F434093

General Info

Members Datasets Scaffolds Average Seq Length
398 163 396 158

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0050041|Ga0395900_0050041_1381_1848
Length 155
Sequence MDDVGVPRGATPDRDHEGWYSWGDFPRSSFAAATGRLLFKPDGPGRGICRMFPTDDHMNMGGSIHGGAVMSFIDMSLFAGGLCAGMERAHYVTLDLTTHFLARGQAGSPLDSHVELVRQTRGHAFLQGVVKQNGENCYSFSGTLKKVARPNAPTR

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
125 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
126 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
155 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
156 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
157 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
158 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
159 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
160 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
161 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
162 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.76
Rhizosphere 97.74
Stem 0
Stem Tuber 0.25
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000774 3300001977 Bacteria 4918
2 JGI24749J21850_1018751 3300002076 Bacteria 977
3 Ga0065712_10078870 3300005290 Bacteria 3284
4 Ga0065715_10132786 3300005293 Bacteria 1984
5 Ga0065715_10168795 3300005293 Bacteria 1564
6 Ga0065715_10273161 3300005293 Bacteria 1069
7 Ga0065707_10245082 3300005295 Bacteria 1143
8 Ga0070658_10135565 3300005327 Bacteria 2054
9 Ga0070658_10706699 3300005327 Bacteria 875
10 Ga0070676_10004290 3300005328 Bacteria 7489
11 Ga0070683_100736331 3300005329 Bacteria 944
12 Ga0070690_100274157 3300005330 Bacteria 1201
13 Ga0070670_100003242 3300005331 Bacteria 13437
14 Ga0070670_100009025 3300005331 Bacteria 8518
15 Ga0070670_100113909 3300005331 Bacteria 2331
16 Ga0070677_10000720 3300005333 Bacteria 11056
17 Ga0070660_100183709 3300005339 Bacteria 1693
18 Ga0070660_100751727 3300005339 Bacteria 819
19 Ga0070687_100247379 3300005343 Bacteria 1106
20 Ga0070661_100029476 3300005344 Bacteria 3962
21 Ga0070661_100097549 3300005344 Bacteria 2182
22 Ga0070661_100105587 3300005344 Bacteria 2100
23 Ga0070668_100142157 3300005347 Bacteria 1935
24 Ga0070668_100296925 3300005347 Bacteria 1354
25 Ga0070669_100009022 3300005353 Bacteria 7111
26 Ga0070669_100170570 3300005353 Bacteria 1696
27 Ga0070669_100604617 3300005353 Bacteria 919
28 Ga0070675_100003625 3300005354 Bacteria 11742
29 Ga0070675_100004856 3300005354 Bacteria 10257
30 Ga0070671_100010885 3300005355 Bacteria 7304
31 Ga0070671_100896153 3300005355 Bacteria 775
32 Ga0070674_100184585 3300005356 Bacteria 1600
33 Ga0070673_100000497 3300005364 Bacteria 20985
34 Ga0070659_100001394 3300005366 Bacteria 17436
35 Ga0070659_100102786 3300005366 Bacteria 2301
36 Ga0070667_100007689 3300005367 Bacteria 8939
37 Ga0070667_100022762 3300005367 Bacteria 5196
38 Ga0070663_100365474 3300005455 Bacteria 1171
39 Ga0070678_100019463 3300005456 Bacteria 4427
40 Ga0070678_100947681 3300005456 Bacteria 789
41 Ga0070662_100001966 3300005457 Bacteria 12622
42 Ga0070662_100021674 3300005457 Bacteria 4391
43 Ga0070662_100829711 3300005457 Bacteria 787
44 Ga0070672_100001933 3300005543 Bacteria 13014
45 Ga0070672_100003046 3300005543 Bacteria 10798
46 Ga0070672_100888329 3300005543 Bacteria 787
47 Ga0070665_100490251 3300005548 Bacteria 1240
48 Ga0070704_100240631 3300005549 Bacteria 1481
49 Ga0068855_100007354 3300005563 Bacteria 13335
50 Ga0068855_100292206 3300005563 Bacteria 1806
51 Ga0070664_100003799 3300005564 Bacteria 12191
52 Ga0070664_100018308 3300005564 Bacteria 5751
53 Ga0068857_100410244 3300005577 Bacteria 1261
54 Ga0068854_100001522 3300005578 Bacteria 14062
55 Ga0068854_100144399 3300005578 Bacteria 1829
56 Ga0068854_100485829 3300005578 Bacteria 1037
57 Ga0068856_100021355 3300005614 Bacteria 6293
58 Ga0068856_101153171 3300005614 Bacteria 792
59 Ga0068852_100002128 3300005616 Bacteria 13573
60 Ga0068852_101342940 3300005616 Bacteria 737
61 Ga0068852_101343194 3300005616 Bacteria 737
62 Ga0068859_100008026 3300005617 Bacteria 10703
63 Ga0068864_100023546 3300005618 Bacteria 5172
64 Ga0068864_100354051 3300005618 Bacteria 1386
65 Ga0068866_10963158 3300005718 Bacteria 604
66 Ga0068861_100069888 3300005719 Bacteria 2718
67 Ga0068860_100201314 3300005843 Bacteria 1930
68 Ga0068862_100115672 3300005844 Bacteria 2359
69 Ga0068862_100287545 3300005844 Bacteria 1509
70 Ga0097621_100428809 3300006237 Bacteria 1188
71 Ga0075431_100180285 3300006847 Bacteria 2168
72 Ga0075433_10897803 3300006852 Bacteria 773
73 Ga0097620_100008026 3300006931 Bacteria 10703
74 Ga0105240_10031879 3300009093 Bacteria 6829
75 Ga0111539_10243402 3300009094 Bacteria 2094
76 Ga0114129_11316248 3300009147 Bacteria 895
77 Ga0105248_10002607 3300009177 Bacteria 20059
78 Ga0105248_10761345 3300009177 Bacteria 1093
79 Ga0105238_10465226 3300009551 Bacteria 1263
80 Ga0105249_10030435 3300009553 Bacteria 4880
81 Ga0105249_10972932 3300009553 Bacteria 917
82 Ga0157373_10005240 3300013100 Bacteria 9733
83 Ga0157373_10438239 3300013100 Bacteria 939
84 Ga0157371_10006979 3300013102 Bacteria 9191
85 Ga0157371_10216613 3300013102 Bacteria 1375
86 Ga0157371_10342389 3300013102 Bacteria 1088
87 Ga0157370_10317374 3300013104 Bacteria 1438
88 Ga0157370_11136567 3300013104 Bacteria 705
89 Ga0157369_10001975 3300013105 Bacteria 24741
90 Ga0157369_10022724 3300013105 Bacteria 6994
91 Ga0157369_10456512 3300013105 Bacteria 1323
92 Ga0163162_10231528 3300013306 Bacteria 1978
93 Ga0157372_10844767 3300013307 Bacteria 1063
94 Ga0157375_10427591 3300013308 Bacteria 1490
95 Ga0157375_11774274 3300013308 Bacteria 731
96 Ga0163163_10104733 3300014325 Bacteria 2854
97 Ga0163163_11961783 3300014325 Bacteria 645
98 Ga0157380_10001477 3300014326 Bacteria 15380
99 Ga0157380_10001524 3300014326 Bacteria 15215
100 Ga0157380_10021905 3300014326 Bacteria 4800
101 Ga0157380_10067598 3300014326 Bacteria 2878
102 Ga0163161_10021139 3300017792 Bacteria 4574
103 Ga0163161_10076584 3300017792 Bacteria 2455
104 Ga0207697_10007792 3300025315 Bacteria 4743
105 Ga0207697_10147975 3300025315 Bacteria 1021
106 Ga0207682_10000874 3300025893 Bacteria 13976
107 Ga0207688_10032959 3300025901 Bacteria 2863
108 Ga0207688_10417154 3300025901 Bacteria 834
109 Ga0207645_10004717 3300025907 Bacteria 10030
110 Ga0207705_10000622 3300025909 Bacteria 29600
111 Ga0207705_10098430 3300025909 Bacteria 2149
112 Ga0207705_10704671 3300025909 Bacteria 785
113 Ga0207695_10018483 3300025913 Bacteria 8058
114 Ga0207695_10031372 3300025913 Bacteria 5829
115 Ga0207657_10038552 3300025919 Bacteria 4254
116 Ga0207649_10002360 3300025920 Bacteria 10582
117 Ga0207681_10002843 3300025923 Bacteria 10951
118 Ga0207681_10067017 3300025923 Bacteria 2487
119 Ga0207681_10316553 3300025923 Bacteria 1239
120 Ga0207681_10378463 3300025923 Bacteria 1139
121 Ga0207650_10001007 3300025925 Bacteria 21201
122 Ga0207650_10002935 3300025925 Bacteria 11760
123 Ga0207650_10035723 3300025925 Bacteria 3611
124 Ga0207659_10003726 3300025926 Bacteria 9186
125 Ga0207659_10009082 3300025926 Bacteria 6202
126 Ga0207644_10001095 3300025931 Bacteria 17391
127 Ga0207644_10171159 3300025931 Bacteria 1695
128 Ga0207690_10001193 3300025932 Bacteria 16417
129 Ga0207706_10000837 3300025933 Bacteria 31802
130 Ga0207706_10026406 3300025933 Bacteria 5199
131 Ga0207706_10233147 3300025933 Bacteria 1610
132 Ga0207709_10415379 3300025935 Bacteria 1032
133 Ga0207669_10058693 3300025937 Bacteria 2349
134 Ga0207691_10001140 3300025940 Bacteria 26349
135 Ga0207691_10005517 3300025940 Bacteria 12221
136 Ga0207711_10024382 3300025941 Bacteria 5067
137 Ga0207711_10585649 3300025941 Bacteria 1041
138 Ga0207661_10226755 3300025944 Bacteria 1653
139 Ga0207679_10001091 3300025945 Bacteria 17278
140 Ga0207667_10042105 3300025949 Bacteria 4857
141 Ga0207667_10094855 3300025949 Bacteria 3080
142 Ga0207667_10209283 3300025949 Bacteria 1999
143 Ga0207651_10002630 3300025960 Bacteria 8584
144 Ga0207712_10003090 3300025961 Bacteria 10621
145 Ga0207668_10002016 3300025972 Bacteria 11853
146 Ga0207668_10081714 3300025972 Bacteria 2345
147 Ga0207668_10302704 3300025972 Bacteria 1320
148 Ga0207668_10834965 3300025972 Bacteria 817
149 Ga0207640_10000363 3300025981 Bacteria 29456
150 Ga0207658_10005039 3300025986 Bacteria 9096
151 Ga0207658_10010161 3300025986 Bacteria 6398
152 Ga0207678_10029870 3300026067 Bacteria 4759
153 Ga0207678_10068372 3300026067 Bacteria 3048
154 Ga0207678_10192045 3300026067 Bacteria 1745
155 Ga0207708_10024565 3300026075 Bacteria 4559
156 Ga0207702_10016188 3300026078 Bacteria 6174
157 Ga0207648_10005430 3300026089 Bacteria 12845
158 Ga0207676_10822830 3300026095 Bacteria 907
159 Ga0207674_10490928 3300026116 Bacteria 1187
160 Ga0207674_10791765 3300026116 Bacteria 915
161 Ga0207675_100021164 3300026118 Bacteria 6059
162 Ga0207683_10054502 3300026121 Bacteria 3506
163 Ga0207683_10149408 3300026121 Bacteria 2108
164 Ga0207698_10008898 3300026142 Bacteria 6366
165 Ga0207698_10167100 3300026142 Bacteria 1932
166 Ga0209983_1038835 3300027665 Bacteria 1027
167 Ga0268265_10269370 3300028380 Bacteria 1518
168 Ga0268265_10348172 3300028380 Bacteria 1352
169 Ga0268265_10816019 3300028380 Bacteria 910
170 Ga0307408_100001902 3300031548 Bacteria 15178
171 Ga0307408_100076998 3300031548 Bacteria 2483
172 Ga0307408_100112354 3300031548 Bacteria 2095
173 Ga0307408_100187396 3300031548 Bacteria 1664
174 Ga0307408_100436666 3300031548 Bacteria 1132
175 Ga0307408_100454067 3300031548 Bacteria 1112
176 Ga0307408_101452955 3300031548 Bacteria 647
177 Ga0307405_10001309 3300031731 Bacteria 10406
178 Ga0307405_10002241 3300031731 Bacteria 8461
179 Ga0307405_10009776 3300031731 Bacteria 4934
180 Ga0307405_10035169 3300031731 Bacteria 2989
181 Ga0307405_10083088 3300031731 Bacteria 2098
182 Ga0307405_10083704 3300031731 Bacteria 2092
183 Ga0307405_10150228 3300031731 Bacteria 1637
184 Ga0307405_10192582 3300031731 Bacteria 1474
185 Ga0307413_10002874 3300031824 Bacteria 7107
186 Ga0307413_10003891 3300031824 Bacteria 6385
187 Ga0307413_10004700 3300031824 Bacteria 5990
188 Ga0307413_10005381 3300031824 Bacteria 5709
189 Ga0307413_10011033 3300031824 Bacteria 4418
190 Ga0307413_10012388 3300031824 Bacteria 4243
191 Ga0307413_10014892 3300031824 Bacteria 3967
192 Ga0307413_10035957 3300031824 Bacteria 2847
193 Ga0307413_10056636 3300031824 Bacteria 2392
194 Ga0307413_10104016 3300031824 Bacteria 1884
195 Ga0307413_10110779 3300031824 Bacteria 1837
196 Ga0307413_10120703 3300031824 Bacteria 1775
197 Ga0307413_10206743 3300031824 Bacteria 1422
198 Ga0307413_10248106 3300031824 Bacteria 1319
199 Ga0307413_10625562 3300031824 Bacteria 884
200 Ga0307413_10664807 3300031824 Bacteria 861
201 Ga0307413_11045064 3300031824 Bacteria 702
202 Ga0307410_10001707 3300031852 Bacteria 10130
203 Ga0307410_10002278 3300031852 Bacteria 9203
204 Ga0307410_10002958 3300031852 Bacteria 8379
205 Ga0307410_10003527 3300031852 Bacteria 7865
206 Ga0307410_10006742 3300031852 Bacteria 6226
207 Ga0307410_10019661 3300031852 Bacteria 4113
208 Ga0307410_10021761 3300031852 Bacteria 3950
209 Ga0307410_10029197 3300031852 Bacteria 3509
210 Ga0307410_10057279 3300031852 Bacteria 2653
211 Ga0307410_10067841 3300031852 Bacteria 2461
212 Ga0307410_10091791 3300031852 Bacteria 2157
213 Ga0307410_10102295 3300031852 Bacteria 2055
214 Ga0307410_10157024 3300031852 Bacteria 1700
215 Ga0307410_10329697 3300031852 Bacteria 1213
216 Ga0307410_10378111 3300031852 Bacteria 1139
217 Ga0307410_10464055 3300031852 Bacteria 1035
218 Ga0307410_10521699 3300031852 Bacteria 980
219 Ga0307410_10596923 3300031852 Bacteria 920
220 Ga0307410_10766805 3300031852 Bacteria 818
221 Ga0307406_10018269 3300031901 Bacteria 4093
222 Ga0307406_10032362 3300031901 Bacteria 3192
223 Ga0307406_10036323 3300031901 Bacteria 3035
224 Ga0307406_10044059 3300031901 Bacteria 2795
225 Ga0307406_10066726 3300031901 Bacteria 2343
226 Ga0307406_10177264 3300031901 Bacteria 1548
227 Ga0307406_10492467 3300031901 Bacteria 992
228 Ga0307407_10001312 3300031903 Bacteria 8885
229 Ga0307407_10003215 3300031903 Bacteria 6635
230 Ga0307407_10006339 3300031903 Bacteria 5240
231 Ga0307407_10025593 3300031903 Bacteria 3112
232 Ga0307407_10042334 3300031903 Bacteria 2553
233 Ga0307407_10045816 3300031903 Bacteria 2473
234 Ga0307407_10071010 3300031903 Bacteria 2072
235 Ga0307407_10115236 3300031903 Bacteria 1694
236 Ga0307407_10273849 3300031903 Bacteria 1166
237 Ga0307407_10463010 3300031903 Bacteria 922
238 Ga0307412_10001080 3300031911 Bacteria 15585
239 Ga0307412_10009742 3300031911 Bacteria 5517
240 Ga0307412_10009927 3300031911 Bacteria 5476
241 Ga0307412_10022501 3300031911 Bacteria 3865
242 Ga0307412_10172796 3300031911 Bacteria 1617
243 Ga0307412_10173795 3300031911 Bacteria 1613
244 Ga0307412_10174061 3300031911 Bacteria 1612
245 Ga0307412_10416916 3300031911 Bacteria 1097
246 Ga0307409_100009310 3300031995 Bacteria 6029
247 Ga0307409_100010525 3300031995 Bacteria 5757
248 Ga0307409_100012104 3300031995 Bacteria 5479
249 Ga0307409_100021424 3300031995 Bacteria 4430
250 Ga0307409_100041318 3300031995 Bacteria 3443
251 Ga0307409_100041967 3300031995 Bacteria 3422
252 Ga0307409_100125906 3300031995 Bacteria 2179
253 Ga0307409_100169925 3300031995 Bacteria 1918
254 Ga0307409_100258505 3300031995 Bacteria 1596
255 Ga0307409_100360162 3300031995 Bacteria 1375
256 Ga0307409_100392499 3300031995 Bacteria 1323
257 Ga0307409_100444369 3300031995 Bacteria 1250
258 Ga0307409_100492142 3300031995 Bacteria 1192
259 Ga0307409_100655340 3300031995 Bacteria 1044
260 Ga0307409_100724160 3300031995 Bacteria 996
261 Ga0307409_101033006 3300031995 Bacteria 841
262 Ga0307409_101218941 3300031995 Bacteria 776
263 Ga0307409_101277012 3300031995 Bacteria 759
264 Ga0307409_101393255 3300031995 Bacteria 727
265 Ga0307416_100003714 3300032002 Bacteria 9048
266 Ga0307416_100004676 3300032002 Bacteria 8286
267 Ga0307416_100012714 3300032002 Bacteria 5685
268 Ga0307416_100036778 3300032002 Bacteria 3759
269 Ga0307416_100081671 3300032002 Bacteria 2734
270 Ga0307416_100129895 3300032002 Bacteria 2265
271 Ga0307416_100660621 3300032002 Bacteria 1131
272 Ga0307414_10003033 3300032004 Bacteria 8903
273 Ga0307414_10004192 3300032004 Bacteria 7797
274 Ga0307414_10004722 3300032004 Bacteria 7434
275 Ga0307414_10004863 3300032004 Bacteria 7339
276 Ga0307414_10006114 3300032004 Bacteria 6684
277 Ga0307414_10009056 3300032004 Bacteria 5694
278 Ga0307414_10019473 3300032004 Bacteria 4206
279 Ga0307414_10037933 3300032004 Bacteria 3231
280 Ga0307414_10103899 3300032004 Bacteria 2145
281 Ga0307414_10226589 3300032004 Bacteria 1538
282 Ga0307414_10244930 3300032004 Bacteria 1486
283 Ga0307414_10265955 3300032004 Bacteria 1433
284 Ga0307414_10416547 3300032004 Bacteria 1170
285 Ga0307414_10495179 3300032004 Bacteria 1080
286 Ga0307414_10585543 3300032004 Bacteria 999
287 Ga0307414_10758639 3300032004 Bacteria 882
288 Ga0307414_10837740 3300032004 Bacteria 840
289 Ga0307414_10862473 3300032004 Bacteria 828
290 Ga0307414_11065076 3300032004 Bacteria 746
291 Ga0307414_11245713 3300032004 Bacteria 689
292 Ga0307414_12123793 3300032004 Bacteria 524
293 Ga0307411_10001400 3300032005 Bacteria 9803
294 Ga0307411_10002471 3300032005 Bacteria 8194
295 Ga0307411_10003378 3300032005 Bacteria 7389
296 Ga0307411_10004479 3300032005 Bacteria 6701
297 Ga0307411_10009793 3300032005 Bacteria 5065
298 Ga0307411_10021426 3300032005 Bacteria 3782
299 Ga0307411_10032109 3300032005 Bacteria 3240
300 Ga0307411_10041295 3300032005 Bacteria 2933
301 Ga0307411_10047893 3300032005 Bacteria 2766
302 Ga0307411_10053217 3300032005 Bacteria 2650
303 Ga0307411_10067339 3300032005 Bacteria 2409
304 Ga0307411_10085484 3300032005 Bacteria 2185
305 Ga0307411_10330156 3300032005 Bacteria 1235
306 Ga0307411_10388025 3300032005 Bacteria 1151
307 Ga0307411_10478343 3300032005 Bacteria 1048
308 Ga0307411_10578917 3300032005 Bacteria 962
309 Ga0307411_10586336 3300032005 Bacteria 956
310 Ga0307411_10723744 3300032005 Bacteria 869
311 Ga0307415_100001677 3300032126 Bacteria 10748
312 Ga0307415_100002105 3300032126 Bacteria 9844
313 Ga0307415_100002388 3300032126 Bacteria 9359
314 Ga0307415_100036875 3300032126 Bacteria 3208
315 Ga0307415_100060240 3300032126 Bacteria 2622
316 Ga0307415_100061489 3300032126 Bacteria 2600
317 Ga0307415_100068160 3300032126 Bacteria 2489
318 Ga0307415_100229792 3300032126 Bacteria 1493
319 Ga0307415_100272471 3300032126 Bacteria 1387
320 Ga0307415_100283372 3300032126 Bacteria 1364
321 Ga0307415_100303908 3300032126 Bacteria 1323
322 Ga0307415_100764548 3300032126 Bacteria 878
323 Ga0395899_0076442 3300037312 Bacteria 2444
324 Ga0395900_0002587 3300037418 Bacteria 19792
325 Ga0395900_0050041 3300037418 Bacteria 4305
326 Ga0395900_0246346 3300037418 Bacteria 1790
327 Ga0395898_1018077 3300037466 Bacteria 764
328 Ga0395905_0000412 3300037471 Bacteria 60157
329 Ga0395905_0290457 3300037471 Bacteria 1522
330 Ga0436364_1406360 3300037853 Bacteria 26034
331 Ga0395901_0001803 3300038443 Bacteria 22120
332 Ga0439453_0021887 3300041408 Bacteria 1155
333 Ga0439465_0031982 3300041413 Bacteria 1678
334 Ga0439465_0171593 3300041413 Bacteria 782
335 Ga0439448_0190162 3300042005 Bacteria 718
336 Ga0439449_0010871 3300042007 Bacteria 3435
337 Ga0450920_011700 3300042122 Bacteria 1638
338 Ga0450920_089259 3300042122 Bacteria 635
339 Ga0439435_0201085 3300042436 Bacteria 657
340 Ga0439435_0313921 3300042436 Bacteria 539
341 Ga0439444_0089080 3300042437 Bacteria 686
342 Ga0439464_0011615 3300042439 Bacteria 2335
343 Ga0450916_012765 3300042530 Bacteria 1076
344 Ga0466966_0000077 3300044684 Bacteria 62463
345 Ga0466963_0047454 3300044694 Bacteria 2834
346 Ga0466960_0072702 3300044901 Bacteria 1715
347 Ga0495584_0393270 3300046491 Bacteria 704
348 Ga0495585_0136950 3300046492 Bacteria 1285
349 Ga0495585_0175881 3300046492 Bacteria 1103
350 Ga0495585_0358944 3300046492 Bacteria 707
351 Ga0495663_0002270 3300046525 Bacteria 5836
352 Ga0495663_0002337 3300046525 Bacteria 5738
353 Ga0495663_0050105 3300046525 Bacteria 1290
354 Ga0495642_0024855 3300046528 Bacteria 2371
355 Ga0495598_0004626 3300046537 Bacteria 2993
356 Ga0495621_0000514 3300046539 Bacteria 9588
357 Ga0495621_0002364 3300046539 Bacteria 5070
358 Ga0495621_0071010 3300046539 Bacteria 1282
359 Ga0495621_0271278 3300046539 Bacteria 697
360 Ga0495597_0184059 3300046542 Bacteria 843
361 Ga0495633_0016373 3300046558 Bacteria 3824
362 Ga0495633_0320831 3300046558 Bacteria 703
363 Ga0495668_0185835 3300046616 Bacteria 1138
364 Ga0495661_0262061 3300046665 Bacteria 878
365 Ga0495661_0438921 3300046665 Bacteria 630
366 Ga0495669_0001526 3300046684 Bacteria 9523
367 Ga0495669_0011235 3300046684 Bacteria 3799
368 Ga0495669_0021736 3300046684 Bacteria 2788
369 Ga0495669_0175598 3300046684 Bacteria 1020
370 Ga0495670_0018902 3300046691 Bacteria 3395
371 Ga0495670_0022655 3300046691 Bacteria 3102
372 Ga0495670_0046642 3300046691 Bacteria 2165
373 Ga0495636_0134611 3300047318 Bacteria 1101
374 Ga0495636_0196015 3300047318 Bacteria 921
375 Ga0495677_0011807 3300047445 Bacteria 3190
376 Ga0495677_0077113 3300047445 Bacteria 1247
377 Ga0495681_0384311 3300047470 Bacteria 528
378 Ga0495615_0162933 3300048090 Bacteria 671
379 Ga0496101_0574615 3300048904 Bacteria 891
380 Ga0496107_0207329 3300048910 Bacteria 1457
381 Ga0496108_0040591 3300048911 Bacteria 3881
382 Ga0496109_0084264 3300048912 Bacteria 2932
383 Ga0496110_0001595 3300048913 Bacteria 16573
384 Ga0496111_0019139 3300048914 Bacteria 4751
385 Ga0496114_0129253 3300048917 Bacteria 2180
386 Ga0501039_1154524 3300049575 Bacteria 600
387 Ga0501209_051017 3300049656 Bacteria 1129
388 Ga0501235_010139 3300049669 Bacteria 2059
389 Ga0501247_039161 3300049677 Bacteria 673
390 Ga0501249_001132 3300049679 Bacteria 5631
391 Ga0501234_013584 3300049707 Bacteria 1278
392 Ga0501262_061782 3300049759 Bacteria 599
393 Ga0501268_053451 3300049765 Bacteria 786
394 Ga0501272_018072 3300049769 Bacteria 833
395 Ga0501279_014040 3300049775 Bacteria 1101
396 nmdc:mga06r32_148851_c1 3300050510 Bacteria 2319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10758639 Ga0307414_107586392 149
2 3300005328 Ga0070676_10004290 Ga0070676_100042902 151
3 3300005344 Ga0070661_100105587 Ga0070661_1001055872 151
4 3300005367 Ga0070667_100007689 Ga0070667_1000076892 151
5 3300005456 Ga0070678_100019463 Ga0070678_1000194634 151
6 3300005457 Ga0070662_100001966 Ga0070662_10000196611 151
7 3300005718 Ga0068866_10963158 Ga0068866_109631581 151
8 3300005843 Ga0068860_100201314 Ga0068860_1002013142 151
9 3300009177 Ga0105248_10761345 Ga0105248_107613452 151
10 3300013306 Ga0163162_10231528 Ga0163162_102315282 151
11 3300013308 Ga0157375_10427591 Ga0157375_104275912 151
12 3300025907 Ga0207645_10004717 Ga0207645_100047172 151
13 3300025933 Ga0207706_10000837 Ga0207706_1000083710 151
14 3300025935 Ga0207709_10415379 Ga0207709_104153792 151
15 3300025941 Ga0207711_10585649 Ga0207711_105856492 151
16 3300025972 Ga0207668_10002016 Ga0207668_1000201610 151
17 3300025986 Ga0207658_10005039 Ga0207658_100050399 151
18 3300026075 Ga0207708_10024565 Ga0207708_100245653 151
19 3300026121 Ga0207683_10054502 Ga0207683_100545024 151
20 3300027665 Ga0209983_1038835 Ga0209983_10388352 151
21 3300032004 Ga0307414_10037933 Ga0307414_100379333 151
22 3300032005 Ga0307411_10723744 Ga0307411_107237442 151
23 3300044901 Ga0466960_0072702 Ga0466960_0072702_1221_1676 151
24 3300005327 Ga0070658_10706699 Ga0070658_107066992 152
25 3300005329 Ga0070683_100736331 Ga0070683_1007363311 152
26 3300005339 Ga0070660_100183709 Ga0070660_1001837092 152
27 3300005344 Ga0070661_100029476 Ga0070661_1000294761 152
28 3300005344 Ga0070661_100097549 Ga0070661_1000975492 152
29 3300005366 Ga0070659_100001394 Ga0070659_10000139411 152
30 3300005455 Ga0070663_100365474 Ga0070663_1003654742 152
31 3300005563 Ga0068855_100007354 Ga0068855_1000073542 152
32 3300005563 Ga0068855_100292206 Ga0068855_1002922062 152
33 3300005577 Ga0068857_100410244 Ga0068857_1004102442 152
34 3300005578 Ga0068854_100001522 Ga0068854_1000015226 152
35 3300005578 Ga0068854_100144399 Ga0068854_1001443992 152
36 3300005578 Ga0068854_100485829 Ga0068854_1004858292 152
37 3300005614 Ga0068856_100021355 Ga0068856_1000213552 152
38 3300005614 Ga0068856_101153171 Ga0068856_1011531712 152
39 3300005616 Ga0068852_100002128 Ga0068852_10000212816 152
40 3300005616 Ga0068852_101342940 Ga0068852_1013429402 152
41 3300009093 Ga0105240_10031879 Ga0105240_100318797 152
42 3300009551 Ga0105238_10465226 Ga0105238_104652262 152
43 3300013100 Ga0157373_10438239 Ga0157373_104382392 152
44 3300013102 Ga0157371_10006979 Ga0157371_1000697910 152
45 3300013102 Ga0157371_10216613 Ga0157371_102166132 152
46 3300013102 Ga0157371_10342389 Ga0157371_103423892 152
47 3300013104 Ga0157370_10317374 Ga0157370_103173742 152
48 3300013104 Ga0157370_11136567 Ga0157370_111365672 152
49 3300013105 Ga0157369_10001975 Ga0157369_1000197521 152
50 3300013105 Ga0157369_10022724 Ga0157369_100227247 152
51 3300013105 Ga0157369_10456512 Ga0157369_104565122 152
52 3300013307 Ga0157372_10844767 Ga0157372_108447672 152
53 3300025909 Ga0207705_10000622 Ga0207705_1000062218 152
54 3300025909 Ga0207705_10704671 Ga0207705_107046712 152
55 3300025913 Ga0207695_10018483 Ga0207695_100184838 152
56 3300025913 Ga0207695_10031372 Ga0207695_100313726 152
57 3300025919 Ga0207657_10038552 Ga0207657_100385522 152
58 3300025920 Ga0207649_10002360 Ga0207649_100023607 152
59 3300025932 Ga0207690_10001193 Ga0207690_100011939 152
60 3300025944 Ga0207661_10226755 Ga0207661_102267552 152
61 3300025949 Ga0207667_10042105 Ga0207667_100421054 152
62 3300025949 Ga0207667_10094855 Ga0207667_100948552 152
63 3300025949 Ga0207667_10209283 Ga0207667_102092834 152
64 3300025981 Ga0207640_10000363 Ga0207640_100003636 152
65 3300026067 Ga0207678_10029870 Ga0207678_100298702 152
66 3300026067 Ga0207678_10192045 Ga0207678_101920453 152
67 3300026078 Ga0207702_10016188 Ga0207702_100161887 152
68 3300026116 Ga0207674_10490928 Ga0207674_104909282 152
69 3300026142 Ga0207698_10008898 Ga0207698_100088987 152
70 3300026142 Ga0207698_10167100 Ga0207698_101671003 152
71 3300031824 Ga0307413_11045064 Ga0307413_110450641 152
72 3300031995 Ga0307409_100169925 Ga0307409_1001699252 152
73 3300031995 Ga0307409_101218941 Ga0307409_1012189411 152
74 3300037312 Ga0395899_0076442 Ga0395899_0076442_1297_1755 152
75 3300037418 Ga0395900_0246346 Ga0395900_0246346_482_940 152
76 3300044684 Ga0466966_0000077 Ga0466966_0000077_54848_55306 152
77 3300044694 Ga0466963_0047454 Ga0466963_0047454_1044_1502 152
78 3300031824 Ga0307413_10206743 Ga0307413_102067432 153
79 3300031852 Ga0307410_10329697 Ga0307410_103296972 153
80 3300031995 Ga0307409_101277012 Ga0307409_1012770122 153
81 3300031995 Ga0307409_101393255 Ga0307409_1013932552 153
82 3300032002 Ga0307416_100660621 Ga0307416_1006606212 153
83 3300032005 Ga0307411_10578917 Ga0307411_105789172 153
84 3300037471 Ga0395905_0290457 Ga0395905_0290457_144_641 153
85 3300005293 Ga0065715_10273161 Ga0065715_102731612 154
86 3300005347 Ga0070668_100296925 Ga0070668_1002969252 154
87 3300005457 Ga0070662_100829711 Ga0070662_1008297112 154
88 3300005543 Ga0070672_100888329 Ga0070672_1008883292 154
89 3300013100 Ga0157373_10005240 Ga0157373_1000524011 154
90 3300014326 Ga0157380_10067598 Ga0157380_100675984 154
91 3300025933 Ga0207706_10233147 Ga0207706_102331472 154
92 3300025972 Ga0207668_10302704 Ga0207668_103027042 154
93 3300031548 Ga0307408_100001902 Ga0307408_1000019029 154
94 3300031548 Ga0307408_101452955 Ga0307408_1014529551 154
95 3300031731 Ga0307405_10001309 Ga0307405_100013097 154
96 3300031824 Ga0307413_10004700 Ga0307413_100047005 154
97 3300031824 Ga0307413_10120703 Ga0307413_101207032 154
98 3300031852 Ga0307410_10002278 Ga0307410_100022786 154
99 3300031852 Ga0307410_10091791 Ga0307410_100917913 154
100 3300031901 Ga0307406_10032362 Ga0307406_100323622 154
101 3300031903 Ga0307407_10006339 Ga0307407_100063392 154
102 3300031903 Ga0307407_10463010 Ga0307407_104630102 154
103 3300031911 Ga0307412_10001080 Ga0307412_1000108015 154
104 3300031995 Ga0307409_100360162 Ga0307409_1003601622 154
105 3300032002 Ga0307416_100012714 Ga0307416_1000127144 154
106 3300032004 Ga0307414_10004192 Ga0307414_100041924 154
107 3300032004 Ga0307414_10862473 Ga0307414_108624732 154
108 3300032004 Ga0307414_11245713 Ga0307414_112457131 154
109 3300032004 Ga0307414_12123793 Ga0307414_121237931 154
110 3300032005 Ga0307411_10041295 Ga0307411_100412954 154
111 3300032005 Ga0307411_10330156 Ga0307411_103301562 154
112 3300032126 Ga0307415_100001677 Ga0307415_1000016776 154
113 3300037853 Ga0436364_1406360 Ga0436364_1406360_24706_25170 154
114 3300046492 Ga0495585_0175881 Ga0495585_0175881_294_758 154
115 3300046525 Ga0495663_0002270 Ga0495663_0002270_5254_5718 154
116 3300046537 Ga0495598_0004626 Ga0495598_0004626_781_1245 154
117 3300046539 Ga0495621_0000514 Ga0495621_0000514_908_1372 154
118 3300046558 Ga0495633_0016373 Ga0495633_0016373_1153_1617 154
119 3300046665 Ga0495661_0262061 Ga0495661_0262061_183_647 154
120 3300046684 Ga0495669_0021736 Ga0495669_0021736_849_1313 154
121 3300046684 Ga0495669_0175598 Ga0495669_0175598_533_997 154
122 3300046691 Ga0495670_0018902 Ga0495670_0018902_1742_2206 154
123 3300047445 Ga0495677_0011807 Ga0495677_0011807_819_1283 154
124 3300047470 Ga0495681_0384311 Ga0495681_0384311_30_494 154
125 3300002076 JGI24749J21850_1018751 JGI24749J21850_10187512 155
126 3300005290 Ga0065712_10078870 Ga0065712_100788701 155
127 3300005327 Ga0070658_10135565 Ga0070658_101355652 155
128 3300005331 Ga0070670_100003242 Ga0070670_10000324211 155
129 3300005354 Ga0070675_100004856 Ga0070675_1000048564 155
130 3300005355 Ga0070671_100010885 Ga0070671_1000108853 155
131 3300005356 Ga0070674_100184585 Ga0070674_1001845852 155
132 3300005364 Ga0070673_100000497 Ga0070673_1000004973 155
133 3300005366 Ga0070659_100102786 Ga0070659_1001027862 155
134 3300005367 Ga0070667_100022762 Ga0070667_1000227623 155
135 3300005456 Ga0070678_100947681 Ga0070678_1009476812 155
136 3300005457 Ga0070662_100021674 Ga0070662_1000216743 155
137 3300005543 Ga0070672_100001933 Ga0070672_1000019334 155
138 3300005548 Ga0070665_100490251 Ga0070665_1004902512 155
139 3300005564 Ga0070664_100003799 Ga0070664_10000379910 155
140 3300006237 Ga0097621_100428809 Ga0097621_1004288092 155
141 3300009177 Ga0105248_10002607 Ga0105248_1000260722 155
142 3300014325 Ga0163163_10104733 Ga0163163_101047334 155
143 3300017792 Ga0163161_10076584 Ga0163161_100765843 155
144 3300025315 Ga0207697_10147975 Ga0207697_101479752 155
145 3300025901 Ga0207688_10417154 Ga0207688_104171541 155
146 3300025909 Ga0207705_10098430 Ga0207705_100984302 155
147 3300025925 Ga0207650_10001007 Ga0207650_1000100711 155
148 3300025926 Ga0207659_10003726 Ga0207659_100037268 155
149 3300025931 Ga0207644_10001095 Ga0207644_1000109517 155
150 3300025933 Ga0207706_10026406 Ga0207706_100264064 155
151 3300025937 Ga0207669_10058693 Ga0207669_100586932 155
152 3300025940 Ga0207691_10005517 Ga0207691_1000551711 155
153 3300025941 Ga0207711_10024382 Ga0207711_100243824 155
154 3300025945 Ga0207679_10001091 Ga0207679_100010913 155
155 3300025960 Ga0207651_10002630 Ga0207651_100026304 155
156 3300025986 Ga0207658_10010161 Ga0207658_100101613 155
157 3300026067 Ga0207678_10068372 Ga0207678_100683722 155
158 3300026121 Ga0207683_10149408 Ga0207683_101494082 155
159 3300031548 Ga0307408_100112354 Ga0307408_1001123542 155
160 3300031548 Ga0307408_100187396 Ga0307408_1001873962 155
161 3300031731 Ga0307405_10035169 Ga0307405_100351692 155
162 3300031731 Ga0307405_10083704 Ga0307405_100837042 155
163 3300031731 Ga0307405_10150228 Ga0307405_101502282 155
164 3300031824 Ga0307413_10002874 Ga0307413_100028741 155
165 3300031824 Ga0307413_10005381 Ga0307413_100053812 155
166 3300031824 Ga0307413_10056636 Ga0307413_100566362 155
167 3300031824 Ga0307413_10110779 Ga0307413_101107793 155
168 3300031852 Ga0307410_10001707 Ga0307410_100017073 155
169 3300031852 Ga0307410_10002958 Ga0307410_100029583 155
170 3300031852 Ga0307410_10019661 Ga0307410_100196612 155
171 3300031852 Ga0307410_10067841 Ga0307410_100678413 155
172 3300031852 Ga0307410_10378111 Ga0307410_103781112 155
173 3300031852 Ga0307410_10766805 Ga0307410_107668052 155
174 3300031901 Ga0307406_10044059 Ga0307406_100440592 155
175 3300031903 Ga0307407_10025593 Ga0307407_100255934 155
176 3300031903 Ga0307407_10045816 Ga0307407_100458162 155
177 3300031911 Ga0307412_10172796 Ga0307412_101727962 155
178 3300031911 Ga0307412_10174061 Ga0307412_101740612 155
179 3300031995 Ga0307409_100009310 Ga0307409_1000093104 155
180 3300031995 Ga0307409_100021424 Ga0307409_1000214244 155
181 3300031995 Ga0307409_100041318 Ga0307409_1000413182 155
182 3300031995 Ga0307409_100724160 Ga0307409_1007241601 155
183 3300032002 Ga0307416_100004676 Ga0307416_1000046765 155
184 3300032002 Ga0307416_100081671 Ga0307416_1000816714 155
185 3300032004 Ga0307414_10003033 Ga0307414_100030335 155
186 3300032004 Ga0307414_10006114 Ga0307414_100061142 155
187 3300032004 Ga0307414_10009056 Ga0307414_100090564 155
188 3300032004 Ga0307414_11065076 Ga0307414_110650762 155
189 3300032005 Ga0307411_10002471 Ga0307411_100024715 155
190 3300032005 Ga0307411_10003378 Ga0307411_100033782 155
191 3300032005 Ga0307411_10009793 Ga0307411_100097934 155
192 3300032005 Ga0307411_10067339 Ga0307411_100673392 155
193 3300032126 Ga0307415_100002388 Ga0307415_1000023884 155
194 3300032126 Ga0307415_100036875 Ga0307415_1000368754 155
195 3300032126 Ga0307415_100283372 Ga0307415_1002833722 155
196 3300032126 Ga0307415_100764548 Ga0307415_1007645481 155
197 3300037418 Ga0395900_0050041 Ga0395900_0050041_1381_1848 155
198 3300042007 Ga0439449_0010871 Ga0439449_0010871_2720_3187 155
199 3300042122 Ga0450920_011700 Ga0450920_011700_327_794 155
200 3300046491 Ga0495584_0393270 Ga0495584_0393270_196_663 155
201 3300046684 Ga0495669_0001526 Ga0495669_0001526_343_810 155
202 3300048904 Ga0496101_0574615 Ga0496101_0574615_288_755 155
203 3300048910 Ga0496107_0207329 Ga0496107_0207329_385_852 155
204 3300048911 Ga0496108_0040591 Ga0496108_0040591_793_1260 155
205 3300048912 Ga0496109_0084264 Ga0496109_0084264_300_767 155
206 3300048913 Ga0496110_0001595 Ga0496110_0001595_3852_4319 155
207 3300048914 Ga0496111_0019139 Ga0496111_0019139_3409_3876 155
208 3300048917 Ga0496114_0129253 Ga0496114_0129253_188_655 155
209 3300049677 Ga0501247_039161 Ga0501247_039161_107_574 155
210 3300049765 Ga0501268_053451 Ga0501268_053451_93_560 155
211 iso_pu_bacteria 2885427238 2885427523 155
212 3300005293 Ga0065715_10132786 Ga0065715_101327862 157
213 3300005844 Ga0068862_100115672 Ga0068862_1001156723 157
214 3300025923 Ga0207681_10067017 Ga0207681_100670173 157
215 3300031824 Ga0307413_10248106 Ga0307413_102481062 157
216 3300032004 Ga0307414_10585543 Ga0307414_105855432 157
217 3300031548 Ga0307408_100076998 Ga0307408_1000769983 158
218 3300031548 Ga0307408_100436666 Ga0307408_1004366662 158
219 3300031731 Ga0307405_10002241 Ga0307405_100022416 158
220 3300031731 Ga0307405_10083088 Ga0307405_100830882 158
221 3300031731 Ga0307405_10192582 Ga0307405_101925822 158
222 3300031824 Ga0307413_10011033 Ga0307413_100110333 158
223 3300031824 Ga0307413_10012388 Ga0307413_100123884 158
224 3300031824 Ga0307413_10014892 Ga0307413_100148925 158
225 3300031824 Ga0307413_10035957 Ga0307413_100359572 158
226 3300031824 Ga0307413_10104016 Ga0307413_101040162 158
227 3300031824 Ga0307413_10625562 Ga0307413_106255621 158
228 3300031824 Ga0307413_10664807 Ga0307413_106648072 158
229 3300031852 Ga0307410_10003527 Ga0307410_100035277 158
230 3300031852 Ga0307410_10021761 Ga0307410_100217612 158
231 3300031852 Ga0307410_10057279 Ga0307410_100572793 158
232 3300031852 Ga0307410_10102295 Ga0307410_101022952 158
233 3300031852 Ga0307410_10157024 Ga0307410_101570242 158
234 3300031852 Ga0307410_10464055 Ga0307410_104640552 158
235 3300031852 Ga0307410_10521699 Ga0307410_105216992 158
236 3300031852 Ga0307410_10596923 Ga0307410_105969232 158
237 3300031901 Ga0307406_10018269 Ga0307406_100182692 158
238 3300031901 Ga0307406_10036323 Ga0307406_100363233 158
239 3300031901 Ga0307406_10177264 Ga0307406_101772642 158
240 3300031901 Ga0307406_10492467 Ga0307406_104924672 158
241 3300031903 Ga0307407_10001312 Ga0307407_100013123 158
242 3300031903 Ga0307407_10003215 Ga0307407_100032157 158
243 3300031903 Ga0307407_10042334 Ga0307407_100423343 158
244 3300031903 Ga0307407_10115236 Ga0307407_101152362 158
245 3300031903 Ga0307407_10273849 Ga0307407_102738492 158
246 3300031911 Ga0307412_10009742 Ga0307412_100097425 158
247 3300031911 Ga0307412_10009927 Ga0307412_100099272 158
248 3300031911 Ga0307412_10022501 Ga0307412_100225013 158
249 3300031911 Ga0307412_10416916 Ga0307412_104169162 158
250 3300031995 Ga0307409_100010525 Ga0307409_1000105256 158
251 3300031995 Ga0307409_100125906 Ga0307409_1001259062 158
252 3300031995 Ga0307409_100258505 Ga0307409_1002585052 158
253 3300031995 Ga0307409_100392499 Ga0307409_1003924992 158
254 3300031995 Ga0307409_100492142 Ga0307409_1004921422 158
255 3300031995 Ga0307409_101033006 Ga0307409_1010330062 158
256 3300032002 Ga0307416_100003714 Ga0307416_1000037146 158
257 3300032002 Ga0307416_100036778 Ga0307416_1000367783 158
258 3300032002 Ga0307416_100129895 Ga0307416_1001298952 158
259 3300032004 Ga0307414_10004863 Ga0307414_1000486310 158
260 3300032004 Ga0307414_10019473 Ga0307414_100194733 158
261 3300032004 Ga0307414_10103899 Ga0307414_101038992 158
262 3300032004 Ga0307414_10226589 Ga0307414_102265892 158
263 3300032004 Ga0307414_10244930 Ga0307414_102449302 158
264 3300032004 Ga0307414_10265955 Ga0307414_102659552 158
265 3300032004 Ga0307414_10416547 Ga0307414_104165472 158
266 3300032004 Ga0307414_10495179 Ga0307414_104951792 158
267 3300032004 Ga0307414_10837740 Ga0307414_108377402 158
268 3300032005 Ga0307411_10004479 Ga0307411_100044792 158
269 3300032005 Ga0307411_10021426 Ga0307411_100214262 158
270 3300032005 Ga0307411_10032109 Ga0307411_100321093 158
271 3300032005 Ga0307411_10047893 Ga0307411_100478934 158
272 3300032005 Ga0307411_10053217 Ga0307411_100532172 158
273 3300032005 Ga0307411_10085484 Ga0307411_100854842 158
274 3300032005 Ga0307411_10586336 Ga0307411_105863362 158
275 3300032126 Ga0307415_100002105 Ga0307415_1000021058 158
276 3300032126 Ga0307415_100060240 Ga0307415_1000602403 158
277 3300032126 Ga0307415_100061489 Ga0307415_1000614894 158
278 3300032126 Ga0307415_100272471 Ga0307415_1002724712 158
279 3300032126 Ga0307415_100303908 Ga0307415_1003039082 158
280 3300037418 Ga0395900_0002587 Ga0395900_0002587_1232_1714 158
281 3300037466 Ga0395898_1018077 Ga0395898_1018077_188_670 158
282 3300037471 Ga0395905_0000412 Ga0395905_0000412_13350_13832 158
283 3300038443 Ga0395901_0001803 Ga0395901_0001803_10787_11269 158
284 3300042005 Ga0439448_0190162 Ga0439448_0190162_37_513 158
285 3300046492 Ga0495585_0136950 Ga0495585_0136950_771_1247 158
286 3300046492 Ga0495585_0358944 Ga0495585_0358944_163_639 158
287 3300046616 Ga0495668_0185835 Ga0495668_0185835_207_689 158
288 3300046684 Ga0495669_0011235 Ga0495669_0011235_1525_2001 158
289 3300046691 Ga0495670_0046642 Ga0495670_0046642_1377_1853 158
290 3300049656 Ga0501209_051017 Ga0501209_051017_264_746 158
291 3300049669 Ga0501235_010139 Ga0501235_010139_1215_1697 158
292 3300049679 Ga0501249_001132 Ga0501249_001132_2282_2764 158
293 3300049707 Ga0501234_013584 Ga0501234_013584_675_1157 158
294 3300049759 Ga0501262_061782 Ga0501262_061782_37_519 158
295 3300049769 Ga0501272_018072 Ga0501272_018072_333_815 158
296 3300049775 Ga0501279_014040 Ga0501279_014040_605_1087 158
297 3300005355 Ga0070671_100896153 Ga0070671_1008961532 160
298 3300006847 Ga0075431_100180285 Ga0075431_1001802852 160
299 3300013308 Ga0157375_11774274 Ga0157375_117742741 160
300 3300014326 Ga0157380_10001477 Ga0157380_1000147710 160
301 3300026116 Ga0207674_10791765 Ga0207674_107917652 160
302 3300031995 Ga0307409_100041967 Ga0307409_1000419672 160
303 3300046539 Ga0495621_0271278 Ga0495621_0271278_141_623 160
304 3300049575 Ga0501039_1154524 Ga0501039_1154524_27_509 160
305 3300050510 nmdc:mga06r32_148851_c1 nmdc:mga06r32_148851_c1_995_1477 160
306 iso_pu_bacteria 2896429255 2896431173 160
307 3300005353 Ga0070669_100604617 Ga0070669_1006046172 161
308 3300009094 Ga0111539_10243402 Ga0111539_102434023 161
309 3300025923 Ga0207681_10378463 Ga0207681_103784632 161
310 3300046525 Ga0495663_0002337 Ga0495663_0002337_2143_2628 161
311 3300046539 Ga0495621_0002364 Ga0495621_0002364_2162_2647 161
312 3300046539 Ga0495621_0071010 Ga0495621_0071010_101_586 161
313 3300046558 Ga0495633_0320831 Ga0495633_0320831_104_589 161
314 3300046665 Ga0495661_0438921 Ga0495661_0438921_129_614 161
315 3300046691 Ga0495670_0022655 Ga0495670_0022655_201_686 161
316 3300047318 Ga0495636_0196015 Ga0495636_0196015_224_709 161
317 3300048090 Ga0495615_0162933 Ga0495615_0162933_174_659 161
318 3300032005 Ga0307411_10388025 Ga0307411_103880251 163
319 3300005293 Ga0065715_10168795 Ga0065715_101687952 164
320 3300005295 Ga0065707_10245082 Ga0065707_102450822 164
321 3300005331 Ga0070670_100113909 Ga0070670_1001139092 164
322 3300005618 Ga0068864_100354051 Ga0068864_1003540511 164
323 3300005844 Ga0068862_100287545 Ga0068862_1002875452 164
324 3300009553 Ga0105249_10972932 Ga0105249_109729322 164
325 3300014325 Ga0163163_11961783 Ga0163163_119617832 164
326 3300014326 Ga0157380_10021905 Ga0157380_100219055 164
327 3300025925 Ga0207650_10035723 Ga0207650_100357231 164
328 3300026095 Ga0207676_10822830 Ga0207676_108228301 164
329 3300028380 Ga0268265_10269370 Ga0268265_102693702 164
330 3300031548 Ga0307408_100454067 Ga0307408_1004540672 164
331 3300031731 Ga0307405_10009776 Ga0307405_100097763 164
332 3300031852 Ga0307410_10029197 Ga0307410_100291973 164
333 3300031901 Ga0307406_10066726 Ga0307406_100667262 164
334 3300031903 Ga0307407_10071010 Ga0307407_100710102 164
335 3300031911 Ga0307412_10173795 Ga0307412_101737952 164
336 3300031995 Ga0307409_100444369 Ga0307409_1004443692 164
337 3300031995 Ga0307409_100655340 Ga0307409_1006553402 164
338 3300032005 Ga0307411_10478343 Ga0307411_104783432 164
339 3300032126 Ga0307415_100229792 Ga0307415_1002297923 164
340 3300041408 Ga0439453_0021887 Ga0439453_0021887_146_640 164
341 3300041413 Ga0439465_0031982 Ga0439465_0031982_707_1201 164
342 3300042436 Ga0439435_0313921 Ga0439435_0313921_12_506 164
343 3300042437 Ga0439444_0089080 Ga0439444_0089080_176_670 164
344 3300042439 Ga0439464_0011615 Ga0439464_0011615_1050_1544 164
345 3300046525 Ga0495663_0050105 Ga0495663_0050105_109_603 164
346 3300046528 Ga0495642_0024855 Ga0495642_0024855_371_865 164
347 3300047318 Ga0495636_0134611 Ga0495636_0134611_338_832 164
348 3300047445 Ga0495677_0077113 Ga0495677_0077113_465_959 164
349 3300001977 JGI24746J21847_1000774 JGI24746J21847_10007742 165
350 3300005330 Ga0070690_100274157 Ga0070690_1002741572 165
351 3300005331 Ga0070670_100009025 Ga0070670_1000090256 165
352 3300005333 Ga0070677_10000720 Ga0070677_100007202 165
353 3300005339 Ga0070660_100751727 Ga0070660_1007517272 165
354 3300005343 Ga0070687_100247379 Ga0070687_1002473792 165
355 3300005347 Ga0070668_100142157 Ga0070668_1001421572 165
356 3300005353 Ga0070669_100009022 Ga0070669_1000090224 165
357 3300005353 Ga0070669_100170570 Ga0070669_1001705702 165
358 3300005354 Ga0070675_100003625 Ga0070675_10000362510 165
359 3300005543 Ga0070672_100003046 Ga0070672_1000030469 165
360 3300005549 Ga0070704_100240631 Ga0070704_1002406312 165
361 3300005564 Ga0070664_100018308 Ga0070664_1000183082 165
362 3300005616 Ga0068852_101343194 Ga0068852_1013431942 165
363 3300005617 Ga0068859_100008026 Ga0068859_1000080269 165
364 3300005618 Ga0068864_100023546 Ga0068864_1000235464 165
365 3300005719 Ga0068861_100069888 Ga0068861_1000698882 165
366 3300006852 Ga0075433_10897803 Ga0075433_108978032 165
367 3300006931 Ga0097620_100008026 Ga0097620_1000080269 165
368 3300009147 Ga0114129_11316248 Ga0114129_113162481 165
369 3300009553 Ga0105249_10030435 Ga0105249_100304353 165
370 3300014326 Ga0157380_10001524 Ga0157380_100015248 165
371 3300017792 Ga0163161_10021139 Ga0163161_100211392 165
372 3300025315 Ga0207697_10007792 Ga0207697_100077923 165
373 3300025893 Ga0207682_10000874 Ga0207682_1000087410 165
374 3300025901 Ga0207688_10032959 Ga0207688_100329592 165
375 3300025923 Ga0207681_10002843 Ga0207681_100028438 165
376 3300025923 Ga0207681_10316553 Ga0207681_103165532 165
377 3300025925 Ga0207650_10002935 Ga0207650_100029359 165
378 3300025926 Ga0207659_10009082 Ga0207659_100090829 165
379 3300025931 Ga0207644_10171159 Ga0207644_101711592 165
380 3300025940 Ga0207691_10001140 Ga0207691_1000114018 165
381 3300025961 Ga0207712_10003090 Ga0207712_100030909 165
382 3300025972 Ga0207668_10081714 Ga0207668_100817142 165
383 3300025972 Ga0207668_10834965 Ga0207668_108349652 165
384 3300026089 Ga0207648_10005430 Ga0207648_1000543017 165
385 3300026118 Ga0207675_100021164 Ga0207675_1000211646 165
386 3300028380 Ga0268265_10348172 Ga0268265_103481722 165
387 3300028380 Ga0268265_10816019 Ga0268265_108160192 165
388 3300031824 Ga0307413_10003891 Ga0307413_100038917 165
389 3300031852 Ga0307410_10006742 Ga0307410_100067427 165
390 3300031995 Ga0307409_100012104 Ga0307409_1000121045 165
391 3300032004 Ga0307414_10004722 Ga0307414_100047226 165
392 3300032005 Ga0307411_10001400 Ga0307411_100014007 165
393 3300032126 Ga0307415_100068160 Ga0307415_1000681602 165
394 3300041413 Ga0439465_0171593 Ga0439465_0171593_22_519 165
395 3300042122 Ga0450920_089259 Ga0450920_089259_38_535 165
396 3300042436 Ga0439435_0201085 Ga0439435_0201085_71_568 165
397 3300042530 Ga0450916_012765 Ga0450916_012765_523_1038 165
398 3300046542 Ga0495597_0184059 Ga0495597_0184059_293_790 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

61

138

0.94

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

54

144

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fs2-assembly1.cif.gz_B structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.8843 39 150
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.8839 39 150
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.8829 39 150
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.8807 39 150
3lbe-assembly1.cif.gz_B the crystal structure of smu.793 from streptococcus mutans ua159 bound to acetyl coa 0.8795 41 150
ID Description Score Start End Superfamily
af_Q2FXM2_325_429_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9174 51 150 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8829 39 150 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8708 50 150 3.10.129.10
af_O06307_73_209_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.868 35 150 3.10.129.10
2fs2B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8675 39 150 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2W6SBN8-F1-model_v4 PaaI family thioesterase 0.9198 23 150 GO:0016790
AF-A0A4S1WAK4-F1-model_v4 PaaI family thioesterase 0.904 12 153 GO:0016790
AF-B8FKV4-F1-model_v4 Thioesterase superfamily protein 0.9031 39 152
AF-A0A2W6SBN8-F1-model_v4 PaaI family thioesterase 0.8998 23 150 GO:0016790
AF-A0A7G7MC19-F1-model_v4 Acyl-coenzyme A thioesterase THEM4 (EC 3.1.2.2) (Thioesterase superfamily member 4) 0.8983 40 151 GO:0005737
GO:0005886
GO:0006631
GO:0016787
GO:0042995

Feature Viewer

pLDDT pTM Quality
90.17 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map