F434097

General Info

Members Datasets Scaffolds Average Seq Length
398 173 796 172

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0201799|Ga0395900_0201799_1346_1978
Length 210
Sequence MSVCQLFPIQVTGNGLSDCTRLPNGPCDPAGFNLDWRVSAMSFGMWEASVPLFVNSLTNMRDWLDKAAGEKDEAALIEARLAPDMRPLPAQYQMASDSAKNALARLTGTEAPSMPDTEKSFAELKDRCDRTIEYLKSFEPKSLTGSEGREVVLKFPNGSGYRFTGSEYLAGFALPNFYFHVTTAYAILRNAGVSLGKPDFLRHLGPPTAG

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
171 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.27
Nodule 0
Rhizoplane 4.77
Rhizosphere 89.45
Stem 0
Stem Tuber 0
Unclassified 12.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0201799 3300037418 Bacteria 2012
2 JGI24752J21851_1021150 3300001976 Bacteria 849
3 JGI24737J22298_10002645 3300001990 Bacteria 6333
4 JGI24743J22301_10029590 3300001991 Bacteria 1075
5 Ga0065712_10024387 3300005290 Unclassified 1496
6 Ga0065715_10348461 3300005293 Unclassified 931
7 Ga0065707_10248873 3300005295 Bacteria 1132
8 Ga0070658_10010412 3300005327 Bacteria 7456
9 Ga0070658_10057703 3300005327 Bacteria 3158
10 Ga0070658_11220567 3300005327 Bacteria 654
11 Ga0070670_100014484 3300005331 Bacteria 6771
12 Ga0070670_100023002 3300005331 Bacteria 5362
13 Ga0070670_100128161 3300005331 Unclassified 2190
14 Ga0070666_10003235 3300005335 Bacteria 9891
15 Ga0070666_10078426 3300005335 Bacteria 2255
16 Ga0070666_10821150 3300005335 Unclassified 685
17 Ga0068868_100037939 3300005338 Bacteria 3738
18 Ga0068868_100260376 3300005338 Bacteria 1462
19 Ga0070660_100005456 3300005339 Bacteria 8805
20 Ga0070660_100008354 3300005339 Bacteria 7239
21 Ga0070661_100035455 3300005344 Unclassified 3623
22 Ga0070661_100066514 3300005344 Bacteria 2648
23 Ga0070661_100196154 3300005344 Unclassified 1541
24 Ga0070668_100018634 3300005347 Bacteria 5212
25 Ga0070668_100078795 3300005347 Bacteria 2578
26 Ga0070668_100224451 3300005347 Unclassified 1551
27 Ga0070668_100462636 3300005347 Bacteria 1092
28 Ga0070669_100105504 3300005353 Bacteria 2132
29 Ga0070669_100117638 3300005353 Bacteria 2024
30 Ga0070669_100369403 3300005353 Unclassified 1168
31 Ga0070675_100051826 3300005354 Bacteria 3373
32 Ga0070675_100443484 3300005354 Bacteria 1163
33 Ga0070671_100003691 3300005355 Bacteria 12005
34 Ga0070671_100075533 3300005355 Bacteria 2815
35 Ga0070671_100334375 3300005355 Bacteria 1291
36 Ga0070674_100065171 3300005356 Plasmid 2556
37 Ga0070673_100006469 3300005364 Bacteria 7618
38 Ga0070673_100041934 3300005364 Bacteria 3524
39 Ga0070673_100042797 3300005364 Bacteria 3494
40 Ga0070673_100155534 3300005364 Bacteria 1940
41 Ga0070673_100415953 3300005364 Unclassified 1205
42 Ga0070659_100053957 3300005366 Plasmid 3165
43 Ga0070667_100019361 3300005367 Bacteria 5646
44 Ga0070667_100036331 3300005367 Bacteria 4130
45 Ga0070667_100075236 3300005367 Bacteria 2882
46 Ga0070667_100167662 3300005367 Bacteria 1937
47 Ga0070667_100175009 3300005367 Unclassified 1896
48 Ga0070714_100339690 3300005435 Bacteria 1408
49 Ga0070713_100889533 3300005436 Bacteria 856
50 Ga0070713_100938572 3300005436 Bacteria 833
51 Ga0070678_100092061 3300005456 Bacteria 2328
52 Ga0070678_100103368 3300005456 Unclassified 2213
53 Ga0070662_100004294 3300005457 Bacteria 8997
54 Ga0070662_100107014 3300005457 Bacteria 2125
55 Ga0070662_100259960 3300005457 Bacteria 1398
56 Ga0070681_10370635 3300005458 Unclassified 1342
57 Ga0068867_100016476 3300005459 Bacteria 5248
58 Ga0068867_100019280 3300005459 Bacteria 4862
59 Ga0070684_101271547 3300005535 Unclassified 692
60 Ga0068853_100032774 3300005539 Bacteria 4403
61 Ga0068853_101252269 3300005539 Bacteria 717
62 Ga0070672_100012993 3300005543 Bacteria 5868
63 Ga0070672_100122087 3300005543 Bacteria 2133
64 Ga0070665_100026147 3300005548 Bacteria 5877
65 Ga0070665_100051475 3300005548 Bacteria 4130
66 Ga0070665_100054204 3300005548 Bacteria 4022
67 Ga0070665_101011562 3300005548 Bacteria 843
68 Ga0068855_100033095 3300005563 Bacteria 6172
69 Ga0070664_100057089 3300005564 Bacteria 3318
70 Ga0070664_100456172 3300005564 Bacteria 1174
71 Ga0070664_100565592 3300005564 Bacteria 1052
72 Ga0068857_100013505 3300005577 Bacteria 7115
73 Ga0068854_100282841 3300005578 Unclassified 1336
74 Ga0068856_100807834 3300005614 Unclassified 957
75 Ga0068852_100050391 3300005616 Bacteria 3568
76 Ga0068852_100067571 3300005616 Bacteria 3125
77 Ga0068852_100601352 3300005616 Bacteria 1104
78 Ga0068852_100989638 3300005616 Bacteria 859
79 Ga0068859_100000088 3300005617 Bacteria 84390
80 Ga0068859_100179078 3300005617 Bacteria 2202
81 Ga0068859_100509549 3300005617 Bacteria 1298
82 Ga0068864_100000136 3300005618 Bacteria 70797
83 Ga0068864_100002426 3300005618 Bacteria 15410
84 Ga0068864_100014686 3300005618 Bacteria 6505
85 Ga0068864_100016278 3300005618 Bacteria 6191
86 Ga0068864_100020504 3300005618 Bacteria 5531
87 Ga0068864_100021856 3300005618 Bacteria 5362
88 Ga0068864_100560297 3300005618 Bacteria 1105
89 Ga0068851_10058955 3300005834 Unclassified 1963
90 Ga0068851_10084041 3300005834 Bacteria 1667
91 Ga0068851_10209048 3300005834 Bacteria 1092
92 Ga0068870_10182890 3300005840 Unclassified 1259
93 Ga0068863_100000167 3300005841 Bacteria 70943
94 Ga0068863_100000384 3300005841 Bacteria 44825
95 Ga0068863_100004005 3300005841 Bacteria 14546
96 Ga0068863_100025913 3300005841 Bacteria 5595
97 Ga0068863_100028267 3300005841 Bacteria 5354
98 Ga0068863_100030468 3300005841 Bacteria 5151
99 Ga0068863_100050590 3300005841 Unclassified 3938
100 Ga0068863_100298882 3300005841 Bacteria 1561
101 Ga0068858_100000063 3300005842 Bacteria 111811
102 Ga0068858_100000198 3300005842 Bacteria 64645
103 Ga0068858_100006677 3300005842 Bacteria 11223
104 Ga0068858_100026724 3300005842 Bacteria 5362
105 Ga0068858_100797124 3300005842 Bacteria 922
106 Ga0068858_101266089 3300005842 Bacteria 725
107 Ga0068860_100000479 3300005843 Bacteria 49770
108 Ga0068860_100064324 3300005843 Bacteria 3484
109 Ga0068860_100144850 3300005843 Bacteria 2285
110 Ga0068860_100160226 3300005843 Bacteria 2169
111 Ga0068860_100249150 3300005843 Unclassified 1729
112 Ga0068860_100899614 3300005843 Unclassified 901
113 Ga0068862_100000118 3300005844 Bacteria 92548
114 Ga0068862_100011336 3300005844 Bacteria 7360
115 Ga0068862_100560111 3300005844 Bacteria 1092
116 Ga0068862_100636234 3300005844 Bacteria 1028
117 Ga0070717_10197104 3300006028 Bacteria 1762
118 Ga0075368_10019813 3300006042 Bacteria 2541
119 Ga0075363_100020217 3300006048 Bacteria 3337
120 Ga0075367_10032013 3300006178 Bacteria 3023
121 Ga0097621_100025108 3300006237 Unclassified 4660
122 Ga0097621_100129922 3300006237 Bacteria 2143
123 Ga0075370_10083090 3300006353 Bacteria 1842
124 Ga0075370_10198598 3300006353 Bacteria 1183
125 Ga0068871_100007735 3300006358 Bacteria 7695
126 Ga0068871_100009438 3300006358 Bacteria 7071
127 Ga0068865_100123300 3300006881 Bacteria 1930
128 Ga0097620_100000088 3300006931 Bacteria 84390
129 Ga0097620_100179089 3300006931 Bacteria 2202
130 Ga0097620_100509498 3300006931 Bacteria 1298
131 Ga0105250_10023119 3300009092 Bacteria 2504
132 Ga0105245_10169329 3300009098 Bacteria 2079
133 Ga0105247_10086331 3300009101 Bacteria 1986
134 Ga0105247_10096625 3300009101 Unclassified 1883
135 Ga0105243_10103834 3300009148 Bacteria 2364
136 Ga0105242_10046670 3300009176 Bacteria 3515
137 Ga0105248_10000169 3300009177 Bacteria 75948
138 Ga0105248_10000604 3300009177 Bacteria 40877
139 Ga0105248_10002620 3300009177 Bacteria 20006
140 Ga0105248_10011420 3300009177 Bacteria 9789
141 Ga0105248_10022740 3300009177 Bacteria 6957
142 Ga0105248_10733480 3300009177 Bacteria 1115
143 Ga0105238_10107575 3300009551 Bacteria 2770
144 Ga0105249_10000119 3300009553 Bacteria 107840
145 Ga0105249_10015607 3300009553 Bacteria 6723
146 Ga0105249_10043788 3300009553 Bacteria 4071
147 Ga0105239_10094823 3300010375 Bacteria 3296
148 Ga0105246_11301832 3300011119 Unclassified 674
149 Ga0157373_10402396 3300013100 Bacteria 981
150 Ga0157371_10647245 3300013102 Bacteria 789
151 Ga0157370_10267551 3300013104 Bacteria 1579
152 Ga0157370_10912032 3300013104 Unclassified 797
153 Ga0157369_10129831 3300013105 Bacteria 2671
154 Ga0157374_10012908 3300013296 Bacteria 7278
155 Ga0157378_10331865 3300013297 Unclassified 1480
156 Ga0157378_10413513 3300013297 Bacteria 1332
157 Ga0163162_10003404 3300013306 Bacteria 15182
158 Ga0163162_10024995 3300013306 Bacteria 5901
159 Ga0163162_10081113 3300013306 Bacteria 3314
160 Ga0157372_10269737 3300013307 Bacteria 1977
161 Ga0157375_10135557 3300013308 Plasmid 2585
162 Ga0157375_10151601 3300013308 Bacteria 2454
163 Ga0157375_10364237 3300013308 Bacteria 1612
164 Ga0163163_10000170 3300014325 Bacteria 68377
165 Ga0163163_10024398 3300014325 Bacteria 5756
166 Ga0157380_10071399 3300014326 Bacteria 2808
167 Ga0157380_10205844 3300014326 Bacteria 1749
168 Ga0157379_10014561 3300014968 Bacteria 6901
169 Ga0157379_10073398 3300014968 Bacteria 3062
170 Ga0157379_10195401 3300014968 Bacteria 1828
171 Ga0157376_10036943 3300014969 Bacteria 3961
172 Ga0163161_10181481 3300017792 Unclassified 1614
173 Ga0207696_1017173 3300025711 Bacteria 2403
174 Ga0207710_10000484 3300025900 Bacteria 25194
175 Ga0207688_10051666 3300025901 Unclassified 2302
176 Ga0207680_10061034 3300025903 Bacteria 2298
177 Ga0207680_10093238 3300025903 Bacteria 1920
178 Ga0207680_10106194 3300025903 Unclassified 1813
179 Ga0207680_10152352 3300025903 Bacteria 1542
180 Ga0207705_10000468 3300025909 Bacteria 34564
181 Ga0207705_10031608 3300025909 Bacteria 3780
182 Ga0207705_10142344 3300025909 Bacteria 1792
183 Ga0207657_10005698 3300025919 Bacteria 12998
184 Ga0207657_10007540 3300025919 Bacteria 11152
185 Ga0207649_10090524 3300025920 Bacteria 2002
186 Ga0207649_10591707 3300025920 Unclassified 852
187 Ga0207652_10082638 3300025921 Bacteria 2811
188 Ga0207681_10103817 3300025923 Unclassified 2055
189 Ga0207681_10113988 3300025923 Bacteria 1971
190 Ga0207681_10246163 3300025923 Bacteria 1394
191 Ga0207681_10545179 3300025923 Bacteria 954
192 Ga0207681_11032085 3300025923 Bacteria 690
193 Ga0207694_10242390 3300025924 Unclassified 1473
194 Ga0207650_10000136 3300025925 Bacteria 89925
195 Ga0207650_10037594 3300025925 Plasmid 3529
196 Ga0207650_10561842 3300025925 Unclassified 957
197 Ga0207659_10059299 3300025926 Bacteria 2751
198 Ga0207659_11283995 3300025926 Bacteria 629
199 Ga0207687_10110377 3300025927 Bacteria 2040
200 Ga0207700_10344795 3300025928 Bacteria 1296
201 Ga0207644_10000061 3300025931 Bacteria 79079
202 Ga0207644_10023683 3300025931 Bacteria 4208
203 Ga0207644_10026218 3300025931 Bacteria 4013
204 Ga0207690_10149376 3300025932 Unclassified 1731
205 Ga0207690_10251712 3300025932 Bacteria 1365
206 Ga0207706_10002200 3300025933 Bacteria 19004
207 Ga0207706_10004173 3300025933 Bacteria 13606
208 Ga0207706_10149390 3300025933 Bacteria 2055
209 Ga0207706_10191778 3300025933 Bacteria 1794
210 Ga0207706_10988140 3300025933 Bacteria 708
211 Ga0207686_10285744 3300025934 Bacteria 1219
212 Ga0207691_10007149 3300025940 Bacteria 10771
213 Ga0207691_10007401 3300025940 Bacteria 10572
214 Ga0207691_10025850 3300025940 Bacteria 5510
215 Ga0207691_10131011 3300025940 Bacteria 2215
216 Ga0207711_10000039 3300025941 Bacteria 162974
217 Ga0207711_10002205 3300025941 Bacteria 17482
218 Ga0207711_10014171 3300025941 Bacteria 6623
219 Ga0207711_10015210 3300025941 Bacteria 6389
220 Ga0207711_10134537 3300025941 Bacteria 2219
221 Ga0207711_10229069 3300025941 Bacteria 1701
222 Ga0207711_10268180 3300025941 Bacteria 1570
223 Ga0207679_10005984 3300025945 Bacteria 7652
224 Ga0207679_10424786 3300025945 Bacteria 1174
225 Ga0207667_10084314 3300025949 Unclassified 3290
226 Ga0207667_10419134 3300025949 Bacteria 1362
227 Ga0207651_10001804 3300025960 Bacteria 9960
228 Ga0207651_10005876 3300025960 Bacteria 6348
229 Ga0207651_10013014 3300025960 Bacteria 4739
230 Ga0207651_10137964 3300025960 Unclassified 1879
231 Ga0207712_10000048 3300025961 Bacteria 160050
232 Ga0207712_10000772 3300025961 Bacteria 23947
233 Ga0207712_10061275 3300025961 Bacteria 2670
234 Ga0207712_10314110 3300025961 Unclassified 1290
235 Ga0207668_10005475 3300025972 Bacteria 7477
236 Ga0207668_10017968 3300025972 Bacteria 4440
237 Ga0207668_10292241 3300025972 Unclassified 1341
238 Ga0207668_10649553 3300025972 Bacteria 923
239 Ga0207640_10775287 3300025981 Bacteria 829
240 Ga0207658_10000167 3300025986 Bacteria 70202
241 Ga0207658_10001595 3300025986 Bacteria 17495
242 Ga0207658_10002756 3300025986 Bacteria 12666
243 Ga0207658_10048674 3300025986 Bacteria 3109
244 Ga0207658_10131466 3300025986 Bacteria 2011
245 Ga0207658_10179262 3300025986 Bacteria 1752
246 Ga0207658_10965136 3300025986 Bacteria 777
247 Ga0207677_10594306 3300026023 Unclassified 970
248 Ga0207677_11123131 3300026023 Bacteria 717
249 Ga0207703_10000189 3300026035 Bacteria 72189
250 Ga0207703_10000327 3300026035 Bacteria 51797
251 Ga0207703_10019349 3300026035 Bacteria 5320
252 Ga0207703_10156598 3300026035 Unclassified 1991
253 Ga0207703_10528569 3300026035 Bacteria 1110
254 Ga0207703_10717727 3300026035 Bacteria 951
255 Ga0207703_10886665 3300026035 Bacteria 854
256 Ga0207678_10086544 3300026067 Bacteria 2678
257 Ga0207678_10276433 3300026067 Unclassified 1441
258 Ga0207678_10362937 3300026067 Bacteria 1250
259 Ga0207702_10338310 3300026078 Bacteria 1437
260 Ga0207641_10000120 3300026088 Bacteria 116070
261 Ga0207641_10000138 3300026088 Bacteria 106531
262 Ga0207641_10003524 3300026088 Bacteria 13854
263 Ga0207641_10004180 3300026088 Bacteria 12578
264 Ga0207641_10006879 3300026088 Bacteria 9520
265 Ga0207641_10069752 3300026088 Plasmid 3019
266 Ga0207641_10163030 3300026088 Bacteria 2028
267 Ga0207641_10248727 3300026088 Bacteria 1659
268 Ga0207641_10423310 3300026088 Unclassified 1282
269 Ga0207648_10015252 3300026089 Bacteria 7067
270 Ga0207648_10098971 3300026089 Unclassified 2554
271 Ga0207676_10000424 3300026095 Bacteria 35638
272 Ga0207676_10000499 3300026095 Bacteria 33023
273 Ga0207676_10000983 3300026095 Bacteria 21929
274 Ga0207676_10008456 3300026095 Bacteria 7317
275 Ga0207676_10014273 3300026095 Bacteria 5711
276 Ga0207676_10451117 3300026095 Bacteria 1212
277 Ga0207674_10000338 3300026116 Bacteria 60092
278 Ga0207675_100237552 3300026118 Bacteria 1760
279 Ga0207683_10071451 3300026121 Bacteria 3068
280 Ga0207683_10151998 3300026121 Bacteria 2089
281 Ga0207698_10051400 3300026142 Bacteria 3151
282 Ga0207698_10066849 3300026142 Bacteria 2832
283 Ga0207698_10094666 3300026142 Bacteria 2456
284 Ga0207698_10438432 3300026142 Bacteria 1258
285 Ga0207698_11153715 3300026142 Bacteria 788
286 Ga0207698_11154322 3300026142 Unclassified 788
287 Ga0209813_10012071 3300027866 Bacteria 2273
288 Ga0268266_10019857 3300028379 Bacteria 5726
289 Ga0268266_10088811 3300028379 Bacteria 2705
290 Ga0268266_11434931 3300028379 Bacteria 666
291 Ga0268265_10000139 3300028380 Bacteria 92561
292 Ga0268265_10103089 3300028380 Bacteria 2309
293 Ga0268265_10392683 3300028380 Bacteria 1280
294 Ga0268264_10000585 3300028381 Bacteria 44270
295 Ga0268264_10002490 3300028381 Bacteria 16193
296 Ga0268264_10003421 3300028381 Bacteria 13690
297 Ga0268264_10049895 3300028381 Bacteria 3483
298 Ga0268264_10171255 3300028381 Unclassified 1964
299 Ga0268264_10177384 3300028381 Bacteria 1932
300 Ga0268264_11105728 3300028381 Bacteria 801
301 Ga0307517_10067914 3300028786 Bacteria 3256
302 Ga0307517_10234455 3300028786 Bacteria 1097
303 Ga0265338_10011878 3300028800 Bacteria 10001
304 Ga0307410_10095268 3300031852 Bacteria 2122
305 Ga0307410_10709867 3300031852 Bacteria 848
306 Ga0307409_100125147 3300031995 Bacteria 2185
307 Ga0307409_100167244 3300031995 Bacteria 1931
308 Ga0307416_100869559 3300032002 Bacteria 1000
309 Ga0307416_101155372 3300032002 Bacteria 879
310 Ga0307414_10024715 3300032004 Bacteria 3836
311 Ga0307414_10054106 3300032004 Bacteria 2803
312 Ga0307414_10297684 3300032004 Bacteria 1363
313 Ga0307411_10023093 3300032005 Bacteria 3676
314 Ga0307411_10076493 3300032005 Bacteria 2288
315 Ga0373956_0049802 3300035119 Bacteria 1879
316 Ga0373957_0088550 3300035120 Bacteria 1228
317 Ga0373955_0033240 3300035172 Bacteria 2715
318 Ga0373935_0493702 3300035692 Bacteria 888
319 Ga0373933_0264458 3300035724 Bacteria 1109
320 Ga0373937_0720621 3300036401 Bacteria 944
321 Ga0395899_0000738 3300037312 Bacteria 32643
322 Ga0395899_0056458 3300037312 Bacteria 2902
323 Ga0395900_0000723 3300037418 Bacteria 43948
324 Ga0395900_0002146 3300037418 Bacteria 22069
325 Ga0395900_0182973 3300037418 Bacteria 2128
326 Ga0395900_0193157 3300037418 Bacteria 2064
327 Ga0395900_0227057 3300037418 Bacteria 1879
328 Ga0395900_0362907 3300037418 Bacteria 1419
329 Ga0395900_0733524 3300037418 Bacteria 919
330 Ga0395900_0776881 3300037418 Unclassified 887
331 Ga0395900_0815305 3300037418 Bacteria 860
332 Ga0395898_0000087 3300037466 Bacteria 239211
333 Ga0395898_0184174 3300037466 Bacteria 1995
334 Ga0395898_0230239 3300037466 Bacteria 1767
335 Ga0395898_0253104 3300037466 Bacteria 1680
336 Ga0395898_0370627 3300037466 Bacteria 1365
337 Ga0395898_0419411 3300037466 Bacteria 1275
338 Ga0395905_0000005 3300037471 Bacteria 557808
339 Ga0395905_0004198 3300037471 Bacteria 15079
340 Ga0395905_0012333 3300037471 Bacteria 8227
341 Ga0395905_0027610 3300037471 Bacteria 5352
342 Ga0395905_0075451 3300037471 Bacteria 3160
343 Ga0395905_0090883 3300037471 Bacteria 2862
344 Ga0395905_0429230 3300037471 Bacteria 1218
345 Ga0395901_0004296 3300038443 Bacteria 14371
346 Ga0395901_0066762 3300038443 Bacteria 3746
347 Ga0395901_0158945 3300038443 Bacteria 2373
348 Ga0395901_0207372 3300038443 Bacteria 2052
349 Ga0395901_0312221 3300038443 Bacteria 1628
350 Ga0395901_0502895 3300038443 Bacteria 1233
351 Ga0395901_0841706 3300038443 Bacteria 903
352 Ga0451841_0498122 3300041498 Unclassified 796
353 Ga0451843_0281590 3300041509 Bacteria 1208
354 Ga0451843_0776697 3300041509 Bacteria 710
355 Ga0451853_1049919 3300041512 Bacteria 860
356 Ga0439458_0006030 3300042157 Bacteria 2711
357 Ga0466963_0493027 3300044694 Bacteria 865
358 Ga0466967_0855899 3300045976 Bacteria 904
359 Ga0495605_0334226 3300046474 Bacteria 637
360 Ga0495625_0211863 3300046660 Bacteria 1273
361 Ga0495623_0325257 3300046679 Bacteria 843
362 Ga0495669_0000672 3300046684 Bacteria 14889
363 Ga0495677_0037792 3300047445 Bacteria 1764
364 Ga0495685_040094 3300047447 Bacteria 1602
365 Ga0495686_0102439 3300047472 Bacteria 1725
366 Ga0495602_0137338 3300048088 Bacteria 1940
367 Ga0496100_1239699 3300048903 Bacteria 588
368 Ga0496101_0063216 3300048904 Unclassified 2694
369 Ga0496102_0023075 3300048905 Bacteria 5522
370 Ga0496102_0430319 3300048905 Unclassified 1239
371 Ga0496104_0397583 3300048907 Bacteria 1290
372 Ga0496104_1257759 3300048907 Bacteria 643
373 Ga0496108_0014277 3300048911 Bacteria 6480
374 Ga0496108_0085930 3300048911 Bacteria 2671
375 Ga0496109_0010102 3300048912 Bacteria 8052
376 Ga0496109_0057528 3300048912 Bacteria 3549
377 Ga0496110_0008076 3300048913 Bacteria 8450
378 Ga0496111_0047774 3300048914 Bacteria 3082
379 Ga0496111_0241559 3300048914 Bacteria 1341
380 Ga0496112_0027353 3300048915 Bacteria 5498
381 Ga0496112_0220997 3300048915 Bacteria 1850
382 Ga0496113_0015082 3300048916 Bacteria 5295
383 Ga0496113_0029264 3300048916 Bacteria 3975
384 Ga0496113_0029609 3300048916 Bacteria 3957
385 Ga0496114_0708609 3300048917 Unclassified 882
386 nmdc:mga03683_13471_c1 3300050489 Bacteria 3011
387 nmdc:mga03n38_36924_c1 3300050490 Bacteria 2104
388 nmdc:mga06z11_51784_c1 3300050494 Bacteria 2104
389 nmdc:mga04h51_22973_c1 3300050495 Bacteria 1894
390 nmdc:mga07m45_160853_c1 3300050496 Bacteria 1304
391 nmdc:mga07m45_245005_c1 3300050496 Bacteria 1043
392 nmdc:mga0sz30_13857_c1 3300050516 Bacteria 3164
393 nmdc:mga0sz30_74871_c1 3300050516 Bacteria 1461
394 Ga0495612_0173340 3300053078 Bacteria 945
395 Ga0495655_0147899 3300053083 Bacteria 736
396 Ga0500652_085729 3300053131 Bacteria 1313
397 Ga0500658_0000036 3300053134 Bacteria 85304
398 Ga0500559_0046268 3300053136 Bacteria 1907
399 Ga0395900_0201799
400 JGI24752J21851_1021150
401 JGI24737J22298_10002645
402 JGI24743J22301_10029590
403 Ga0065712_10024387
404 Ga0065715_10348461
405 Ga0065707_10248873
406 Ga0070658_10010412
407 Ga0070658_10057703
408 Ga0070658_11220567
409 Ga0070670_100014484
410 Ga0070670_100023002
411 Ga0070670_100128161
412 Ga0070666_10003235
413 Ga0070666_10078426
414 Ga0070666_10821150
415 Ga0068868_100037939
416 Ga0068868_100260376
417 Ga0070660_100005456
418 Ga0070660_100008354
419 Ga0070661_100035455
420 Ga0070661_100066514
421 Ga0070661_100196154
422 Ga0070668_100018634
423 Ga0070668_100078795
424 Ga0070668_100224451
425 Ga0070668_100462636
426 Ga0070669_100105504
427 Ga0070669_100117638
428 Ga0070669_100369403
429 Ga0070675_100051826
430 Ga0070675_100443484
431 Ga0070671_100003691
432 Ga0070671_100075533
433 Ga0070671_100334375
434 Ga0070674_100065171
435 Ga0070673_100006469
436 Ga0070673_100041934
437 Ga0070673_100042797
438 Ga0070673_100155534
439 Ga0070673_100415953
440 Ga0070659_100053957
441 Ga0070667_100019361
442 Ga0070667_100036331
443 Ga0070667_100075236
444 Ga0070667_100167662
445 Ga0070667_100175009
446 Ga0070714_100339690
447 Ga0070713_100889533
448 Ga0070713_100938572
449 Ga0070678_100092061
450 Ga0070678_100103368
451 Ga0070662_100004294
452 Ga0070662_100107014
453 Ga0070662_100259960
454 Ga0070681_10370635
455 Ga0068867_100016476
456 Ga0068867_100019280
457 Ga0070684_101271547
458 Ga0068853_100032774
459 Ga0068853_101252269
460 Ga0070672_100012993
461 Ga0070672_100122087
462 Ga0070665_100026147
463 Ga0070665_100051475
464 Ga0070665_100054204
465 Ga0070665_101011562
466 Ga0068855_100033095
467 Ga0070664_100057089
468 Ga0070664_100456172
469 Ga0070664_100565592
470 Ga0068857_100013505
471 Ga0068854_100282841
472 Ga0068856_100807834
473 Ga0068852_100050391
474 Ga0068852_100067571
475 Ga0068852_100601352
476 Ga0068852_100989638
477 Ga0068859_100000088
478 Ga0068859_100179078
479 Ga0068859_100509549
480 Ga0068864_100000136
481 Ga0068864_100002426
482 Ga0068864_100014686
483 Ga0068864_100016278
484 Ga0068864_100020504
485 Ga0068864_100021856
486 Ga0068864_100560297
487 Ga0068851_10058955
488 Ga0068851_10084041
489 Ga0068851_10209048
490 Ga0068870_10182890
491 Ga0068863_100000167
492 Ga0068863_100000384
493 Ga0068863_100004005
494 Ga0068863_100025913
495 Ga0068863_100028267
496 Ga0068863_100030468
497 Ga0068863_100050590
498 Ga0068863_100298882
499 Ga0068858_100000063
500 Ga0068858_100000198
501 Ga0068858_100006677
502 Ga0068858_100026724
503 Ga0068858_100797124
504 Ga0068858_101266089
505 Ga0068860_100000479
506 Ga0068860_100064324
507 Ga0068860_100144850
508 Ga0068860_100160226
509 Ga0068860_100249150
510 Ga0068860_100899614
511 Ga0068862_100000118
512 Ga0068862_100011336
513 Ga0068862_100560111
514 Ga0068862_100636234
515 Ga0070717_10197104
516 Ga0075368_10019813
517 Ga0075363_100020217
518 Ga0075367_10032013
519 Ga0097621_100025108
520 Ga0097621_100129922
521 Ga0075370_10083090
522 Ga0075370_10198598
523 Ga0068871_100007735
524 Ga0068871_100009438
525 Ga0068865_100123300
526 Ga0097620_100000088
527 Ga0097620_100179089
528 Ga0097620_100509498
529 Ga0105250_10023119
530 Ga0105245_10169329
531 Ga0105247_10086331
532 Ga0105247_10096625
533 Ga0105243_10103834
534 Ga0105242_10046670
535 Ga0105248_10000169
536 Ga0105248_10000604
537 Ga0105248_10002620
538 Ga0105248_10011420
539 Ga0105248_10022740
540 Ga0105248_10733480
541 Ga0105238_10107575
542 Ga0105249_10000119
543 Ga0105249_10015607
544 Ga0105249_10043788
545 Ga0105239_10094823
546 Ga0105246_11301832
547 Ga0157373_10402396
548 Ga0157371_10647245
549 Ga0157370_10267551
550 Ga0157370_10912032
551 Ga0157369_10129831
552 Ga0157374_10012908
553 Ga0157378_10331865
554 Ga0157378_10413513
555 Ga0163162_10003404
556 Ga0163162_10024995
557 Ga0163162_10081113
558 Ga0157372_10269737
559 Ga0157375_10135557
560 Ga0157375_10151601
561 Ga0157375_10364237
562 Ga0163163_10000170
563 Ga0163163_10024398
564 Ga0157380_10071399
565 Ga0157380_10205844
566 Ga0157379_10014561
567 Ga0157379_10073398
568 Ga0157379_10195401
569 Ga0157376_10036943
570 Ga0163161_10181481
571 Ga0207696_1017173
572 Ga0207710_10000484
573 Ga0207688_10051666
574 Ga0207680_10061034
575 Ga0207680_10093238
576 Ga0207680_10106194
577 Ga0207680_10152352
578 Ga0207705_10000468
579 Ga0207705_10031608
580 Ga0207705_10142344
581 Ga0207657_10005698
582 Ga0207657_10007540
583 Ga0207649_10090524
584 Ga0207649_10591707
585 Ga0207652_10082638
586 Ga0207681_10103817
587 Ga0207681_10113988
588 Ga0207681_10246163
589 Ga0207681_10545179
590 Ga0207681_11032085
591 Ga0207694_10242390
592 Ga0207650_10000136
593 Ga0207650_10037594
594 Ga0207650_10561842
595 Ga0207659_10059299
596 Ga0207659_11283995
597 Ga0207687_10110377
598 Ga0207700_10344795
599 Ga0207644_10000061
600 Ga0207644_10023683
601 Ga0207644_10026218
602 Ga0207690_10149376
603 Ga0207690_10251712
604 Ga0207706_10002200
605 Ga0207706_10004173
606 Ga0207706_10149390
607 Ga0207706_10191778
608 Ga0207706_10988140
609 Ga0207686_10285744
610 Ga0207691_10007149
611 Ga0207691_10007401
612 Ga0207691_10025850
613 Ga0207691_10131011
614 Ga0207711_10000039
615 Ga0207711_10002205
616 Ga0207711_10014171
617 Ga0207711_10015210
618 Ga0207711_10134537
619 Ga0207711_10229069
620 Ga0207711_10268180
621 Ga0207679_10005984
622 Ga0207679_10424786
623 Ga0207667_10084314
624 Ga0207667_10419134
625 Ga0207651_10001804
626 Ga0207651_10005876
627 Ga0207651_10013014
628 Ga0207651_10137964
629 Ga0207712_10000048
630 Ga0207712_10000772
631 Ga0207712_10061275
632 Ga0207712_10314110
633 Ga0207668_10005475
634 Ga0207668_10017968
635 Ga0207668_10292241
636 Ga0207668_10649553
637 Ga0207640_10775287
638 Ga0207658_10000167
639 Ga0207658_10001595
640 Ga0207658_10002756
641 Ga0207658_10048674
642 Ga0207658_10131466
643 Ga0207658_10179262
644 Ga0207658_10965136
645 Ga0207677_10594306
646 Ga0207677_11123131
647 Ga0207703_10000189
648 Ga0207703_10000327
649 Ga0207703_10019349
650 Ga0207703_10156598
651 Ga0207703_10528569
652 Ga0207703_10717727
653 Ga0207703_10886665
654 Ga0207678_10086544
655 Ga0207678_10276433
656 Ga0207678_10362937
657 Ga0207702_10338310
658 Ga0207641_10000120
659 Ga0207641_10000138
660 Ga0207641_10003524
661 Ga0207641_10004180
662 Ga0207641_10006879
663 Ga0207641_10069752
664 Ga0207641_10163030
665 Ga0207641_10248727
666 Ga0207641_10423310
667 Ga0207648_10015252
668 Ga0207648_10098971
669 Ga0207676_10000424
670 Ga0207676_10000499
671 Ga0207676_10000983
672 Ga0207676_10008456
673 Ga0207676_10014273
674 Ga0207676_10451117
675 Ga0207674_10000338
676 Ga0207675_100237552
677 Ga0207683_10071451
678 Ga0207683_10151998
679 Ga0207698_10051400
680 Ga0207698_10066849
681 Ga0207698_10094666
682 Ga0207698_10438432
683 Ga0207698_11153715
684 Ga0207698_11154322
685 Ga0209813_10012071
686 Ga0268266_10019857
687 Ga0268266_10088811
688 Ga0268266_11434931
689 Ga0268265_10000139
690 Ga0268265_10103089
691 Ga0268265_10392683
692 Ga0268264_10000585
693 Ga0268264_10002490
694 Ga0268264_10003421
695 Ga0268264_10049895
696 Ga0268264_10171255
697 Ga0268264_10177384
698 Ga0268264_11105728
699 Ga0307517_10067914
700 Ga0307517_10234455
701 Ga0265338_10011878
702 Ga0307410_10095268
703 Ga0307410_10709867
704 Ga0307409_100125147
705 Ga0307409_100167244
706 Ga0307416_100869559
707 Ga0307416_101155372
708 Ga0307414_10024715
709 Ga0307414_10054106
710 Ga0307414_10297684
711 Ga0307411_10023093
712 Ga0307411_10076493
713 Ga0373956_0049802
714 Ga0373957_0088550
715 Ga0373955_0033240
716 Ga0373935_0493702
717 Ga0373933_0264458
718 Ga0373937_0720621
719 Ga0395899_0000738
720 Ga0395899_0056458
721 Ga0395900_0000723
722 Ga0395900_0002146
723 Ga0395900_0182973
724 Ga0395900_0193157
725 Ga0395900_0227057
726 Ga0395900_0362907
727 Ga0395900_0733524
728 Ga0395900_0776881
729 Ga0395900_0815305
730 Ga0395898_0000087
731 Ga0395898_0184174
732 Ga0395898_0230239
733 Ga0395898_0253104
734 Ga0395898_0370627
735 Ga0395898_0419411
736 Ga0395905_0000005
737 Ga0395905_0004198
738 Ga0395905_0012333
739 Ga0395905_0027610
740 Ga0395905_0075451
741 Ga0395905_0090883
742 Ga0395905_0429230
743 Ga0395901_0004296
744 Ga0395901_0066762
745 Ga0395901_0158945
746 Ga0395901_0207372
747 Ga0395901_0312221
748 Ga0395901_0502895
749 Ga0395901_0841706
750 Ga0451841_0498122
751 Ga0451843_0281590
752 Ga0451843_0776697
753 Ga0451853_1049919
754 Ga0439458_0006030
755 Ga0466963_0493027
756 Ga0466967_0855899
757 Ga0495605_0334226
758 Ga0495625_0211863
759 Ga0495623_0325257
760 Ga0495669_0000672
761 Ga0495677_0037792
762 Ga0495685_040094
763 Ga0495686_0102439
764 Ga0495602_0137338
765 Ga0496100_1239699
766 Ga0496101_0063216
767 Ga0496102_0023075
768 Ga0496102_0430319
769 Ga0496104_0397583
770 Ga0496104_1257759
771 Ga0496108_0014277
772 Ga0496108_0085930
773 Ga0496109_0010102
774 Ga0496109_0057528
775 Ga0496110_0008076
776 Ga0496111_0047774
777 Ga0496111_0241559
778 Ga0496112_0027353
779 Ga0496112_0220997
780 Ga0496113_0015082
781 Ga0496113_0029264
782 Ga0496113_0029609
783 Ga0496114_0708609
784 nmdc:mga03683_13471_c1
785 nmdc:mga03n38_36924_c1
786 nmdc:mga06z11_51784_c1
787 nmdc:mga04h51_22973_c1
788 nmdc:mga07m45_160853_c1
789 nmdc:mga07m45_245005_c1
790 nmdc:mga0sz30_13857_c1
791 nmdc:mga0sz30_74871_c1
792 Ga0495612_0173340
793 Ga0495655_0147899
794 Ga0500652_085729
795 Ga0500658_0000036
796 Ga0500559_0046268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09351

DUF1993

Domain of unknown function (DUF1993)

45

201

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qth-assembly1.cif.gz_B crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.9132 6 161
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8905 6 161
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.8693 5 173
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.8411 5 173
3qth-assembly1.cif.gz_B crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8082 6 161
ID Description Score Start End Superfamily
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9104 6 161 1.20.120.450
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8921 11 162 1.20.120.450
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.811 11 162 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.808 6 161 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6547 4 151 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A359D5N7-F1-model_v4 DUF1993 domain-containing protein 0.9853 40 154
AF-A0A2R7SJI8-F1-model_v4 deleted 0.9779 40 162
AF-A0A359D5N7-F1-model_v4 DUF1993 domain-containing protein 0.9768 40 154
AF-A0A3N5H1L3-F1-model_v4 DUF1993 domain-containing protein 0.976 49 162
AF-A0A2T5I0L7-F1-model_v4 DUF1993 domain-containing protein 0.972 46 162

Map