Ga0105238_117038091 142
203 3300009553 Ga0105249_10024400 Ga0105249_100244003 142
204 3300009553 Ga0105249_10029039 Ga0105249_100290397 142
205 3300009553 Ga0105249_10089376 Ga0105249_100893765 142
206 3300009553 Ga0105249_10808876 Ga0105249_108088761 142
207 3300009553 Ga0105249_11877640 Ga0105249_118776401 142
208 3300010375 Ga0105239_10000142 Ga0105239_1000014250 142
209 3300010375 Ga0105239_10246983 Ga0105239_102469832 142
210 3300010375 Ga0105239_10286441 Ga0105239_102864412 142
211 3300011119 Ga0105246_10211885 Ga0105246_102118851 142
212 3300012487 Ga0157321_1005899 Ga0157321_10058992 142
213 3300013100 Ga0157373_10079301 Ga0157373_100793014 142
214 3300013100 Ga0157373_10111261 Ga0157373_101112613 142
215 3300013102 Ga0157371_10633433 Ga0157371_106334332 142
216 3300013105 Ga0157369_11296461 Ga0157369_112964611 142
217 3300013296 Ga0157374_10112517 Ga0157374_101125172 142
218 3300013296 Ga0157374_10276895 Ga0157374_102768951 142
219 3300013296 Ga0157374_10505396 Ga0157374_105053961 142
220 3300013296 Ga0157374_10715696 Ga0157374_107156962 142
221 3300013297 Ga0157378_10005675 Ga0157378_100056759 142
222 3300013297 Ga0157378_10044490 Ga0157378_100444903 142
223 3300013297 Ga0157378_10327423 Ga0157378_103274232 142
224 3300013297 Ga0157378_10441024 Ga0157378_104410242 142
225 3300013306 Ga0163162_10057844 Ga0163162_100578442 142
226 3300013306 Ga0163162_10102589 Ga0163162_101025894 142
227 3300013306 Ga0163162_10137676 Ga0163162_101376762 142
228 3300013306 Ga0163162_10603117 Ga0163162_106031172 142
229 3300013307 Ga0157372_10020339 Ga0157372_100203394 142
230 3300013307 Ga0157372_10298717 Ga0157372_102987172 142
231 3300013307 Ga0157372_10372072 Ga0157372_103720722 142
232 3300013308 Ga0157375_10001560 Ga0157375_100015607 142
233 3300013308 Ga0157375_10005935 Ga0157375_1000593513 142
234 3300013308 Ga0157375_10112012 Ga0157375_101120124 142
235 3300013308 Ga0157375_10157998 Ga0157375_101579982 142
236 3300013308 Ga0157375_10661456 Ga0157375_106614562 142
237 3300013308 Ga0157375_11410810 Ga0157375_114108101 142
238 3300013308 Ga0157375_11520796 Ga0157375_115207962 142
239 3300013308 Ga0157375_12215856 Ga0157375_122158562 142
240 3300013308 Ga0157375_12543315 Ga0157375_125433151 142
241 3300014325 Ga0163163_11488025 Ga0163163_114880251 142
242 3300014326 Ga0157380_10094623 Ga0157380_100946232 142
243 3300014326 Ga0157380_10199833 Ga0157380_101998332 142
244 3300014745 Ga0157377_10086610 Ga0157377_100866102 142
245 3300014968 Ga0157379_10080137 Ga0157379_100801372 142
246 3300014969 Ga0157376_10451864 Ga0157376_104518642 142
247 3300014969 Ga0157376_10538146 Ga0157376_105381462 142
248 3300017792 Ga0163161_10266362 Ga0163161_102663621 142
249 3300017792 Ga0163161_11625343 Ga0163161_116253431 142
250 3300021384 Ga0213876_10002163 Ga0213876_1000216312 142
251 3300025223 Ga0207672_1007189 Ga0207672_10071891 142
252 3300025226 Ga0209674_100457 Ga0209674_1004574 142
253 3300025242 Ga0209258_117488 Ga0209258_1174881 142
254 3300025250 Ga0209026_1000090 Ga0209026_100009096 142
255 3300025256 Ga0209759_1013062 Ga0209759_10130622 142
256 3300025893 Ga0207682_10384630 Ga0207682_103846301 142
257 3300025901 Ga0207688_10674730 Ga0207688_106747302 142
258 3300025906 Ga0207699_10007796 Ga0207699_100077962 142
259 3300025908 Ga0207643_10036046 Ga0207643_100360463 142
260 3300025912 Ga0207707_10048146 Ga0207707_100481463 142
261 3300025913 Ga0207695_10012635 Ga0207695_100126356 142
262 3300025913 Ga0207695_10039899 Ga0207695_100398992 142
263 3300025913 Ga0207695_10593039 Ga0207695_105930392 142
264 3300025915 Ga0207693_10926572 Ga0207693_109265721 142
265 3300025919 Ga0207657_10332079 Ga0207657_103320792 142
266 3300025920 Ga0207649_10006218 Ga0207649_100062188 142
267 3300025923 Ga0207681_10752613 Ga0207681_107526131 142
268 3300025925 Ga0207650_11056724 Ga0207650_110567242 142
269 3300025926 Ga0207659_10093884 Ga0207659_100938842 142
270 3300025926 Ga0207659_10292481 Ga0207659_102924812 142
271 3300025926 Ga0207659_10625071 Ga0207659_106250712 142
272 3300025926 Ga0207659_10977709 Ga0207659_109777091 142
273 3300025931 Ga0207644_10108948 Ga0207644_101089483 142
274 3300025931 Ga0207644_10372718 Ga0207644_103727182 142
275 3300025932 Ga0207690_10209033 Ga0207690_102090331 142
276 3300025933 Ga0207706_10001112 Ga0207706_1000111214 142
277 3300025933 Ga0207706_10096937 Ga0207706_100969371 142
278 3300025934 Ga0207686_10000793 Ga0207686_100007934 142
279 3300025934 Ga0207686_10431727 Ga0207686_104317272 142
280 3300025934 Ga0207686_11233629 Ga0207686_112336292 142
281 3300025936 Ga0207670_10082266 Ga0207670_100822663 142
282 3300025936 Ga0207670_10481435 Ga0207670_104814352 142
283 3300025936 Ga0207670_10543863 Ga0207670_105438632 142
284 3300025937 Ga0207669_10059912 Ga0207669_100599121 142
285 3300025938 Ga0207704_10044522 Ga0207704_100445222 142
286 3300025938 Ga0207704_10125611 Ga0207704_101256112 142
287 3300025940 Ga0207691_10041540 Ga0207691_100415403 142
288 3300025941 Ga0207711_10023809 Ga0207711_100238095 142
289 3300025941 Ga0207711_10201266 Ga0207711_102012662 142
290 3300025942 Ga0207689_10653725 Ga0207689_106537251 142
291 3300025945 Ga0207679_10044094 Ga0207679_100440944 142
292 3300025945 Ga0207679_10265907 Ga0207679_102659072 142
293 3300025949 Ga0207667_10576266 Ga0207667_105762662 142
294 3300025960 Ga0207651_10230684 Ga0207651_102306842 142
295 3300025960 Ga0207651_10576228 Ga0207651_105762282 142
296 3300025961 Ga0207712_10038242 Ga0207712_100382422 142
297 3300025961 Ga0207712_10051779 Ga0207712_100517793 142
298 3300025961 Ga0207712_11840778 Ga0207712_118407781 142
299 3300025972 Ga0207668_10287604 Ga0207668_102876042 142
300 3300025981 Ga0207640_10405862 Ga0207640_104058621 142
301 3300025986 Ga0207658_10147678 Ga0207658_101476782 142
302 3300026035 Ga0207703_10029684 Ga0207703_100296844 142
303 3300026035 Ga0207703_10309572 Ga0207703_103095722 142
304 3300026041 Ga0207639_10020930 Ga0207639_100209304 142
305 3300026041 Ga0207639_10055215 Ga0207639_100552152 142
306 3300026041 Ga0207639_10141435 Ga0207639_101414352 142
307 3300026041 Ga0207639_10428411 Ga0207639_104284111 142
308 3300026075 Ga0207708_10419945 Ga0207708_104199452 142
309 3300026075 Ga0207708_10919164 Ga0207708_109191641 142
310 3300026078 Ga0207702_10172335 Ga0207702_101723352 142
311 3300026078 Ga0207702_11548735 Ga0207702_115487351 142
312 3300026088 Ga0207641_10018275 Ga0207641_100182757 142
313 3300026088 Ga0207641_10099023 Ga0207641_100990232 142
314 3300026088 Ga0207641_10227265 Ga0207641_102272652 142
315 3300026088 Ga0207641_11714827 Ga0207641_117148271 142
316 3300026089 Ga0207648_10336410 Ga0207648_103364102 142
317 3300026095 Ga0207676_10072759 Ga0207676_100727592 142
318 3300026116 Ga0207674_10034538 Ga0207674_100345383 142
319 3300026142 Ga0207698_10544916 Ga0207698_105449161 142
320 3300026142 Ga0207698_12022064 Ga0207698_120220641 142
321 3300027360 Ga0209969_1037992 Ga0209969_10379922 142
322 3300027364 Ga0209967_1051670 Ga0209967_10516701 142
323 3300027471 Ga0209995_1022652 Ga0209995_10226521 142
324 3300027526 Ga0209968_1000820 Ga0209968_10008207 142
325 3300027617 Ga0210002_1002403 Ga0210002_10024032 142
326 3300027876 Ga0209974_10006839 Ga0209974_100068394 142
327 3300028381 Ga0268264_10034334 Ga0268264_100343344 142
328 3300028381 Ga0268264_11030417 Ga0268264_110304172 142
329 3300028794 Ga0307515_10000684 Ga0307515_1000068428 142
330 3300028794 Ga0307515_10000790 Ga0307515_1000079015 142
331 3300028800 Ga0265338_10005369 Ga0265338_100053695 142
332 3300031249 Ga0265339_10007701 Ga0265339_100077015 142
333 3300031711 Ga0265314_10000027 Ga0265314_10000027228 142
334 3300031711 Ga0265314_10139707 Ga0265314_101397071 142
335 3300032005 Ga0307411_11096825 Ga0307411_110968251 142
336 3300033180 Ga0307510_10005458 Ga0307510_100054589 142
337 3300035695 Ga0373927_0059974 Ga0373927_0059974_1864_2313 142
338 3300035725 Ga0373947_0160622 Ga0373947_0160622_1005_1436 142
339 3300036401 Ga0373937_0350451 Ga0373937_0350451_679_1125 142
340 3300038443 Ga0395901_0014803 Ga0395901_0014803_3096_3536 142
341 3300039437 Ga0436365_0589010 Ga0436365_0589010_9109_9540 142
342 3300039438 Ga0436360_0628197 Ga0436360_0628197_145_597 142
343 3300039447 Ga0436361_1023825 Ga0436361_1023825_7784_8215 142
344 3300039453 Ga0436362_1211113 Ga0436362_1211113_434_865 142
345 3300041463 Ga0451804_0236151 Ga0451804_0236151_55_486 142
346 3300041498 Ga0451841_0850043 Ga0451841_0850043_188_622 142
347 3300044712 Ga0453684_0382179 Ga0453684_0382179_445_873 142
348 3300044712 Ga0453684_0406135 Ga0453684_0406135_790_1395 142
349 3300045051 Ga0451576_1501511 Ga0451576_1501511_149_586 142
350 3300046473 Ga0495582_0530416 Ga0495582_0530416_133_564 142
351 3300046516 Ga0495628_0017613 Ga0495628_0017613_4214_4660 142
352 3300046517 Ga0495630_0100432 Ga0495630_0100432_473_919 142
353 3300046524 Ga0495648_0131573 Ga0495648_0131573_386_841 142
354 3300046528 Ga0495642_0085183 Ga0495642_0085183_727_1164 142
355 3300046529 Ga0495652_0321529 Ga0495652_0321529_41_478 142
356 3300046533 Ga0495640_0374012 Ga0495640_0374012_212_658 142
357 3300046535 Ga0495586_0043647 Ga0495586_0043647_672_1118 142
358 3300046537 Ga0495598_0031328 Ga0495598_0031328_839_1273 142
359 3300046537 Ga0495598_0184727 Ga0495598_0184727_263_694 142
360 3300046539 Ga0495621_0032789 Ga0495621_0032789_564_998 142
361 3300046559 Ga0495667_0183794 Ga0495667_0183794_684_1130 142
362 3300046616 Ga0495668_0008040 Ga0495668_0008040_569_1003 142
363 3300046642 Ga0495634_0672147 Ga0495634_0672147_83_529 142
364 3300046648 Ga0495611_0032199 Ga0495611_0032199_1433_1888 142
365 3300046660 Ga0495625_0000628 Ga0495625_0000628_7773_8204 142
366 3300046660 Ga0495625_0029028 Ga0495625_0029028_3662_4093 142
367 3300046660 Ga0495625_0046915 Ga0495625_0046915_2514_2969 142
368 3300046665 Ga0495661_0228712 Ga0495661_0228712_330_764 142
369 3300046679 Ga0495623_0202732 Ga0495623_0202732_430_864 142
370 3300046691 Ga0495670_0085635 Ga0495670_0085635_851_1285 142
371 3300047317 Ga0495604_0482034 Ga0495604_0482034_170_604 142
372 3300047318 Ga0495636_0000005 Ga0495636_0000005_39219_39656 142
373 3300047321 Ga0495676_0269361 Ga0495676_0269361_715_1146 142
374 3300047443 Ga0495687_016963 Ga0495687_016963_1565_1996 142
375 3300047471 Ga0495684_0162720 Ga0495684_0162720_547_993 142
376 3300048914 Ga0496111_0665921 Ga0496111_0665921_312_743 142
377 3300048915 Ga0496112_0841940 Ga0496112_0841940_289_720 142
378 3300048916 Ga0496113_0320777 Ga0496113_0320777_173_604 142
379 3300048917 Ga0496114_0477050 Ga0496114_0477050_272_703 142
380 3300049581 Ga0501047_0778223 Ga0501047_0778223_168_599 142
381 3300049704 Ga0501221_056501 Ga0501221_056501_154_600 142
382 3300049741 Ga0501079_0517046 Ga0501079_0517046_273_701 142
383 3300050493 nmdc:mga0k408_424_c1 nmdc:mga0k408_424_c1_16558_16989 142
384 3300050493 nmdc:mga0k408_95302_c1 nmdc:mga0k408_95302_c1_750_1181 142
385 3300050508 nmdc:mga09592_8533_c1 nmdc:mga09592_8533_c1_4773_5201 142
386 3300050508 nmdc:mga09592_937564_c1 nmdc:mga09592_937564_c1_28_465 142
387 3300050509 nmdc:mga0qj67_77243_c1 nmdc:mga0qj67_77243_c1_634_1068 142
388 3300050509 nmdc:mga0qj67_986563_c1 nmdc:mga0qj67_986563_c1_181_609 142
389 3300050510 nmdc:mga06r32_103035_c1 nmdc:mga06r32_103035_c1_841_1275 142
390 3300050511 nmdc:mga08y16_49845_c1 nmdc:mga08y16_49845_c1_317_745 142
391 3300053093 Ga0500651_0631458 Ga0500651_0631458_104_538 142
392 3300053096 Ga0500641_0007357 Ga0500641_0007357_1333_1767 142
393 3300053136 Ga0500559_0093957 Ga0500559_0093957_195_629 142
394 3300053147 Ga0500589_193591 Ga0500589_193591_133_579 142
395 3300053153 Ga0500616_0000378 Ga0500616_0000378_28610_29038 142
396 3300053153 Ga0500616_0002964 Ga0500616_0002964_12669_13103 142
397 3300053163 Ga0500639_098162 Ga0500639_098162_177_605 142
398 3300055283 Ga0500661_001774 Ga0500661_001774_582_1025 142

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i5t-assembly1.cif.gz_A crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131 0.6059 75 141
2vgz-assembly1.cif.gz_A crystal structure of human kynurenine aminotransferase ii 0.5807 85 135
4grx-assembly1.cif.gz_B structure of an omega-aminotransferase from paracoccus denitrificans 0.5779 85 141
1dj3-assembly1.cif.gz_B structures of adenylosuccinate synthetase from triticum aestivum and arabidopsis thaliana 0.5457 59 77
8a5p-assembly1.cif.gz_X structure of arp4-ies4-n-actin-arp8-ino80hsa subcomplex (a-module) of chaetomium thermophilum ino80 on curved dna 0.5301 45 74
ID Description Score Start End Superfamily
af_P9WKE3_10_163_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6392 59 74 3.40.50.2020
3gqhC02 Few Secondary Structures;Irregular;Rhinovirus 14, subunit 4;succinate dehydrogenase protein domain 0.5992 44 74 4.10.80.40
2ogjF01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.596 59 89 2.30.40.10
af_A0A0P0V657_185_381_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.5933 60 89 3.30.420.10
af_O53674_644_806_3.30.413.10 Alpha Beta;2-Layer Sandwich;Sulfite Reductase Hemoprotein; domain 1;Sulfite Reductase Hemoprotein, domain 1 0.5833 74 91 3.30.413.10
ID Description Score Start End GO Terms
AF-A0A1H6JFL5-F1-model_v4 Uncharacterized protein 0.9531 1 141
AF-A0A4Q3UIT9-F1-model_v4 DUF1801 domain-containing protein 0.9509 1 138
AF-A0A6B8RMY4-F1-model_v4 DUF1801 domain-containing protein 0.9501 1 139
AF-A0A7W5Q1R6-F1-model_v4 YdhG-like domain-containing protein 0.9418 1 137
AF-A0A1H6JFL5-F1-model_v4 Uncharacterized protein 0.9401 1 141

Feature Viewer

pLDDT pTM Quality
93.27 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map