F434063

General Info

Members Datasets Scaffolds Average Seq Length
398 187 396 320

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10295470|Ga0207658_102954701
Length 373
Sequence MMKNRPYRDPLFQQWGEAKAHYPTAVERFAAESGYSLNVFLFSLSFEYINLSMYSFKELSQLFDEKFAVRHFPWYPESLYDASQYILTLRGKRIRPVMCLMGNELFDKISADAWHIANAIELFHNFTLIHDDIMDNAPLRRGMQTVHTKYSGPTALLSGDVMLVAGYEYINKISNEYLHRVLAVFNATAKHVCEGQQLDMDFEKKEKVSFEDYVQMIGLKTSVLLAASLQLGGMLGGAGLGNQQHLYEFGKSLGIAFQVQDDYLDAFGDPEKFGKKKGGDILANKKTFLYVQALHAGSAEQVKELNNLRQENDDHKIDRVLNIYKSCKVDEWAKELKQKYMSIALEHLDEIAVLSVRKKPLQELAHYLLERDT

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
149 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
152 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
176 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
177 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
178 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
181 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
182 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
183 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
184 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
185 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
186 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.03
Nodule 0
Rhizoplane 0.5
Rhizosphere 92.71
Stem 0
Stem Tuber 0
Unclassified 1.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10050999 3300001989 Bacteria 1336
2 JGI24751J29686_10000670 3300002459 Bacteria 8551
3 rootH1_10113424 3300003316 Bacteria 2449
4 rootL2_10090870 3300003322 Bacteria 1592
5 rootL2_10090871 3300003322 Unclassified 1409
6 JGI25160J50197_1004406 3300003354 Bacteria 6099
7 Ga0065712_10072979 3300005290 Bacteria 4532
8 Ga0070658_10027736 3300005327 Bacteria 4544
9 Ga0070683_100002184 3300005329 Bacteria 15475
10 Ga0070683_100020984 3300005329 Bacteria 5825
11 Ga0070683_100025338 3300005329 Bacteria 5326
12 Ga0070683_100221820 3300005329 Unclassified 1797
13 Ga0070670_100020032 3300005331 Bacteria 5745
14 Ga0070670_100116021 3300005331 Bacteria 2309
15 Ga0070670_100208677 3300005331 Bacteria 1698
16 Ga0070670_100313540 3300005331 Bacteria 1373
17 Ga0070670_100345598 3300005331 Unclassified 1306
18 Ga0068869_100005451 3300005334 Bacteria 8003
19 Ga0068869_100022204 3300005334 Bacteria 4370
20 Ga0068869_100030108 3300005334 Bacteria 3808
21 Ga0068869_100071563 3300005334 Bacteria 2568
22 Ga0068869_100083184 3300005334 Bacteria 2393
23 Ga0068869_100207230 3300005334 Bacteria 1549
24 Ga0070666_10011914 3300005335 Bacteria 5470
25 Ga0070666_10026275 3300005335 Bacteria 3801
26 Ga0070666_10101801 3300005335 Bacteria 1980
27 Ga0070666_10215662 3300005335 Bacteria 1353
28 Ga0070680_100266458 3300005336 Bacteria 1450
29 Ga0070680_100342688 3300005336 Unclassified 1270
30 Ga0070682_100005005 3300005337 Bacteria 7366
31 Ga0068868_100002169 3300005338 Bacteria 13537
32 Ga0068868_100018452 3300005338 Bacteria 5217
33 Ga0068868_100030431 3300005338 Bacteria 4140
34 Ga0068868_100324765 3300005338 Bacteria 1312
35 Ga0070660_100073057 3300005339 Bacteria 2681
36 Ga0070689_100060565 3300005340 Bacteria 2943
37 Ga0070689_100065482 3300005340 Bacteria 2830
38 Ga0070689_100195587 3300005340 Bacteria 1648
39 Ga0070689_100271812 3300005340 Bacteria 1403
40 Ga0070661_100078176 3300005344 Bacteria 2440
41 Ga0070661_100104292 3300005344 Bacteria 2112
42 Ga0070668_100015981 3300005347 Bacteria 5615
43 Ga0070669_100100487 3300005353 Unclassified 2181
44 Ga0070675_100016538 3300005354 Bacteria 5856
45 Ga0070675_100034503 3300005354 Bacteria 4107
46 Ga0070675_100099600 3300005354 Bacteria 2447
47 Ga0070675_100312268 3300005354 Bacteria 1387
48 Ga0070671_100004909 3300005355 Bacteria 10647
49 Ga0070673_100014013 3300005364 Bacteria 5568
50 Ga0070673_100038061 3300005364 Bacteria 3670
51 Ga0070673_100289879 3300005364 Bacteria 1438
52 Ga0070688_100004110 3300005365 Bacteria 7554
53 Ga0070688_100021037 3300005365 Bacteria 3805
54 Ga0070688_100109071 3300005365 Bacteria 1838
55 Ga0070659_100005333 3300005366 Bacteria 9223
56 Ga0070659_100038067 3300005366 Bacteria 3750
57 Ga0070659_100415330 3300005366 Bacteria 1137
58 Ga0070667_100004254 3300005367 Bacteria 12089
59 Ga0070667_100060865 3300005367 Bacteria 3196
60 Ga0070667_100225644 3300005367 Unclassified 1669
61 Ga0070667_100337532 3300005367 Unclassified 1362
62 Ga0070667_100427934 3300005367 Bacteria 1207
63 Ga0070701_10080964 3300005438 Unclassified 1758
64 Ga0070701_10162406 3300005438 Bacteria 1295
65 Ga0070700_100140706 3300005441 Bacteria 1639
66 Ga0070678_100336227 3300005456 Bacteria 1294
67 Ga0070662_100002745 3300005457 Bacteria 10880
68 Ga0070662_100005009 3300005457 Bacteria 8427
69 Ga0070662_100016213 3300005457 Bacteria 5000
70 Ga0070681_10061851 3300005458 Bacteria 3718
71 Ga0068867_100014886 3300005459 Bacteria 5512
72 Ga0068867_100041072 3300005459 Bacteria 3380
73 Ga0068867_100059622 3300005459 Bacteria 2829
74 Ga0068867_100160303 3300005459 Bacteria 1773
75 Ga0068867_100201720 3300005459 Bacteria 1593
76 Ga0068867_100263278 3300005459 Bacteria 1407
77 Ga0070685_10072481 3300005466 Bacteria 2045
78 Ga0070685_10142274 3300005466 Bacteria 1511
79 Ga0070698_100008358 3300005471 Bacteria 11187
80 Ga0070698_100024291 3300005471 Bacteria 6324
81 Ga0070679_100127627 3300005530 Bacteria 2525
82 Ga0070684_100001436 3300005535 Bacteria 17157
83 Ga0070684_100096517 3300005535 Bacteria 2635
84 Ga0068853_100053609 3300005539 Bacteria 3472
85 Ga0068853_100369371 3300005539 Bacteria 1338
86 Ga0070686_100304823 3300005544 Bacteria 1182
87 Ga0070693_100033522 3300005547 Bacteria 2835
88 Ga0070665_100027910 3300005548 Bacteria 5684
89 Ga0068855_100024392 3300005563 Bacteria 7236
90 Ga0068855_100357723 3300005563 Bacteria 1607
91 Ga0070664_100017280 3300005564 Bacteria 5924
92 Ga0070664_100018244 3300005564 Bacteria 5759
93 Ga0070664_100021674 3300005564 Bacteria 5298
94 Ga0070664_100102243 3300005564 Bacteria 2493
95 Ga0070664_100128491 3300005564 Bacteria 2225
96 Ga0070664_100143375 3300005564 Bacteria 2105
97 Ga0068857_100011178 3300005577 Bacteria 7807
98 Ga0068857_100058150 3300005577 Bacteria 3432
99 Ga0068857_100076541 3300005577 Unclassified 2984
100 Ga0068857_100625372 3300005577 Unclassified 1019
101 Ga0068854_100037871 3300005578 Bacteria 3387
102 Ga0068854_100275506 3300005578 Unclassified 1352
103 Ga0068854_100276118 3300005578 Unclassified 1351
104 Ga0068856_100123383 3300005614 Bacteria 2593
105 Ga0068852_100140790 3300005616 Bacteria 2232
106 Ga0068852_100247196 3300005616 Bacteria 1707
107 Ga0068859_100020315 3300005617 Bacteria 6667
108 Ga0068859_100027739 3300005617 Bacteria 5679
109 Ga0068859_100324924 3300005617 Unclassified 1632
110 Ga0068859_100408359 3300005617 Bacteria 1454
111 Ga0068864_100006025 3300005618 Bacteria 9953
112 Ga0068864_100058823 3300005618 Bacteria 3323
113 Ga0068864_100083513 3300005618 Bacteria 2805
114 Ga0068864_100347004 3300005618 Bacteria 1399
115 Ga0068864_100532763 3300005618 Bacteria 1133
116 Ga0068866_10223497 3300005718 Unclassified 1137
117 Ga0068861_100043799 3300005719 Unclassified 3362
118 Ga0068851_10010694 3300005834 Bacteria 4288
119 Ga0068851_10090022 3300005834 Bacteria 1614
120 Ga0068863_100037816 3300005841 Bacteria 4593
121 Ga0068863_100204435 3300005841 Bacteria 1900
122 Ga0068863_100217593 3300005841 Bacteria 1840
123 Ga0068858_100018630 3300005842 Bacteria 6499
124 Ga0068858_100107515 3300005842 Bacteria 2604
125 Ga0068858_100357498 3300005842 Bacteria 1399
126 Ga0068860_100003295 3300005843 Bacteria 16613
127 Ga0068860_100022197 3300005843 Bacteria 6145
128 Ga0068860_100069931 3300005843 Bacteria 3337
129 Ga0068860_100404057 3300005843 Bacteria 1352
130 Ga0068862_100074000 3300005844 Bacteria 2944
131 Ga0068862_100198292 3300005844 Unclassified 1809
132 Ga0081539_10000337 3300005985 Bacteria 103868
133 Ga0075366_10013047 3300006195 Bacteria 4725
134 Ga0075366_10027365 3300006195 Bacteria 3345
135 Ga0097621_100001126 3300006237 Bacteria 18630
136 Ga0097621_100001728 3300006237 Bacteria 14930
137 Ga0097621_100097896 3300006237 Bacteria 2464
138 Ga0068871_100001247 3300006358 Bacteria 16998
139 Ga0068871_100041210 3300006358 Bacteria 3701
140 Ga0075430_100017225 3300006846 Bacteria 6153
141 Ga0075430_100324622 3300006846 Bacteria 1272
142 Ga0075434_100051074 3300006871 Bacteria 4108
143 Ga0075429_100007106 3300006880 Bacteria 9721
144 Ga0075429_100055246 3300006880 Bacteria 3455
145 Ga0068865_100188868 3300006881 Bacteria 1592
146 Ga0097620_100020314 3300006931 Bacteria 6667
147 Ga0097620_100027743 3300006931 Bacteria 5679
148 Ga0097620_100324923 3300006931 Unclassified 1632
149 Ga0097620_100408378 3300006931 Bacteria 1454
150 Ga0111539_10005334 3300009094 Bacteria 16629
151 Ga0111539_10204352 3300009094 Bacteria 2303
152 Ga0111539_10376164 3300009094 Bacteria 1654
153 Ga0105247_10002918 3300009101 Bacteria 11374
154 Ga0114129_10082907 3300009147 Bacteria 4455
155 Ga0105242_10031547 3300009176 Bacteria 4234
156 Ga0105237_10002901 3300009545 Bacteria 20795
157 Ga0105249_10002459 3300009553 Bacteria 16072
158 Ga0105249_10010476 3300009553 Bacteria 8146
159 Ga0105249_10113693 3300009553 Bacteria 2562
160 Ga0105249_10143095 3300009553 Bacteria 2295
161 Ga0105249_10178554 3300009553 Bacteria 2064
162 Ga0105239_10003300 3300010375 Bacteria 19873
163 Ga0105246_10209913 3300011119 Bacteria 1519
164 Ga0157373_10066376 3300013100 Bacteria 2553
165 Ga0157373_10072399 3300013100 Bacteria 2433
166 Ga0157373_10100667 3300013100 Bacteria 2034
167 Ga0157371_10000913 3300013102 Bacteria 33279
168 Ga0157371_10018584 3300013102 Bacteria 5136
169 Ga0157371_10055194 3300013102 Bacteria 2819
170 Ga0157370_10002692 3300013104 Bacteria 21301
171 Ga0157370_10017741 3300013104 Bacteria 7175
172 Ga0157370_10055400 3300013104 Bacteria 3778
173 Ga0157370_10298854 3300013104 Bacteria 1486
174 Ga0157369_10010265 3300013105 Bacteria 10685
175 Ga0157374_10001792 3300013296 Bacteria 18071
176 Ga0157374_10002989 3300013296 Bacteria 14152
177 Ga0157374_10017838 3300013296 Bacteria 6254
178 Ga0157374_10023310 3300013296 Bacteria 5536
179 Ga0157374_10024277 3300013296 Bacteria 5434
180 Ga0157374_10046313 3300013296 Bacteria 4027
181 Ga0157374_10152532 3300013296 Bacteria 2247
182 Ga0157374_10249856 3300013296 Bacteria 1745
183 Ga0157378_10000623 3300013297 Bacteria 33314
184 Ga0157378_10023262 3300013297 Bacteria 5453
185 Ga0157378_10103875 3300013297 Bacteria 2597
186 Ga0157378_10164108 3300013297 Bacteria 2080
187 Ga0163162_10014936 3300013306 Bacteria 7583
188 Ga0163162_10019081 3300013306 Bacteria 6725
189 Ga0163162_10095720 3300013306 Bacteria 3056
190 Ga0163162_10105637 3300013306 Bacteria 2910
191 Ga0163162_10239607 3300013306 Bacteria 1945
192 Ga0163162_10351285 3300013306 Bacteria 1607
193 Ga0163162_10414272 3300013306 Bacteria 1480
194 Ga0163162_10504209 3300013306 Bacteria 1340
195 Ga0163162_10614272 3300013306 Bacteria 1213
196 Ga0157372_10057057 3300013307 Bacteria 4365
197 Ga0157372_10067783 3300013307 Bacteria 4011
198 Ga0157372_10069455 3300013307 Bacteria 3962
199 Ga0157372_10211462 3300013307 Bacteria 2248
200 Ga0157372_10269989 3300013307 Unclassified 1976
201 Ga0157372_10544064 3300013307 Bacteria 1354
202 Ga0157372_10776019 3300013307 Bacteria 1114
203 Ga0157375_10002063 3300013308 Bacteria 17354
204 Ga0157375_10029071 3300013308 Bacteria 5193
205 Ga0157375_10044554 3300013308 Bacteria 4312
206 Ga0157375_10071174 3300013308 Bacteria 3490
207 Ga0163163_10000982 3300014325 Bacteria 24199
208 Ga0163163_10004922 3300014325 Bacteria 11488
209 Ga0163163_10014724 3300014325 Bacteria 7196
210 Ga0163163_10160396 3300014325 Bacteria 2294
211 Ga0163163_10305433 3300014325 Bacteria 1643
212 Ga0157380_10005287 3300014326 Bacteria 9029
213 Ga0157380_10130411 3300014326 Bacteria 2143
214 Ga0157380_10289323 3300014326 Bacteria 1504
215 Ga0157377_10002833 3300014745 Bacteria 7742
216 Ga0157377_10063174 3300014745 Bacteria 2120
217 Ga0157377_10065006 3300014745 Bacteria 2094
218 Ga0157377_10066176 3300014745 Bacteria 2077
219 Ga0157377_10326468 3300014745 Bacteria 1021
220 Ga0157379_10068707 3300014968 Bacteria 3168
221 Ga0157379_10193112 3300014968 Bacteria 1840
222 Ga0157379_10317715 3300014968 Bacteria 1421
223 Ga0157376_10000779 3300014969 Bacteria 20826
224 Ga0157376_10052116 3300014969 Bacteria 3401
225 Ga0163161_10014155 3300017792 Bacteria 5555
226 Ga0163161_10014865 3300017792 Bacteria 5424
227 Ga0163161_10078638 3300017792 Bacteria 2424
228 Ga0207426_1000019 3300025302 Bacteria 558579
229 Ga0207710_10003867 3300025900 Bacteria 6617
230 Ga0207680_10053545 3300025903 Bacteria 2423
231 Ga0207680_10057279 3300025903 Bacteria 2358
232 Ga0207647_10046315 3300025904 Bacteria 2711
233 Ga0207645_10013083 3300025907 Bacteria 5605
234 Ga0207645_10096687 3300025907 Bacteria 1903
235 Ga0207645_10126101 3300025907 Bacteria 1664
236 Ga0207643_10023029 3300025908 Bacteria 3433
237 Ga0207705_10047362 3300025909 Bacteria 3091
238 Ga0207705_10061884 3300025909 Bacteria 2704
239 Ga0207707_10049334 3300025912 Bacteria 3667
240 Ga0207662_10005791 3300025918 Bacteria 6615
241 Ga0207662_10029629 3300025918 Bacteria 3172
242 Ga0207657_10001051 3300025919 Bacteria 29279
243 Ga0207649_10127391 3300025920 Bacteria 1725
244 Ga0207681_10271124 3300025923 Unclassified 1332
245 Ga0207650_10001510 3300025925 Bacteria 16628
246 Ga0207650_10076897 3300025925 Bacteria 2522
247 Ga0207650_10175598 3300025925 Bacteria 1705
248 Ga0207650_10302775 3300025925 Unclassified 1306
249 Ga0207659_10087786 3300025926 Bacteria 2316
250 Ga0207644_10083110 3300025931 Bacteria 2370
251 Ga0207690_10004919 3300025932 Bacteria 7884
252 Ga0207690_10009016 3300025932 Bacteria 5921
253 Ga0207706_10001391 3300025933 Bacteria 24155
254 Ga0207706_10023150 3300025933 Bacteria 5579
255 Ga0207706_10029649 3300025933 Bacteria 4884
256 Ga0207706_10149743 3300025933 Bacteria 2052
257 Ga0207706_10187629 3300025933 Bacteria 1815
258 Ga0207706_10261587 3300025933 Bacteria 1510
259 Ga0207686_10000956 3300025934 Bacteria 17240
260 Ga0207670_10158195 3300025936 Unclassified 1688
261 Ga0207669_10241294 3300025937 Bacteria 1340
262 Ga0207704_10010871 3300025938 Bacteria 4459
263 Ga0207704_10115028 3300025938 Bacteria 1827
264 Ga0207691_10020974 3300025940 Bacteria 6175
265 Ga0207689_10001172 3300025942 Bacteria 25240
266 Ga0207689_10019839 3300025942 Bacteria 5663
267 Ga0207689_10025898 3300025942 Bacteria 4912
268 Ga0207689_10042041 3300025942 Bacteria 3783
269 Ga0207689_10067854 3300025942 Bacteria 2931
270 Ga0207689_10208945 3300025942 Unclassified 1612
271 Ga0207661_10030914 3300025944 Bacteria 4129
272 Ga0207661_10100104 3300025944 Unclassified 2432
273 Ga0207661_10125844 3300025944 Bacteria 2189
274 Ga0207679_10004312 3300025945 Bacteria 8849
275 Ga0207679_10018046 3300025945 Bacteria 4718
276 Ga0207679_10019851 3300025945 Bacteria 4526
277 Ga0207679_10055476 3300025945 Bacteria 2921
278 Ga0207679_10367749 3300025945 Bacteria 1258
279 Ga0207667_10069144 3300025949 Bacteria 3676
280 Ga0207667_10319470 3300025949 Bacteria 1586
281 Ga0207667_10355710 3300025949 Bacteria 1493
282 Ga0207651_10022196 3300025960 Bacteria 3875
283 Ga0207651_10111792 3300025960 Bacteria 2052
284 Ga0207651_10281756 3300025960 Bacteria 1374
285 Ga0207712_10005316 3300025961 Bacteria 8132
286 Ga0207712_10016265 3300025961 Bacteria 4813
287 Ga0207712_10138008 3300025961 Unclassified 1867
288 Ga0207712_10236001 3300025961 Bacteria 1471
289 Ga0207668_10155272 3300025972 Bacteria 1777
290 Ga0207640_10039939 3300025981 Bacteria 2974
291 Ga0207640_10214618 3300025981 Bacteria 1469
292 Ga0207640_10266326 3300025981 Unclassified 1338
293 Ga0207658_10005723 3300025986 Bacteria 8499
294 Ga0207658_10064770 3300025986 Bacteria 2743
295 Ga0207658_10211258 3300025986 Bacteria 1626
296 Ga0207658_10295470 3300025986 Bacteria 1394
297 Ga0207677_10225421 3300026023 Bacteria 1506
298 Ga0207677_10264634 3300026023 Bacteria 1403
299 Ga0207703_10025279 3300026035 Bacteria 4670
300 Ga0207639_10036791 3300026041 Bacteria 3630
301 Ga0207702_10026226 3300026078 Bacteria 4837
302 Ga0207641_10013101 3300026088 Bacteria 6799
303 Ga0207641_10017176 3300026088 Bacteria 5919
304 Ga0207641_10122431 3300026088 Bacteria 2323
305 Ga0207641_10184311 3300026088 Bacteria 1914
306 Ga0207648_10002631 3300026089 Bacteria 19216
307 Ga0207648_10009027 3300026089 Bacteria 9588
308 Ga0207648_10026467 3300026089 Bacteria 5154
309 Ga0207648_10029653 3300026089 Bacteria 4851
310 Ga0207648_10164205 3300026089 Bacteria 1962
311 Ga0207676_10006956 3300026095 Bacteria 8017
312 Ga0207676_10009281 3300026095 Bacteria 6998
313 Ga0207676_10061034 3300026095 Bacteria 2984
314 Ga0207676_10067797 3300026095 Bacteria 2851
315 Ga0207676_10069988 3300026095 Bacteria 2812
316 Ga0207676_10229026 3300026095 Bacteria 1660
317 Ga0207674_10001383 3300026116 Bacteria 31265
318 Ga0207674_10038280 3300026116 Bacteria 4980
319 Ga0207674_10078069 3300026116 Bacteria 3316
320 Ga0207675_100042514 3300026118 Bacteria 4244
321 Ga0207683_10025898 3300026121 Bacteria 5062
322 Ga0207683_10495441 3300026121 Unclassified 1128
323 Ga0207698_10137729 3300026142 Bacteria 2097
324 Ga0207698_10303734 3300026142 Bacteria 1487
325 Ga0268265_10110228 3300028380 Bacteria 2245
326 Ga0268265_10152614 3300028380 Bacteria 1950
327 Ga0268265_10290669 3300028380 Bacteria 1467
328 Ga0268264_10015854 3300028381 Bacteria 6170
329 Ga0268264_10159256 3300028381 Unclassified 2032
330 Ga0268264_10276330 3300028381 Bacteria 1571
331 Ga0265327_10000054 3300031251 Bacteria 250337
332 Ga0307508_10234252 3300031616 Bacteria 1434
333 Ga0307405_10047534 3300031731 Bacteria 2643
334 Ga0307413_10005900 3300031824 Bacteria 5531
335 Ga0307407_10044071 3300031903 Bacteria 2512
336 Ga0307412_10075076 3300031911 Bacteria 2318
337 Ga0307415_100002870 3300032126 Bacteria 8625
338 Ga0373945_0145452 3300035116 Bacteria 958
339 Ga0373947_0180486 3300035725 Bacteria 1374
340 Ga0373925_0476903 3300037068 Bacteria 1023
341 Ga0395899_0009094 3300037312 Bacteria 7631
342 Ga0395899_0193939 3300037312 Bacteria 1420
343 Ga0395900_0041546 3300037418 Bacteria 4740
344 Ga0395898_0080842 3300037466 Bacteria 3134
345 Ga0395898_0240524 3300037466 Bacteria 1726
346 Ga0395898_0412944 3300037466 Bacteria 1287
347 Ga0395905_0250512 3300037471 Bacteria 1654
348 Ga0395905_0322842 3300037471 Unclassified 1434
349 Ga0395901_0001630 3300038443 Bacteria 23212
350 Ga0439436_0008372 3300041404 Bacteria 3178
351 Ga0451841_0125156 3300041498 Bacteria 1121
352 Ga0439449_0010747 3300042007 Bacteria 3456
353 Ga0439457_000667 3300042014 Bacteria 10140
354 Ga0439462_0071371 3300042015 Unclassified 943
355 Ga0466972_0000011 3300044658 Bacteria 249697
356 Ga0453684_0157181 3300044712 Bacteria 2694
357 Ga0466957_0018386 3300044842 Bacteria 4104
358 Ga0495638_0133070 3300046460 Bacteria 1459
359 Ga0495672_0067479 3300047320 Bacteria 2037
360 Ga0495676_0254278 3300047321 Bacteria 1197
361 Ga0495686_0055773 3300047472 Bacteria 2470
362 Ga0496109_0423388 3300048912 Bacteria 1258
363 Ga0496110_0117115 3300048913 Bacteria 2399
364 Ga0501034_0007113 3300049571 Bacteria 11936
365 Ga0501034_0513474 3300049571 Bacteria 1111
366 Ga0501047_0011313 3300049581 Bacteria 8448
367 Ga0501047_0083324 3300049581 Bacteria 3073
368 Ga0501047_0149501 3300049581 Bacteria 2212
369 Ga0501048_0337831 3300049582 Bacteria 1074
370 Ga0501072_0039565 3300049588 Bacteria 3702
371 Ga0501257_012319 3300049686 Bacteria 1956
372 Ga0501035_0007281 3300049822 Bacteria 10352
373 Ga0501044_0060000 3300049823 Bacteria 3896
374 nmdc:mga0k408_25311_c1 3300050493 Bacteria 3361
375 nmdc:mga05p37_98637_c1 3300050507 Bacteria 3598
376 nmdc:mga09592_37183_c1 3300050508 Bacteria 4083
377 nmdc:mga0qj67_28943_c1 3300050509 Bacteria 4301
378 nmdc:mga08y16_257410_c1 3300050511 Bacteria 1803
379 nmdc:mga08y16_280622_c1 3300050511 Bacteria 1718
380 nmdc:mga08y16_91234_c1 3300050511 Bacteria 3175
381 nmdc:mga0n895_38625_c1 3300050512 Bacteria 4626
382 Ga0500578_0000027 3300053086 Bacteria 144362
383 Ga0500644_0008655 3300053088 Bacteria 2693
384 Ga0500583_0000004 3300053092 Bacteria 174723
385 Ga0500583_0013100 3300053092 Bacteria 3193
386 Ga0500562_000020 3300053108 Bacteria 113686
387 Ga0500568_0001662 3300053139 Bacteria 13941
388 Ga0500573_0024241 3300053140 Bacteria 3488
389 Ga0500589_014226 3300053147 Bacteria 3524
390 Ga0500622_0000467 3300053156 Bacteria 38187
391 Ga0500622_0018408 3300053156 Bacteria 3714
392 Ga0500639_023011 3300053163 Bacteria 3291
393 Ga0500636_0048229 3300053177 Bacteria 2508
394 Ga0500637_0069776 3300053178 Bacteria 2021
395 Ga0500611_000098 3300053727 Bacteria 23666
396 Ga0500645_008071 3300053730 Bacteria 3623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0145452 Ga0373945_0145452_84_905 257
2 3300037068 Ga0373925_0476903 Ga0373925_0476903_107_928 257
3 3300053140 Ga0500573_0024241 Ga0500573_0024241_34_855 257
4 3300042015 Ga0439462_0071371 Ga0439462_0071371_108_929 260
5 3300053092 Ga0500583_0000004 Ga0500583_0000004_126853_127818 280
6 3300053177 Ga0500636_0048229 Ga0500636_0048229_802_1767 297
7 3300053092 Ga0500583_0013100 Ga0500583_0013100_1503_2477 299
8 3300053147 Ga0500589_014226 Ga0500589_014226_1342_2316 299
9 3300005843 Ga0068860_100022197 Ga0068860_1000221974 300
10 3300028381 Ga0268264_10015854 Ga0268264_100158544 300
11 3300031616 Ga0307508_10234252 Ga0307508_102342522 300
12 3300031731 Ga0307405_10047534 Ga0307405_100475343 300
13 3300031824 Ga0307413_10005900 Ga0307413_100059002 300
14 3300031903 Ga0307407_10044071 Ga0307407_100440712 300
15 3300031911 Ga0307412_10075076 Ga0307412_100750762 300
16 3300032126 Ga0307415_100002870 Ga0307415_1000028702 300
17 3300049571 Ga0501034_0513474 Ga0501034_0513474_78_1043 300
18 3300049581 Ga0501047_0083324 Ga0501047_0083324_91_1056 300
19 3300049582 Ga0501048_0337831 Ga0501048_0337831_45_1010 300
20 3300049823 Ga0501044_0060000 Ga0501044_0060000_13_978 300
21 3300053156 Ga0500622_0018408 Ga0500622_0018408_1808_2782 300
22 3300053178 Ga0500637_0069776 Ga0500637_0069776_398_1363 300
23 3300044842 Ga0466957_0018386 Ga0466957_0018386_1461_2426 301
24 3300003322 rootL2_10090871 rootL2_100908712 302
25 3300041498 Ga0451841_0125156 Ga0451841_0125156_93_1058 302
26 3300044658 Ga0466972_0000011 Ga0466972_0000011_49225_50190 302
27 3300049581 Ga0501047_0011313 Ga0501047_0011313_2384_3349 302
28 3300013307 Ga0157372_10211462 Ga0157372_102114622 303
29 3300053163 Ga0500639_023011 Ga0500639_023011_422_1387 305
30 3300041404 Ga0439436_0008372 Ga0439436_0008372_1805_2770 308
31 3300042007 Ga0439449_0010747 Ga0439449_0010747_1857_2822 308
32 3300042014 Ga0439457_000667 Ga0439457_000667_1289_2254 308
33 3300053086 Ga0500578_0000027 Ga0500578_0000027_106259_107224 313
34 3300006195 Ga0075366_10027365 Ga0075366_100273652 314
35 3300050493 nmdc:mga0k408_25311_c1 nmdc:mga0k408_25311_c1_1877_2842 314
36 3300005719 Ga0068861_100043799 Ga0068861_1000437993 317
37 iso_pu_bacteria 2818991444 2819588328 317
38 iso_pu_bacteria 2884791551 2884792958 317
39 3300005334 Ga0068869_100071563 Ga0068869_1000715633 319
40 3300005340 Ga0070689_100195587 Ga0070689_1001955871 319
41 3300005438 Ga0070701_10080964 Ga0070701_100809642 319
42 3300005466 Ga0070685_10142274 Ga0070685_101422741 319
43 3300005471 Ga0070698_100008358 Ga0070698_10000835813 319
44 3300005471 Ga0070698_100024291 Ga0070698_1000242914 319
45 3300005544 Ga0070686_100304823 Ga0070686_1003048232 319
46 3300005577 Ga0068857_100625372 Ga0068857_1006253721 319
47 3300005618 Ga0068864_100347004 Ga0068864_1003470042 319
48 3300005841 Ga0068863_100037816 Ga0068863_1000378163 319
49 3300005841 Ga0068863_100204435 Ga0068863_1002044353 319
50 3300006846 Ga0075430_100017225 Ga0075430_1000172255 319
51 3300006846 Ga0075430_100324622 Ga0075430_1003246221 319
52 3300006880 Ga0075429_100007106 Ga0075429_1000071067 319
53 3300006880 Ga0075429_100055246 Ga0075429_1000552463 319
54 3300009094 Ga0111539_10204352 Ga0111539_102043522 319
55 3300009147 Ga0114129_10082907 Ga0114129_100829074 319
56 3300009176 Ga0105242_10031547 Ga0105242_100315474 319
57 3300009553 Ga0105249_10178554 Ga0105249_101785543 319
58 3300011119 Ga0105246_10209913 Ga0105246_102099132 319
59 3300013306 Ga0163162_10239607 Ga0163162_102396073 319
60 3300013306 Ga0163162_10504209 Ga0163162_105042092 319
61 3300014325 Ga0163163_10305433 Ga0163163_103054332 319
62 3300014326 Ga0157380_10130411 Ga0157380_101304112 319
63 3300014968 Ga0157379_10317715 Ga0157379_103177152 319
64 3300014969 Ga0157376_10052116 Ga0157376_100521161 319
65 3300025918 Ga0207662_10005791 Ga0207662_100057912 319
66 3300025934 Ga0207686_10000956 Ga0207686_1000095617 319
67 3300025942 Ga0207689_10025898 Ga0207689_100258982 319
68 3300025960 Ga0207651_10111792 Ga0207651_101117921 319
69 3300025961 Ga0207712_10138008 Ga0207712_101380082 319
70 3300025986 Ga0207658_10064770 Ga0207658_100647702 319
71 3300026088 Ga0207641_10013101 Ga0207641_100131016 319
72 3300026088 Ga0207641_10017176 Ga0207641_100171766 319
73 3300026088 Ga0207641_10122431 Ga0207641_101224313 319
74 3300050507 nmdc:mga05p37_98637_c1 nmdc:mga05p37_98637_c1_2324_3283 319
75 3300050508 nmdc:mga09592_37183_c1 nmdc:mga09592_37183_c1_216_1175 319
76 3300050509 nmdc:mga0qj67_28943_c1 nmdc:mga0qj67_28943_c1_1820_2779 319
77 3300050511 nmdc:mga08y16_91234_c1 nmdc:mga08y16_91234_c1_1948_2907 319
78 3300002459 JGI24751J29686_10000670 JGI24751J29686_100006704 321
79 3300003316 rootH1_10113424 rootH1_101134242 321
80 3300003322 rootL2_10090870 rootL2_100908701 321
81 3300003354 JGI25160J50197_1004406 JGI25160J50197_10044063 321
82 3300005290 Ga0065712_10072979 Ga0065712_100729793 321
83 3300005327 Ga0070658_10027736 Ga0070658_100277363 321
84 3300005329 Ga0070683_100020984 Ga0070683_1000209842 321
85 3300005329 Ga0070683_100025338 Ga0070683_1000253382 321
86 3300005329 Ga0070683_100221820 Ga0070683_1002218202 321
87 3300005331 Ga0070670_100020032 Ga0070670_1000200322 321
88 3300005331 Ga0070670_100116021 Ga0070670_1001160213 321
89 3300005331 Ga0070670_100208677 Ga0070670_1002086772 321
90 3300005331 Ga0070670_100313540 Ga0070670_1003135402 321
91 3300005331 Ga0070670_100345598 Ga0070670_1003455982 321
92 3300005334 Ga0068869_100005451 Ga0068869_1000054517 321
93 3300005334 Ga0068869_100022204 Ga0068869_1000222043 321
94 3300005334 Ga0068869_100030108 Ga0068869_1000301082 321
95 3300005334 Ga0068869_100083184 Ga0068869_1000831843 321
96 3300005334 Ga0068869_100207230 Ga0068869_1002072302 321
97 3300005335 Ga0070666_10011914 Ga0070666_100119145 321
98 3300005335 Ga0070666_10101801 Ga0070666_101018012 321
99 3300005335 Ga0070666_10215662 Ga0070666_102156622 321
100 3300005336 Ga0070680_100266458 Ga0070680_1002664582 321
101 3300005336 Ga0070680_100342688 Ga0070680_1003426881 321
102 3300005338 Ga0068868_100002169 Ga0068868_1000021693 321
103 3300005338 Ga0068868_100030431 Ga0068868_1000304312 321
104 3300005338 Ga0068868_100324765 Ga0068868_1003247652 321
105 3300005340 Ga0070689_100060565 Ga0070689_1000605652 321
106 3300005340 Ga0070689_100065482 Ga0070689_1000654822 321
107 3300005344 Ga0070661_100078176 Ga0070661_1000781761 321
108 3300005344 Ga0070661_100104292 Ga0070661_1001042923 321
109 3300005347 Ga0070668_100015981 Ga0070668_1000159812 321
110 3300005353 Ga0070669_100100487 Ga0070669_1001004872 321
111 3300005354 Ga0070675_100034503 Ga0070675_1000345032 321
112 3300005354 Ga0070675_100099600 Ga0070675_1000996002 321
113 3300005354 Ga0070675_100312268 Ga0070675_1003122681 321
114 3300005355 Ga0070671_100004909 Ga0070671_10000490910 321
115 3300005364 Ga0070673_100014013 Ga0070673_1000140132 321
116 3300005364 Ga0070673_100038061 Ga0070673_1000380612 321
117 3300005364 Ga0070673_100289879 Ga0070673_1002898792 321
118 3300005365 Ga0070688_100004110 Ga0070688_1000041101 321
119 3300005365 Ga0070688_100021037 Ga0070688_1000210373 321
120 3300005365 Ga0070688_100109071 Ga0070688_1001090712 321
121 3300005366 Ga0070659_100038067 Ga0070659_1000380672 321
122 3300005367 Ga0070667_100004254 Ga0070667_1000042544 321
123 3300005367 Ga0070667_100060865 Ga0070667_1000608652 321
124 3300005367 Ga0070667_100225644 Ga0070667_1002256442 321
125 3300005367 Ga0070667_100337532 Ga0070667_1003375321 321
126 3300005367 Ga0070667_100427934 Ga0070667_1004279341 321
127 3300005438 Ga0070701_10162406 Ga0070701_101624061 321
128 3300005441 Ga0070700_100140706 Ga0070700_1001407062 321
129 3300005456 Ga0070678_100336227 Ga0070678_1003362272 321
130 3300005457 Ga0070662_100002745 Ga0070662_1000027457 321
131 3300005457 Ga0070662_100016213 Ga0070662_1000162132 321
132 3300005459 Ga0068867_100014886 Ga0068867_1000148862 321
133 3300005459 Ga0068867_100041072 Ga0068867_1000410721 321
134 3300005459 Ga0068867_100059622 Ga0068867_1000596222 321
135 3300005459 Ga0068867_100160303 Ga0068867_1001603031 321
136 3300005459 Ga0068867_100201720 Ga0068867_1002017201 321
137 3300005466 Ga0070685_10072481 Ga0070685_100724812 321
138 3300005535 Ga0070684_100001436 Ga0070684_10000143615 321
139 3300005539 Ga0068853_100369371 Ga0068853_1003693711 321
140 3300005548 Ga0070665_100027910 Ga0070665_1000279104 321
141 3300005563 Ga0068855_100357723 Ga0068855_1003577232 321
142 3300005564 Ga0070664_100017280 Ga0070664_1000172802 321
143 3300005564 Ga0070664_100021674 Ga0070664_1000216743 321
144 3300005564 Ga0070664_100102243 Ga0070664_1001022432 321
145 3300005564 Ga0070664_100128491 Ga0070664_1001284912 321
146 3300005564 Ga0070664_100143375 Ga0070664_1001433753 321
147 3300005577 Ga0068857_100011178 Ga0068857_1000111784 321
148 3300005577 Ga0068857_100058150 Ga0068857_1000581502 321
149 3300005578 Ga0068854_100275506 Ga0068854_1002755062 321
150 3300005578 Ga0068854_100276118 Ga0068854_1002761182 321
151 3300005616 Ga0068852_100140790 Ga0068852_1001407902 321
152 3300005617 Ga0068859_100020315 Ga0068859_1000203153 321
153 3300005617 Ga0068859_100027739 Ga0068859_1000277392 321
154 3300005617 Ga0068859_100324924 Ga0068859_1003249242 321
155 3300005617 Ga0068859_100408359 Ga0068859_1004083592 321
156 3300005618 Ga0068864_100006025 Ga0068864_1000060254 321
157 3300005618 Ga0068864_100058823 Ga0068864_1000588233 321
158 3300005618 Ga0068864_100083513 Ga0068864_1000835133 321
159 3300005618 Ga0068864_100532763 Ga0068864_1005327631 321
160 3300005718 Ga0068866_10223497 Ga0068866_102234971 321
161 3300005834 Ga0068851_10010694 Ga0068851_100106943 321
162 3300005834 Ga0068851_10090022 Ga0068851_100900222 321
163 3300005841 Ga0068863_100217593 Ga0068863_1002175932 321
164 3300005842 Ga0068858_100018630 Ga0068858_1000186302 321
165 3300005842 Ga0068858_100107515 Ga0068858_1001075153 321
166 3300005842 Ga0068858_100357498 Ga0068858_1003574982 321
167 3300005843 Ga0068860_100003295 Ga0068860_1000032959 321
168 3300005843 Ga0068860_100069931 Ga0068860_1000699313 321
169 3300005843 Ga0068860_100404057 Ga0068860_1004040572 321
170 3300005844 Ga0068862_100074000 Ga0068862_1000740002 321
171 3300005844 Ga0068862_100198292 Ga0068862_1001982922 321
172 3300006195 Ga0075366_10013047 Ga0075366_100130474 321
173 3300006237 Ga0097621_100097896 Ga0097621_1000978962 321
174 3300006871 Ga0075434_100051074 Ga0075434_1000510742 321
175 3300006881 Ga0068865_100188868 Ga0068865_1001888682 321
176 3300006931 Ga0097620_100020314 Ga0097620_1000203143 321
177 3300006931 Ga0097620_100027743 Ga0097620_1000277432 321
178 3300006931 Ga0097620_100324923 Ga0097620_1003249232 321
179 3300006931 Ga0097620_100408378 Ga0097620_1004083782 321
180 3300009094 Ga0111539_10005334 Ga0111539_100053349 321
181 3300009094 Ga0111539_10376164 Ga0111539_103761641 321
182 3300009101 Ga0105247_10002918 Ga0105247_100029184 321
183 3300009545 Ga0105237_10002901 Ga0105237_1000290114 321
184 3300009553 Ga0105249_10002459 Ga0105249_100024592 321
185 3300009553 Ga0105249_10010476 Ga0105249_100104765 321
186 3300009553 Ga0105249_10113693 Ga0105249_101136931 321
187 3300009553 Ga0105249_10143095 Ga0105249_101430952 321
188 3300010375 Ga0105239_10003300 Ga0105239_100033004 321
189 3300013100 Ga0157373_10066376 Ga0157373_100663762 321
190 3300013100 Ga0157373_10100667 Ga0157373_101006671 321
191 3300013102 Ga0157371_10018584 Ga0157371_100185844 321
192 3300013104 Ga0157370_10017741 Ga0157370_100177412 321
193 3300013104 Ga0157370_10055400 Ga0157370_100554002 321
194 3300013104 Ga0157370_10298854 Ga0157370_102988541 321
195 3300013105 Ga0157369_10010265 Ga0157369_100102653 321
196 3300013296 Ga0157374_10001792 Ga0157374_100017927 321
197 3300013296 Ga0157374_10002989 Ga0157374_100029899 321
198 3300013296 Ga0157374_10017838 Ga0157374_100178386 321
199 3300013296 Ga0157374_10023310 Ga0157374_100233106 321
200 3300013296 Ga0157374_10024277 Ga0157374_100242772 321
201 3300013296 Ga0157374_10046313 Ga0157374_100463132 321
202 3300013296 Ga0157374_10152532 Ga0157374_101525322 321
203 3300013296 Ga0157374_10249856 Ga0157374_102498562 321
204 3300013297 Ga0157378_10000623 Ga0157378_1000062316 321
205 3300013297 Ga0157378_10023262 Ga0157378_100232625 321
206 3300013297 Ga0157378_10103875 Ga0157378_101038753 321
207 3300013297 Ga0157378_10164108 Ga0157378_101641082 321
208 3300013306 Ga0163162_10014936 Ga0163162_100149366 321
209 3300013306 Ga0163162_10019081 Ga0163162_100190813 321
210 3300013306 Ga0163162_10095720 Ga0163162_100957202 321
211 3300013306 Ga0163162_10105637 Ga0163162_101056372 321
212 3300013306 Ga0163162_10351285 Ga0163162_103512852 321
213 3300013306 Ga0163162_10414272 Ga0163162_104142722 321
214 3300013306 Ga0163162_10614272 Ga0163162_106142721 321
215 3300013307 Ga0157372_10067783 Ga0157372_100677832 321
216 3300013307 Ga0157372_10269989 Ga0157372_102699892 321
217 3300013307 Ga0157372_10544064 Ga0157372_105440642 321
218 3300013307 Ga0157372_10776019 Ga0157372_107760192 321
219 3300013308 Ga0157375_10002063 Ga0157375_100020639 321
220 3300013308 Ga0157375_10029071 Ga0157375_100290712 321
221 3300013308 Ga0157375_10044554 Ga0157375_100445543 321
222 3300013308 Ga0157375_10071174 Ga0157375_100711742 321
223 3300014325 Ga0163163_10000982 Ga0163163_100009823 321
224 3300014325 Ga0163163_10014724 Ga0163163_100147242 321
225 3300014325 Ga0163163_10160396 Ga0163163_101603962 321
226 3300014326 Ga0157380_10005287 Ga0157380_100052876 321
227 3300014326 Ga0157380_10289323 Ga0157380_102893232 321
228 3300014745 Ga0157377_10002833 Ga0157377_100028335 321
229 3300014745 Ga0157377_10063174 Ga0157377_100631742 321
230 3300014745 Ga0157377_10065006 Ga0157377_100650061 321
231 3300014745 Ga0157377_10066176 Ga0157377_100661762 321
232 3300014745 Ga0157377_10326468 Ga0157377_103264681 321
233 3300014968 Ga0157379_10068707 Ga0157379_100687072 321
234 3300014969 Ga0157376_10000779 Ga0157376_1000077910 321
235 3300017792 Ga0163161_10014865 Ga0163161_100148652 321
236 3300017792 Ga0163161_10078638 Ga0163161_100786382 321
237 3300025302 Ga0207426_1000019 Ga0207426_1000019325 321
238 3300025900 Ga0207710_10003867 Ga0207710_100038673 321
239 3300025903 Ga0207680_10057279 Ga0207680_100572792 321
240 3300025907 Ga0207645_10013083 Ga0207645_100130834 321
241 3300025907 Ga0207645_10096687 Ga0207645_100966873 321
242 3300025907 Ga0207645_10126101 Ga0207645_101261012 321
243 3300025908 Ga0207643_10023029 Ga0207643_100230293 321
244 3300025918 Ga0207662_10029629 Ga0207662_100296292 321
245 3300025920 Ga0207649_10127391 Ga0207649_101273912 321
246 3300025923 Ga0207681_10271124 Ga0207681_102711242 321
247 3300025925 Ga0207650_10001510 Ga0207650_100015105 321
248 3300025925 Ga0207650_10076897 Ga0207650_100768973 321
249 3300025925 Ga0207650_10175598 Ga0207650_101755982 321
250 3300025925 Ga0207650_10302775 Ga0207650_103027752 321
251 3300025926 Ga0207659_10087786 Ga0207659_100877862 321
252 3300025932 Ga0207690_10004919 Ga0207690_100049198 321
253 3300025933 Ga0207706_10023150 Ga0207706_100231504 321
254 3300025933 Ga0207706_10029649 Ga0207706_100296493 321
255 3300025933 Ga0207706_10149743 Ga0207706_101497432 321
256 3300025933 Ga0207706_10187629 Ga0207706_101876292 321
257 3300025933 Ga0207706_10261587 Ga0207706_102615872 321
258 3300025936 Ga0207670_10158195 Ga0207670_101581951 321
259 3300025937 Ga0207669_10241294 Ga0207669_102412942 321
260 3300025938 Ga0207704_10010871 Ga0207704_100108713 321
261 3300025938 Ga0207704_10115028 Ga0207704_101150282 321
262 3300025940 Ga0207691_10020974 Ga0207691_100209743 321
263 3300025942 Ga0207689_10001172 Ga0207689_1000117216 321
264 3300025942 Ga0207689_10019839 Ga0207689_100198393 321
265 3300025942 Ga0207689_10042041 Ga0207689_100420412 321
266 3300025942 Ga0207689_10067854 Ga0207689_100678542 321
267 3300025942 Ga0207689_10208945 Ga0207689_102089452 321
268 3300025944 Ga0207661_10030914 Ga0207661_100309143 321
269 3300025944 Ga0207661_10100104 Ga0207661_101001042 321
270 3300025944 Ga0207661_10125844 Ga0207661_101258441 321
271 3300025945 Ga0207679_10004312 Ga0207679_100043127 321
272 3300025945 Ga0207679_10018046 Ga0207679_100180462 321
273 3300025945 Ga0207679_10019851 Ga0207679_100198513 321
274 3300025945 Ga0207679_10055476 Ga0207679_100554763 321
275 3300025945 Ga0207679_10367749 Ga0207679_103677491 321
276 3300025949 Ga0207667_10319470 Ga0207667_103194701 321
277 3300025960 Ga0207651_10281756 Ga0207651_102817562 321
278 3300025961 Ga0207712_10005316 Ga0207712_100053165 321
279 3300025961 Ga0207712_10016265 Ga0207712_100162652 321
280 3300025961 Ga0207712_10236001 Ga0207712_102360012 321
281 3300025972 Ga0207668_10155272 Ga0207668_101552722 321
282 3300025981 Ga0207640_10214618 Ga0207640_102146181 321
283 3300025981 Ga0207640_10266326 Ga0207640_102663262 321
284 3300025986 Ga0207658_10211258 Ga0207658_102112583 321
285 3300026023 Ga0207677_10225421 Ga0207677_102254212 321
286 3300026023 Ga0207677_10264634 Ga0207677_102646342 321
287 3300026035 Ga0207703_10025279 Ga0207703_100252793 321
288 3300026088 Ga0207641_10184311 Ga0207641_101843112 321
289 3300026089 Ga0207648_10002631 Ga0207648_100026313 321
290 3300026089 Ga0207648_10009027 Ga0207648_100090279 321
291 3300026089 Ga0207648_10026467 Ga0207648_100264675 321
292 3300026089 Ga0207648_10029653 Ga0207648_100296534 321
293 3300026089 Ga0207648_10164205 Ga0207648_101642052 321
294 3300026095 Ga0207676_10006956 Ga0207676_100069561 321
295 3300026095 Ga0207676_10009281 Ga0207676_100092814 321
296 3300026095 Ga0207676_10061034 Ga0207676_100610343 321
297 3300026095 Ga0207676_10067797 Ga0207676_100677972 321
298 3300026095 Ga0207676_10229026 Ga0207676_102290262 321
299 3300026116 Ga0207674_10001383 Ga0207674_1000138312 321
300 3300026116 Ga0207674_10038280 Ga0207674_100382803 321
301 3300026118 Ga0207675_100042514 Ga0207675_1000425142 321
302 3300026121 Ga0207683_10025898 Ga0207683_100258983 321
303 3300026121 Ga0207683_10495441 Ga0207683_104954411 321
304 3300026142 Ga0207698_10137729 Ga0207698_101377292 321
305 3300026142 Ga0207698_10303734 Ga0207698_103037341 321
306 3300028380 Ga0268265_10110228 Ga0268265_101102283 321
307 3300028380 Ga0268265_10152614 Ga0268265_101526141 321
308 3300028380 Ga0268265_10290669 Ga0268265_102906691 321
309 3300028381 Ga0268264_10159256 Ga0268264_101592562 321
310 3300028381 Ga0268264_10276330 Ga0268264_102763301 321
311 3300031251 Ga0265327_10000054 Ga0265327_10000054117 321
312 3300035725 Ga0373947_0180486 Ga0373947_0180486_380_1345 321
313 3300037466 Ga0395898_0412944 Ga0395898_0412944_95_1060 321
314 3300037471 Ga0395905_0250512 Ga0395905_0250512_378_1343 321
315 3300037471 Ga0395905_0322842 Ga0395905_0322842_433_1398 321
316 3300044712 Ga0453684_0157181 Ga0453684_0157181_577_1542 321
317 3300046460 Ga0495638_0133070 Ga0495638_0133070_258_1223 321
318 3300047320 Ga0495672_0067479 Ga0495672_0067479_553_1518 321
319 3300047321 Ga0495676_0254278 Ga0495676_0254278_97_1062 321
320 3300047472 Ga0495686_0055773 Ga0495686_0055773_37_1002 321
321 3300048912 Ga0496109_0423388 Ga0496109_0423388_60_1025 321
322 3300048913 Ga0496110_0117115 Ga0496110_0117115_649_1614 321
323 3300049581 Ga0501047_0149501 Ga0501047_0149501_791_1756 321
324 3300049588 Ga0501072_0039565 Ga0501072_0039565_893_1858 321
325 3300049686 Ga0501257_012319 Ga0501257_012319_627_1592 321
326 3300050511 nmdc:mga08y16_257410_c1 nmdc:mga08y16_257410_c1_454_1419 321
327 3300050511 nmdc:mga08y16_280622_c1 nmdc:mga08y16_280622_c1_342_1307 321
328 3300050512 nmdc:mga0n895_38625_c1 nmdc:mga0n895_38625_c1_581_1546 321
329 3300053139 Ga0500568_0001662 Ga0500568_0001662_4853_5818 321
330 3300053727 Ga0500611_000098 Ga0500611_000098_284_1249 321
331 3300053730 Ga0500645_008071 Ga0500645_008071_380_1345 321
332 3300001989 JGI24739J22299_10050999 JGI24739J22299_100509991 322
333 3300005329 Ga0070683_100002184 Ga0070683_10000218410 322
334 3300005335 Ga0070666_10026275 Ga0070666_100262752 322
335 3300005337 Ga0070682_100005005 Ga0070682_1000050051 322
336 3300005338 Ga0068868_100018452 Ga0068868_1000184522 322
337 3300005339 Ga0070660_100073057 Ga0070660_1000730572 322
338 3300005340 Ga0070689_100271812 Ga0070689_1002718122 322
339 3300005354 Ga0070675_100016538 Ga0070675_1000165382 322
340 3300005366 Ga0070659_100005333 Ga0070659_1000053336 322
341 3300005366 Ga0070659_100415330 Ga0070659_1004153301 322
342 3300005457 Ga0070662_100005009 Ga0070662_1000050092 322
343 3300005458 Ga0070681_10061851 Ga0070681_100618512 322
344 3300005459 Ga0068867_100263278 Ga0068867_1002632781 322
345 3300005530 Ga0070679_100127627 Ga0070679_1001276272 322
346 3300005535 Ga0070684_100096517 Ga0070684_1000965172 322
347 3300005539 Ga0068853_100053609 Ga0068853_1000536092 322
348 3300005547 Ga0070693_100033522 Ga0070693_1000335222 322
349 3300005563 Ga0068855_100024392 Ga0068855_1000243927 322
350 3300005564 Ga0070664_100018244 Ga0070664_1000182442 322
351 3300005577 Ga0068857_100076541 Ga0068857_1000765413 322
352 3300005578 Ga0068854_100037871 Ga0068854_1000378712 322
353 3300005614 Ga0068856_100123383 Ga0068856_1001233833 322
354 3300005616 Ga0068852_100247196 Ga0068852_1002471961 322
355 3300005985 Ga0081539_10000337 Ga0081539_1000033758 322
356 3300006237 Ga0097621_100001126 Ga0097621_1000011269 322
357 3300006237 Ga0097621_100001728 Ga0097621_1000017286 322
358 3300006358 Ga0068871_100001247 Ga0068871_1000012478 322
359 3300006358 Ga0068871_100041210 Ga0068871_1000412102 322
360 3300013100 Ga0157373_10072399 Ga0157373_100723992 322
361 3300013102 Ga0157371_10000913 Ga0157371_100009132 322
362 3300013102 Ga0157371_10055194 Ga0157371_100551943 322
363 3300013104 Ga0157370_10002692 Ga0157370_1000269214 322
364 3300013307 Ga0157372_10057057 Ga0157372_100570572 322
365 3300013307 Ga0157372_10069455 Ga0157372_100694553 322
366 3300014325 Ga0163163_10004922 Ga0163163_100049222 322
367 3300014968 Ga0157379_10193112 Ga0157379_101931122 322
368 3300017792 Ga0163161_10014155 Ga0163161_100141552 322
369 3300025903 Ga0207680_10053545 Ga0207680_100535453 322
370 3300025904 Ga0207647_10046315 Ga0207647_100463152 322
371 3300025909 Ga0207705_10047362 Ga0207705_100473622 322
372 3300025909 Ga0207705_10061884 Ga0207705_100618842 322
373 3300025912 Ga0207707_10049334 Ga0207707_100493343 322
374 3300025919 Ga0207657_10001051 Ga0207657_1000105119 322
375 3300025931 Ga0207644_10083110 Ga0207644_100831102 322
376 3300025932 Ga0207690_10009016 Ga0207690_100090164 322
377 3300025933 Ga0207706_10001391 Ga0207706_1000139112 322
378 3300025949 Ga0207667_10069144 Ga0207667_100691441 322
379 3300025949 Ga0207667_10355710 Ga0207667_103557102 322
380 3300025960 Ga0207651_10022196 Ga0207651_100221963 322
381 3300025981 Ga0207640_10039939 Ga0207640_100399393 322
382 3300025986 Ga0207658_10005723 Ga0207658_100057234 322
383 3300025986 Ga0207658_10295470 Ga0207658_102954701 322
384 3300026041 Ga0207639_10036791 Ga0207639_100367912 322
385 3300026078 Ga0207702_10026226 Ga0207702_100262263 322
386 3300026095 Ga0207676_10069988 Ga0207676_100699882 322
387 3300026116 Ga0207674_10078069 Ga0207674_100780692 322
388 3300037312 Ga0395899_0009094 Ga0395899_0009094_528_1511 322
389 3300037312 Ga0395899_0193939 Ga0395899_0193939_315_1352 322
390 3300037418 Ga0395900_0041546 Ga0395900_0041546_1431_2414 322
391 3300037466 Ga0395898_0080842 Ga0395898_0080842_1255_2292 322
392 3300037466 Ga0395898_0240524 Ga0395898_0240524_142_1125 322
393 3300038443 Ga0395901_0001630 Ga0395901_0001630_14235_15218 322
394 3300049571 Ga0501034_0007113 Ga0501034_0007113_2528_3562 322
395 3300049822 Ga0501035_0007281 Ga0501035_0007281_4848_5882 322
396 3300053088 Ga0500644_0008655 Ga0500644_0008655_83_1051 322
397 3300053108 Ga0500562_000020 Ga0500562_000020_10505_11473 322
398 3300053156 Ga0500622_0000467 Ga0500622_0000467_21463_22461 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00348

polyprenyl_synt

Polyprenyl synthetase

76

327

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kd7-assembly1.cif.gz_A crystal structure of geranylgeranyl pyrophosphate synthase 0.9443 2 322
6kd7-assembly1.cif.gz_A crystal structure of geranylgeranyl pyrophosphate synthase 0.9387 2 322
1wy0-assembly1.cif.gz_A-2 crystal structure of geranylgeranyl pyrophosphate synthetase from pyrococcus horikoshii ot3 0.9263 5 321
7my7-assembly2.cif.gz_CCC se-crte n-term his-tag structure 0.9134 5 207
1wy0-assembly1.cif.gz_A-2 crystal structure of geranylgeranyl pyrophosphate synthetase from pyrococcus horikoshii ot3 0.9098 5 321
ID Description Score Start End Superfamily
af_Q58270_13_326_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9281 8 320 1.10.600.10
1wy0A00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9263 5 321 1.10.600.10
af_P0AD57_1_323_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9191 5 322 1.10.600.10
af_O50410_18_349_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9158 5 321 1.10.600.10
1wy0A00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9098 5 321 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A4Q5QMM2-F1-model_v4 Polyprenyl synthetase family protein 0.9974 2 202 GO:0004659
GO:0008299
AF-A0A4Q5RHP3-F1-model_v4 Polyprenyl synthetase family protein 0.992 2 195 GO:0004659
GO:0008299
AF-A0A257HV32-F1-model_v4 Polyprenyl synthetase 0.9888 2 322 GO:0004659
GO:0008299
AF-A0A4Q5QMM2-F1-model_v4 Polyprenyl synthetase family protein 0.9876 2 202 GO:0004659
GO:0008299
AF-A0A1M4XRC0-F1-model_v4 Geranylgeranyl diphosphate synthase, type II 0.9874 2 322 GO:0004659
GO:0008299

Feature Viewer

pLDDT pTM Quality
94.7 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map