F434099

General Info

Members Datasets Scaffolds Average Seq Length
398 202 796 140

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0584438|Ga0395898_0584438_396_914
Length 172
Sequence MLFYDSNTAELLLFPSSETALVSPTRRTAKGAAMLKDFRAFIAKGNVLDLAVAVIIGAAFGKIATSLTEDIIMPIVGKIFGGLDFSSYFTLLGPLPAGYKGSMNDYAALKAAGAPVLGWGAFVTVVINFVILAFIIFLLVRAATKAMRKREEAGGPTEVELLTEIRDELKKR

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
87 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
191 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
192 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
193 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
194 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
198 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
201 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
202 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 0
Rhizoplane 0.75
Rhizosphere 95.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0584438 3300037466 Bacteria 1059
2 JGI24736J21556_1025599 3300001904 Bacteria 918
3 JGI24741J21665_1015857 3300001915 Bacteria 1238
4 JGI24747J21853_1013752 3300001978 Bacteria 837
5 JGI24740J21852_10015952 3300001979 Bacteria 2728
6 JGI24739J22299_10001094 3300001989 Bacteria 10097
7 JGI24739J22299_10229561 3300001989 Bacteria 544
8 JGI24737J22298_10000410 3300001990 Bacteria 14666
9 JGI24743J22301_10132468 3300001991 Bacteria 551
10 JGI24748J21848_1009932 3300002074 Bacteria 1121
11 JGI24738J21930_10003193 3300002075 Bacteria 4187
12 JGI24742J22300_10007931 3300002244 Bacteria 1753
13 Ga0055542_1000259 3300003762 Bacteria 59537
14 Ga0055529_1003225 3300003763 Bacteria 2778
15 Ga0065715_10111430 3300005293 Bacteria 2567
16 Ga0065715_10166982 3300005293 Bacteria 1578
17 Ga0070658_10048042 3300005327 Bacteria 3455
18 Ga0070658_10259236 3300005327 Bacteria 1476
19 Ga0070658_10290331 3300005327 Bacteria 1393
20 Ga0070658_10299955 3300005327 Bacteria 1370
21 Ga0070658_10636149 3300005327 Bacteria 925
22 Ga0070676_10000162 3300005328 Bacteria 26894
23 Ga0070676_11005595 3300005328 Bacteria 626
24 Ga0070683_101304953 3300005329 Bacteria 697
25 Ga0070690_100007395 3300005330 Bacteria 6292
26 Ga0070670_100094053 3300005331 Bacteria 2578
27 Ga0070670_100351207 3300005331 Bacteria 1295
28 Ga0070670_100552934 3300005331 Bacteria 1027
29 Ga0070677_10002550 3300005333 Bacteria 5830
30 Ga0068869_100000198 3300005334 Bacteria 31224
31 Ga0070666_10155088 3300005335 Bacteria 1599
32 Ga0070680_100206759 3300005336 Bacteria 1656
33 Ga0070680_100848465 3300005336 Bacteria 787
34 Ga0070682_101491491 3300005337 Bacteria 581
35 Ga0068868_100007958 3300005338 Bacteria 7574
36 Ga0070660_100010929 3300005339 Bacteria 6427
37 Ga0070660_100078935 3300005339 Bacteria 2582
38 Ga0070660_100187603 3300005339 Bacteria 1674
39 Ga0070660_100196469 3300005339 Bacteria 1635
40 Ga0070660_100219957 3300005339 Bacteria 1543
41 Ga0070660_100732391 3300005339 Bacteria 830
42 Ga0070687_100156739 3300005343 Bacteria 1342
43 Ga0070661_100015093 3300005344 Bacteria 5449
44 Ga0070661_100037192 3300005344 Bacteria 3540
45 Ga0070661_100205148 3300005344 Bacteria 1507
46 Ga0070692_10879893 3300005345 Bacteria 618
47 Ga0070668_100012654 3300005347 Bacteria 6281
48 Ga0070668_100114814 3300005347 Bacteria 2146
49 Ga0070669_100002760 3300005353 Bacteria 12664
50 Ga0070669_100008759 3300005353 Bacteria 7220
51 Ga0070669_100880916 3300005353 Bacteria 764
52 Ga0070669_101114940 3300005353 Bacteria 680
53 Ga0070675_100030742 3300005354 Bacteria 4337
54 Ga0070675_100146334 3300005354 Bacteria 2023
55 Ga0070675_100577206 3300005354 Bacteria 1018
56 Ga0070671_100027851 3300005355 Bacteria 4652
57 Ga0070674_100035583 3300005356 Bacteria 3336
58 Ga0070674_101198648 3300005356 Bacteria 674
59 Ga0070673_100000412 3300005364 Bacteria 22566
60 Ga0070673_100651773 3300005364 Bacteria 964
61 Ga0070688_100160711 3300005365 Bacteria 1543
62 Ga0070659_100034636 3300005366 Bacteria 3928
63 Ga0070659_100062379 3300005366 Bacteria 2946
64 Ga0070659_100089636 3300005366 Bacteria 2464
65 Ga0070659_100248109 3300005366 Bacteria 1475
66 Ga0070659_100513447 3300005366 Bacteria 1022
67 Ga0070667_100005227 3300005367 Bacteria 10848
68 Ga0070667_100025199 3300005367 Bacteria 4944
69 Ga0070667_101925720 3300005367 Bacteria 557
70 Ga0070663_100039649 3300005455 Bacteria 3293
71 Ga0070663_100612721 3300005455 Bacteria 917
72 Ga0070678_100125205 3300005456 Bacteria 2033
73 Ga0070662_100001397 3300005457 Bacteria 14878
74 Ga0070662_100119916 3300005457 Bacteria 2015
75 Ga0070662_100468196 3300005457 Bacteria 1048
76 Ga0070662_100572332 3300005457 Bacteria 948
77 Ga0070681_10528128 3300005458 Bacteria 1093
78 Ga0068867_100002707 3300005459 Bacteria 12492
79 Ga0070679_100250212 3300005530 Bacteria 1729
80 Ga0070679_100426164 3300005530 Bacteria 1272
81 Ga0068853_100026533 3300005539 Bacteria 4865
82 Ga0068853_100651467 3300005539 Bacteria 1002
83 Ga0070672_100005140 3300005543 Bacteria 8640
84 Ga0070672_100102782 3300005543 Bacteria 2320
85 Ga0070672_100701826 3300005543 Bacteria 886
86 Ga0070693_100556048 3300005547 Bacteria 822
87 Ga0068855_100026440 3300005563 Bacteria 6941
88 Ga0070664_100016751 3300005564 Bacteria 6014
89 Ga0070664_100049359 3300005564 Bacteria 3559
90 Ga0070664_100145789 3300005564 Bacteria 2088
91 Ga0068857_100028411 3300005577 Bacteria 4936
92 Ga0068857_100295059 3300005577 Bacteria 1493
93 Ga0068854_100000599 3300005578 Bacteria 21420
94 Ga0068856_100294449 3300005614 Bacteria 1640
95 Ga0068852_100000805 3300005616 Bacteria 20642
96 Ga0068859_100014917 3300005617 Bacteria 7802
97 Ga0068859_100286491 3300005617 Bacteria 1740
98 Ga0068864_100000592 3300005618 Bacteria 30861
99 Ga0068864_100619319 3300005618 Bacteria 1052
100 Ga0068866_10050519 3300005718 Bacteria 2112
101 Ga0068861_100019435 3300005719 Bacteria 4853
102 Ga0068851_10108702 3300005834 Bacteria 1478
103 Ga0068863_100002181 3300005841 Bacteria 19410
104 Ga0068863_100004142 3300005841 Bacteria 14326
105 Ga0068858_100004047 3300005842 Bacteria 14457
106 Ga0068858_100710837 3300005842 Bacteria 978
107 Ga0068860_100005853 3300005843 Bacteria 12376
108 Ga0068860_100145712 3300005843 Bacteria 2278
109 Ga0068862_100010832 3300005844 Bacteria 7529
110 Ga0097621_100150892 3300006237 Bacteria 1993
111 Ga0068871_101323768 3300006358 Bacteria 678
112 Ga0068865_100007388 3300006881 Bacteria 6761
113 Ga0097620_100014916 3300006931 Bacteria 7802
114 Ga0097620_100286481 3300006931 Bacteria 1740
115 Ga0105245_10002561 3300009098 Bacteria 16366
116 Ga0105243_10348078 3300009148 Bacteria 1360
117 Ga0105241_10394651 3300009174 Bacteria 1212
118 Ga0105242_10240291 3300009176 Bacteria 1628
119 Ga0105248_10005697 3300009177 Bacteria 13685
120 Ga0105248_10039361 3300009177 Bacteria 5293
121 Ga0105238_10022584 3300009551 Bacteria 6411
122 Ga0105239_10067139 3300010375 Bacteria 3939
123 Ga0105246_10111901 3300011119 Bacteria 2007
124 Ga0157373_10373064 3300013100 Bacteria 1020
125 Ga0157371_10007469 3300013102 Bacteria 8846
126 Ga0157371_10099953 3300013102 Bacteria 2057
127 Ga0157371_10200879 3300013102 Bacteria 1429
128 Ga0157371_10960031 3300013102 Bacteria 650
129 Ga0157370_10270104 3300013104 Bacteria 1571
130 Ga0157370_10884689 3300013104 Bacteria 811
131 Ga0157369_10076824 3300013105 Bacteria 3580
132 Ga0157369_10363835 3300013105 Bacteria 1502
133 Ga0157369_10418715 3300013105 Bacteria 1389
134 Ga0157374_12431656 3300013296 Bacteria 551
135 Ga0157378_10007134 3300013297 Bacteria 9763
136 Ga0163162_10006504 3300013306 Bacteria 11316
137 Ga0163162_10118542 3300013306 Bacteria 2749
138 Ga0163162_10137281 3300013306 Bacteria 2557
139 Ga0157372_10605937 3300013307 Bacteria 1276
140 Ga0157375_10031692 3300013308 Bacteria 5004
141 Ga0157380_10029193 3300014326 Bacteria 4215
142 Ga0157379_10084912 3300014968 Bacteria 2837
143 Ga0183363_1017 3300015690 Bacteria 67022
144 Ga0183361_12712 3300016635 Bacteria 960
145 Ga0163161_10907038 3300017792 Bacteria 747
146 Ga0209563_125645 3300025230 Bacteria 606
147 Ga0209148_1000008 3300025254 Bacteria 1504371
148 Ga0209233_1020086 3300025261 Bacteria 1759
149 Ga0209455_1000002 3300025272 Bacteria 1505459
150 Ga0207673_1002476 3300025290 Bacteria 2110
151 Ga0207697_10000285 3300025315 Bacteria 28077
152 Ga0207682_10000308 3300025893 Bacteria 22087
153 Ga0207682_10022282 3300025893 Bacteria 2495
154 Ga0207642_10306451 3300025899 Bacteria 923
155 Ga0207688_10000475 3300025901 Bacteria 19243
156 Ga0207680_10043655 3300025903 Bacteria 2631
157 Ga0207680_10532806 3300025903 Bacteria 838
158 Ga0207647_10000475 3300025904 Bacteria 32451
159 Ga0207645_10018208 3300025907 Bacteria 4627
160 Ga0207645_10047878 3300025907 Bacteria 2730
161 Ga0207645_10163080 3300025907 Bacteria 1459
162 Ga0207645_10266510 3300025907 Bacteria 1135
163 Ga0207705_10001025 3300025909 Bacteria 22684
164 Ga0207705_10088539 3300025909 Bacteria 2265
165 Ga0207705_10158709 3300025909 Bacteria 1698
166 Ga0207705_10901853 3300025909 Bacteria 685
167 Ga0207654_10078590 3300025911 Bacteria 1980
168 Ga0207707_10228411 3300025912 Bacteria 1619
169 Ga0207707_10249031 3300025912 Bacteria 1543
170 Ga0207695_11054926 3300025913 Bacteria 692
171 Ga0207660_10409411 3300025917 Bacteria 1093
172 Ga0207660_10438555 3300025917 Bacteria 1055
173 Ga0207660_11165885 3300025917 Bacteria 627
174 Ga0207662_10406403 3300025918 Bacteria 924
175 Ga0207657_10018329 3300025919 Bacteria 6688
176 Ga0207657_10029976 3300025919 Bacteria 4944
177 Ga0207657_10034186 3300025919 Bacteria 4574
178 Ga0207657_10172458 3300025919 Bacteria 1752
179 Ga0207657_10190421 3300025919 Bacteria 1655
180 Ga0207657_10198183 3300025919 Bacteria 1616
181 Ga0207649_10011076 3300025920 Bacteria 4963
182 Ga0207649_10207899 3300025920 Bacteria 1387
183 Ga0207649_10729313 3300025920 Bacteria 770
184 Ga0207652_10123689 3300025921 Bacteria 2303
185 Ga0207652_10187429 3300025921 Bacteria 1860
186 Ga0207652_10435988 3300025921 Bacteria 1181
187 Ga0207681_10046482 3300025923 Bacteria 2919
188 Ga0207681_10175641 3300025923 Bacteria 1627
189 Ga0207681_10185719 3300025923 Bacteria 1587
190 Ga0207650_10005560 3300025925 Bacteria 8601
191 Ga0207650_10080870 3300025925 Bacteria 2464
192 Ga0207659_10196108 3300025926 Bacteria 1609
193 Ga0207659_10224878 3300025926 Bacteria 1511
194 Ga0207659_10933517 3300025926 Bacteria 746
195 Ga0207687_10017502 3300025927 Bacteria 4720
196 Ga0207644_10017317 3300025931 Bacteria 4864
197 Ga0207690_10019315 3300025932 Bacteria 4194
198 Ga0207690_10057989 3300025932 Bacteria 2617
199 Ga0207690_10252842 3300025932 Bacteria 1362
200 Ga0207706_10001597 3300025933 Bacteria 22512
201 Ga0207706_10009923 3300025933 Bacteria 8731
202 Ga0207706_10044846 3300025933 Bacteria 3917
203 Ga0207686_10135287 3300025934 Bacteria 1696
204 Ga0207670_10010216 3300025936 Bacteria 5398
205 Ga0207669_10055086 3300025937 Bacteria 2406
206 Ga0207704_10024575 3300025938 Bacteria 3271
207 Ga0207691_10001819 3300025940 Bacteria 20863
208 Ga0207691_10310890 3300025940 Bacteria 1352
209 Ga0207711_10005149 3300025941 Bacteria 11077
210 Ga0207711_10005690 3300025941 Bacteria 10525
211 Ga0207689_10000849 3300025942 Bacteria 29415
212 Ga0207661_10979347 3300025944 Bacteria 779
213 Ga0207679_10014348 3300025945 Bacteria 5208
214 Ga0207679_10129473 3300025945 Bacteria 2022
215 Ga0207679_10166540 3300025945 Bacteria 1810
216 Ga0207679_10417572 3300025945 Bacteria 1183
217 Ga0207679_11289873 3300025945 Bacteria 670
218 Ga0207667_10265407 3300025949 Bacteria 1755
219 Ga0207651_10004002 3300025960 Bacteria 7329
220 Ga0207651_10437015 3300025960 Bacteria 1120
221 Ga0207640_10001701 3300025981 Bacteria 11792
222 Ga0207640_10279171 3300025981 Bacteria 1311
223 Ga0207658_10017714 3300025986 Bacteria 4910
224 Ga0207658_10147206 3300025986 Bacteria 1914
225 Ga0207677_10001108 3300026023 Bacteria 14712
226 Ga0207703_10017153 3300026035 Bacteria 5648
227 Ga0207703_10409040 3300026035 Bacteria 1260
228 Ga0207639_10026318 3300026041 Bacteria 4227
229 Ga0207639_10030051 3300026041 Bacteria 3983
230 Ga0207639_10984155 3300026041 Bacteria 790
231 Ga0207678_10026944 3300026067 Bacteria 5013
232 Ga0207678_10470783 3300026067 Bacteria 1093
233 Ga0207678_10635088 3300026067 Bacteria 937
234 Ga0207641_10009130 3300026088 Bacteria 8189
235 Ga0207641_10031302 3300026088 Bacteria 4412
236 Ga0207648_10000950 3300026089 Bacteria 32798
237 Ga0207648_10183277 3300026089 Bacteria 1853
238 Ga0207676_10028442 3300026095 Bacteria 4175
239 Ga0207676_11239797 3300026095 Bacteria 740
240 Ga0207674_10036382 3300026116 Bacteria 5131
241 Ga0207674_10038910 3300026116 Bacteria 4933
242 Ga0207674_10594972 3300026116 Bacteria 1068
243 Ga0207675_100071005 3300026118 Bacteria 3255
244 Ga0207698_10001868 3300026142 Bacteria 12306
245 Ga0209974_10022660 3300027876 Bacteria 2080
246 Ga0268266_10602077 3300028379 Bacteria 1056
247 Ga0268265_10029960 3300028380 Bacteria 3915
248 Ga0268264_10009893 3300028381 Bacteria 7895
249 Ga0268264_10124800 3300028381 Bacteria 2274
250 Ga0307513_10177281 3300031456 Bacteria 2000
251 Ga0307513_10287389 3300031456 Bacteria 1418
252 Ga0307408_100034966 3300031548 Bacteria 3523
253 Ga0307408_100037073 3300031548 Bacteria 3432
254 Ga0307408_100149959 3300031548 Bacteria 1839
255 Ga0307408_100164875 3300031548 Bacteria 1763
256 Ga0307408_100372629 3300031548 Bacteria 1218
257 Ga0307408_101918625 3300031548 Bacteria 568
258 Ga0307405_10005451 3300031731 Bacteria 6135
259 Ga0307405_10129354 3300031731 Bacteria 1742
260 Ga0307405_10182720 3300031731 Bacteria 1507
261 Ga0307405_10219169 3300031731 Bacteria 1395
262 Ga0307405_10593931 3300031731 Bacteria 902
263 Ga0307413_10004263 3300031824 Bacteria 6193
264 Ga0307413_10007127 3300031824 Bacteria 5162
265 Ga0307413_10015110 3300031824 Bacteria 3947
266 Ga0307413_10151304 3300031824 Bacteria 1617
267 Ga0307413_10184991 3300031824 Bacteria 1489
268 Ga0307413_10296324 3300031824 Bacteria 1224
269 Ga0307413_10633752 3300031824 Bacteria 879
270 Ga0307413_10710388 3300031824 Bacteria 836
271 Ga0307413_11045154 3300031824 Bacteria 702
272 Ga0307410_10001333 3300031852 Bacteria 11058
273 Ga0307410_10011651 3300031852 Bacteria 5040
274 Ga0307410_10019223 3300031852 Bacteria 4150
275 Ga0307410_10023184 3300031852 Bacteria 3853
276 Ga0307410_10033110 3300031852 Bacteria 3334
277 Ga0307410_10071240 3300031852 Bacteria 2410
278 Ga0307410_10108198 3300031852 Bacteria 2007
279 Ga0307410_10433766 3300031852 Bacteria 1068
280 Ga0307410_10637035 3300031852 Bacteria 893
281 Ga0307406_10021371 3300031901 Bacteria 3826
282 Ga0307406_10233336 3300031901 Bacteria 1375
283 Ga0307406_10420072 3300031901 Bacteria 1065
284 Ga0307406_10557820 3300031901 Bacteria 938
285 Ga0307406_11046302 3300031901 Bacteria 702
286 Ga0307407_10006716 3300031903 Bacteria 5147
287 Ga0307407_10021846 3300031903 Bacteria 3308
288 Ga0307407_10142898 3300031903 Bacteria 1546
289 Ga0307407_10342976 3300031903 Bacteria 1055
290 Ga0307407_10374781 3300031903 Bacteria 1014
291 Ga0307407_10766961 3300031903 Bacteria 731
292 Ga0307412_10006725 3300031911 Bacteria 6518
293 Ga0307412_10015344 3300031911 Bacteria 4540
294 Ga0307412_10022597 3300031911 Bacteria 3858
295 Ga0307412_10059131 3300031911 Bacteria 2567
296 Ga0307412_10117863 3300031911 Bacteria 1907
297 Ga0307412_10290083 3300031911 Bacteria 1288
298 Ga0307412_10464076 3300031911 Bacteria 1046
299 Ga0307412_10500890 3300031911 Bacteria 1011
300 Ga0307412_11619880 3300031911 Bacteria 591
301 Ga0307409_100008382 3300031995 Bacteria 6268
302 Ga0307409_100016659 3300031995 Bacteria 4871
303 Ga0307409_100017667 3300031995 Bacteria 4763
304 Ga0307409_100023088 3300031995 Bacteria 4302
305 Ga0307409_100116962 3300031995 Bacteria 2248
306 Ga0307409_100148315 3300031995 Bacteria 2032
307 Ga0307409_100229867 3300031995 Bacteria 1680
308 Ga0307409_100619955 3300031995 Bacteria 1071
309 Ga0307409_100708465 3300031995 Bacteria 1007
310 Ga0307409_100897759 3300031995 Bacteria 899
311 Ga0307409_101596914 3300031995 Bacteria 680
312 Ga0307409_101715451 3300031995 Bacteria 657
313 Ga0307409_101938434 3300031995 Bacteria 619
314 Ga0307416_100002387 3300032002 Bacteria 10759
315 Ga0307416_100033054 3300032002 Bacteria 3917
316 Ga0307416_100091939 3300032002 Bacteria 2607
317 Ga0307416_100097592 3300032002 Bacteria 2545
318 Ga0307416_100101378 3300032002 Bacteria 2507
319 Ga0307416_100102885 3300032002 Bacteria 2492
320 Ga0307416_100315316 3300032002 Bacteria 1563
321 Ga0307416_100397566 3300032002 Bacteria 1414
322 Ga0307416_100530556 3300032002 Bacteria 1247
323 Ga0307416_102005087 3300032002 Bacteria 681
324 Ga0307414_10043030 3300032004 Bacteria 3073
325 Ga0307414_10067809 3300032004 Bacteria 2557
326 Ga0307414_10075767 3300032004 Bacteria 2442
327 Ga0307414_10108220 3300032004 Bacteria 2108
328 Ga0307414_10215861 3300032004 Bacteria 1571
329 Ga0307414_10246142 3300032004 Bacteria 1483
330 Ga0307414_10572018 3300032004 Bacteria 1010
331 Ga0307414_11542904 3300032004 Bacteria 618
332 Ga0307411_10003609 3300032005 Bacteria 7225
333 Ga0307411_10011827 3300032005 Bacteria 4731
334 Ga0307411_10015292 3300032005 Bacteria 4304
335 Ga0307411_10031620 3300032005 Bacteria 3259
336 Ga0307411_10050508 3300032005 Bacteria 2708
337 Ga0307411_10200130 3300032005 Bacteria 1533
338 Ga0307411_10251631 3300032005 Bacteria 1389
339 Ga0307411_10702022 3300032005 Bacteria 881
340 Ga0307415_100005979 3300032126 Bacteria 6520
341 Ga0307415_100033396 3300032126 Bacteria 3340
342 Ga0307415_100087769 3300032126 Bacteria 2242
343 Ga0307415_100133654 3300032126 Bacteria 1882
344 Ga0307415_100649563 3300032126 Bacteria 945
345 Ga0307415_100879148 3300032126 Bacteria 824
346 Ga0307510_10027330 3300033180 Bacteria 6538
347 Ga0395899_0177953 3300037312 Bacteria 1495
348 Ga0395900_0281769 3300037418 Bacteria 1654
349 Ga0395900_0307236 3300037418 Bacteria 1570
350 Ga0395898_1080461 3300037466 Bacteria 736
351 Ga0395905_1107010 3300037471 Bacteria 695
352 Ga0395901_0235708 3300038443 Bacteria 1910
353 Ga0395901_0531881 3300038443 Bacteria 1193
354 Ga0395901_1270460 3300038443 Bacteria 699
355 Ga0439465_0044375 3300041413 Bacteria 1444
356 Ga0439445_0034267 3300042004 Bacteria 1330
357 Ga0439432_058706 3300042006 Bacteria 1189
358 Ga0439449_0016730 3300042007 Bacteria 2755
359 Ga0439449_0237208 3300042007 Bacteria 685
360 Ga0450920_023993 3300042122 Bacteria 1184
361 Ga0439464_0002322 3300042439 Bacteria 4657
362 Ga0466965_0361390 3300044683 Bacteria 797
363 Ga0466963_0024836 3300044694 Bacteria 3816
364 Ga0466964_0085911 3300044706 Bacteria 1360
365 Ga0466957_0000132 3300044842 Bacteria 31445
366 Ga0466960_0314335 3300044901 Bacteria 886
367 Ga0466967_0046479 3300045976 Bacteria 3779
368 Ga0466967_1588973 3300045976 Bacteria 651
369 Ga0495617_010807 3300046452 Bacteria 3126
370 Ga0495650_0001001 3300046471 Bacteria 31974
371 Ga0495594_0311869 3300046499 Bacteria 896
372 Ga0495583_0000879 3300046506 Bacteria 36366
373 Ga0495598_0096488 3300046537 Bacteria 972
374 Ga0495597_0270443 3300046542 Bacteria 664
375 Ga0495633_0027026 3300046558 Bacteria 2809
376 Ga0495611_0151556 3300046648 Bacteria 1082
377 Ga0495623_0011435 3300046679 Bacteria 5744
378 Ga0495613_0056027 3300046689 Bacteria 2895
379 Ga0495677_0003366 3300047445 Bacteria 6219
380 Ga0496100_1266377 3300048903 Bacteria 582
381 Ga0496103_0177381 3300048906 Bacteria 1369
382 Ga0496112_1404643 3300048915 Bacteria 613
383 Ga0501047_0185474 3300049581 Bacteria 1946
384 Ga0501047_0423139 3300049581 Bacteria 1163
385 Ga0501067_0078488 3300049583 Bacteria 1830
386 Ga0501198_066908 3300049649 Bacteria 670
387 Ga0501233_175041 3300049668 Bacteria 612
388 Ga0501253_089927 3300049683 Bacteria 705
389 Ga0501268_180986 3300049765 Bacteria 502
390 Ga0501273_005194 3300049770 Bacteria 1461
391 Ga0501035_0349720 3300049822 Bacteria 1237
392 Ga0501044_0652589 3300049823 Bacteria 941
393 Ga0500607_177986 3300053121 Bacteria 947
394 Ga0500585_073216 3300053144 Bacteria 1237
395 Ga0500622_0177546 3300053156 Bacteria 986
396 Ga0500596_000172 3300053735 Bacteria 10318
397 Ga0500661_006113 3300055283 Bacteria 2246
398 Ga0590075_088469 3300059424 Bacteria 803
399 Ga0395898_0584438
400 JGI24736J21556_1025599
401 JGI24741J21665_1015857
402 JGI24747J21853_1013752
403 JGI24740J21852_10015952
404 JGI24739J22299_10001094
405 JGI24739J22299_10229561
406 JGI24737J22298_10000410
407 JGI24743J22301_10132468
408 JGI24748J21848_1009932
409 JGI24738J21930_10003193
410 JGI24742J22300_10007931
411 Ga0055542_1000259
412 Ga0055529_1003225
413 Ga0065715_10111430
414 Ga0065715_10166982
415 Ga0070658_10048042
416 Ga0070658_10259236
417 Ga0070658_10290331
418 Ga0070658_10299955
419 Ga0070658_10636149
420 Ga0070676_10000162
421 Ga0070676_11005595
422 Ga0070683_101304953
423 Ga0070690_100007395
424 Ga0070670_100094053
425 Ga0070670_100351207
426 Ga0070670_100552934
427 Ga0070677_10002550
428 Ga0068869_100000198
429 Ga0070666_10155088
430 Ga0070680_100206759
431 Ga0070680_100848465
432 Ga0070682_101491491
433 Ga0068868_100007958
434 Ga0070660_100010929
435 Ga0070660_100078935
436 Ga0070660_100187603
437 Ga0070660_100196469
438 Ga0070660_100219957
439 Ga0070660_100732391
440 Ga0070687_100156739
441 Ga0070661_100015093
442 Ga0070661_100037192
443 Ga0070661_100205148
444 Ga0070692_10879893
445 Ga0070668_100012654
446 Ga0070668_100114814
447 Ga0070669_100002760
448 Ga0070669_100008759
449 Ga0070669_100880916
450 Ga0070669_101114940
451 Ga0070675_100030742
452 Ga0070675_100146334
453 Ga0070675_100577206
454 Ga0070671_100027851
455 Ga0070674_100035583
456 Ga0070674_101198648
457 Ga0070673_100000412
458 Ga0070673_100651773
459 Ga0070688_100160711
460 Ga0070659_100034636
461 Ga0070659_100062379
462 Ga0070659_100089636
463 Ga0070659_100248109
464 Ga0070659_100513447
465 Ga0070667_100005227
466 Ga0070667_100025199
467 Ga0070667_101925720
468 Ga0070663_100039649
469 Ga0070663_100612721
470 Ga0070678_100125205
471 Ga0070662_100001397
472 Ga0070662_100119916
473 Ga0070662_100468196
474 Ga0070662_100572332
475 Ga0070681_10528128
476 Ga0068867_100002707
477 Ga0070679_100250212
478 Ga0070679_100426164
479 Ga0068853_100026533
480 Ga0068853_100651467
481 Ga0070672_100005140
482 Ga0070672_100102782
483 Ga0070672_100701826
484 Ga0070693_100556048
485 Ga0068855_100026440
486 Ga0070664_100016751
487 Ga0070664_100049359
488 Ga0070664_100145789
489 Ga0068857_100028411
490 Ga0068857_100295059
491 Ga0068854_100000599
492 Ga0068856_100294449
493 Ga0068852_100000805
494 Ga0068859_100014917
495 Ga0068859_100286491
496 Ga0068864_100000592
497 Ga0068864_100619319
498 Ga0068866_10050519
499 Ga0068861_100019435
500 Ga0068851_10108702
501 Ga0068863_100002181
502 Ga0068863_100004142
503 Ga0068858_100004047
504 Ga0068858_100710837
505 Ga0068860_100005853
506 Ga0068860_100145712
507 Ga0068862_100010832
508 Ga0097621_100150892
509 Ga0068871_101323768
510 Ga0068865_100007388
511 Ga0097620_100014916
512 Ga0097620_100286481
513 Ga0105245_10002561
514 Ga0105243_10348078
515 Ga0105241_10394651
516 Ga0105242_10240291
517 Ga0105248_10005697
518 Ga0105248_10039361
519 Ga0105238_10022584
520 Ga0105239_10067139
521 Ga0105246_10111901
522 Ga0157373_10373064
523 Ga0157371_10007469
524 Ga0157371_10099953
525 Ga0157371_10200879
526 Ga0157371_10960031
527 Ga0157370_10270104
528 Ga0157370_10884689
529 Ga0157369_10076824
530 Ga0157369_10363835
531 Ga0157369_10418715
532 Ga0157374_12431656
533 Ga0157378_10007134
534 Ga0163162_10006504
535 Ga0163162_10118542
536 Ga0163162_10137281
537 Ga0157372_10605937
538 Ga0157375_10031692
539 Ga0157380_10029193
540 Ga0157379_10084912
541 Ga0183363_1017
542 Ga0183361_12712
543 Ga0163161_10907038
544 Ga0209563_125645
545 Ga0209148_1000008
546 Ga0209233_1020086
547 Ga0209455_1000002
548 Ga0207673_1002476
549 Ga0207697_10000285
550 Ga0207682_10000308
551 Ga0207682_10022282
552 Ga0207642_10306451
553 Ga0207688_10000475
554 Ga0207680_10043655
555 Ga0207680_10532806
556 Ga0207647_10000475
557 Ga0207645_10018208
558 Ga0207645_10047878
559 Ga0207645_10163080
560 Ga0207645_10266510
561 Ga0207705_10001025
562 Ga0207705_10088539
563 Ga0207705_10158709
564 Ga0207705_10901853
565 Ga0207654_10078590
566 Ga0207707_10228411
567 Ga0207707_10249031
568 Ga0207695_11054926
569 Ga0207660_10409411
570 Ga0207660_10438555
571 Ga0207660_11165885
572 Ga0207662_10406403
573 Ga0207657_10018329
574 Ga0207657_10029976
575 Ga0207657_10034186
576 Ga0207657_10172458
577 Ga0207657_10190421
578 Ga0207657_10198183
579 Ga0207649_10011076
580 Ga0207649_10207899
581 Ga0207649_10729313
582 Ga0207652_10123689
583 Ga0207652_10187429
584 Ga0207652_10435988
585 Ga0207681_10046482
586 Ga0207681_10175641
587 Ga0207681_10185719
588 Ga0207650_10005560
589 Ga0207650_10080870
590 Ga0207659_10196108
591 Ga0207659_10224878
592 Ga0207659_10933517
593 Ga0207687_10017502
594 Ga0207644_10017317
595 Ga0207690_10019315
596 Ga0207690_10057989
597 Ga0207690_10252842
598 Ga0207706_10001597
599 Ga0207706_10009923
600 Ga0207706_10044846
601 Ga0207686_10135287
602 Ga0207670_10010216
603 Ga0207669_10055086
604 Ga0207704_10024575
605 Ga0207691_10001819
606 Ga0207691_10310890
607 Ga0207711_10005149
608 Ga0207711_10005690
609 Ga0207689_10000849
610 Ga0207661_10979347
611 Ga0207679_10014348
612 Ga0207679_10129473
613 Ga0207679_10166540
614 Ga0207679_10417572
615 Ga0207679_11289873
616 Ga0207667_10265407
617 Ga0207651_10004002
618 Ga0207651_10437015
619 Ga0207640_10001701
620 Ga0207640_10279171
621 Ga0207658_10017714
622 Ga0207658_10147206
623 Ga0207677_10001108
624 Ga0207703_10017153
625 Ga0207703_10409040
626 Ga0207639_10026318
627 Ga0207639_10030051
628 Ga0207639_10984155
629 Ga0207678_10026944
630 Ga0207678_10470783
631 Ga0207678_10635088
632 Ga0207641_10009130
633 Ga0207641_10031302
634 Ga0207648_10000950
635 Ga0207648_10183277
636 Ga0207676_10028442
637 Ga0207676_11239797
638 Ga0207674_10036382
639 Ga0207674_10038910
640 Ga0207674_10594972
641 Ga0207675_100071005
642 Ga0207698_10001868
643 Ga0209974_10022660
644 Ga0268266_10602077
645 Ga0268265_10029960
646 Ga0268264_10009893
647 Ga0268264_10124800
648 Ga0307513_10177281
649 Ga0307513_10287389
650 Ga0307408_100034966
651 Ga0307408_100037073
652 Ga0307408_100149959
653 Ga0307408_100164875
654 Ga0307408_100372629
655 Ga0307408_101918625
656 Ga0307405_10005451
657 Ga0307405_10129354
658 Ga0307405_10182720
659 Ga0307405_10219169
660 Ga0307405_10593931
661 Ga0307413_10004263
662 Ga0307413_10007127
663 Ga0307413_10015110
664 Ga0307413_10151304
665 Ga0307413_10184991
666 Ga0307413_10296324
667 Ga0307413_10633752
668 Ga0307413_10710388
669 Ga0307413_11045154
670 Ga0307410_10001333
671 Ga0307410_10011651
672 Ga0307410_10019223
673 Ga0307410_10023184
674 Ga0307410_10033110
675 Ga0307410_10071240
676 Ga0307410_10108198
677 Ga0307410_10433766
678 Ga0307410_10637035
679 Ga0307406_10021371
680 Ga0307406_10233336
681 Ga0307406_10420072
682 Ga0307406_10557820
683 Ga0307406_11046302
684 Ga0307407_10006716
685 Ga0307407_10021846
686 Ga0307407_10142898
687 Ga0307407_10342976
688 Ga0307407_10374781
689 Ga0307407_10766961
690 Ga0307412_10006725
691 Ga0307412_10015344
692 Ga0307412_10022597
693 Ga0307412_10059131
694 Ga0307412_10117863
695 Ga0307412_10290083
696 Ga0307412_10464076
697 Ga0307412_10500890
698 Ga0307412_11619880
699 Ga0307409_100008382
700 Ga0307409_100016659
701 Ga0307409_100017667
702 Ga0307409_100023088
703 Ga0307409_100116962
704 Ga0307409_100148315
705 Ga0307409_100229867
706 Ga0307409_100619955
707 Ga0307409_100708465
708 Ga0307409_100897759
709 Ga0307409_101596914
710 Ga0307409_101715451
711 Ga0307409_101938434
712 Ga0307416_100002387
713 Ga0307416_100033054
714 Ga0307416_100091939
715 Ga0307416_100097592
716 Ga0307416_100101378
717 Ga0307416_100102885
718 Ga0307416_100315316
719 Ga0307416_100397566
720 Ga0307416_100530556
721 Ga0307416_102005087
722 Ga0307414_10043030
723 Ga0307414_10067809
724 Ga0307414_10075767
725 Ga0307414_10108220
726 Ga0307414_10215861
727 Ga0307414_10246142
728 Ga0307414_10572018
729 Ga0307414_11542904
730 Ga0307411_10003609
731 Ga0307411_10011827
732 Ga0307411_10015292
733 Ga0307411_10031620
734 Ga0307411_10050508
735 Ga0307411_10200130
736 Ga0307411_10251631
737 Ga0307411_10702022
738 Ga0307415_100005979
739 Ga0307415_100033396
740 Ga0307415_100087769
741 Ga0307415_100133654
742 Ga0307415_100649563
743 Ga0307415_100879148
744 Ga0307510_10027330
745 Ga0395899_0177953
746 Ga0395900_0281769
747 Ga0395900_0307236
748 Ga0395898_1080461
749 Ga0395905_1107010
750 Ga0395901_0235708
751 Ga0395901_0531881
752 Ga0395901_1270460
753 Ga0439465_0044375
754 Ga0439445_0034267
755 Ga0439432_058706
756 Ga0439449_0016730
757 Ga0439449_0237208
758 Ga0450920_023993
759 Ga0439464_0002322
760 Ga0466965_0361390
761 Ga0466963_0024836
762 Ga0466964_0085911
763 Ga0466957_0000132
764 Ga0466960_0314335
765 Ga0466967_0046479
766 Ga0466967_1588973
767 Ga0495617_010807
768 Ga0495650_0001001
769 Ga0495594_0311869
770 Ga0495583_0000879
771 Ga0495598_0096488
772 Ga0495597_0270443
773 Ga0495633_0027026
774 Ga0495611_0151556
775 Ga0495623_0011435
776 Ga0495613_0056027
777 Ga0495677_0003366
778 Ga0496100_1266377
779 Ga0496103_0177381
780 Ga0496112_1404643
781 Ga0501047_0185474
782 Ga0501047_0423139
783 Ga0501067_0078488
784 Ga0501198_066908
785 Ga0501233_175041
786 Ga0501253_089927
787 Ga0501268_180986
788 Ga0501273_005194
789 Ga0501035_0349720
790 Ga0501044_0652589
791 Ga0500607_177986
792 Ga0500585_073216
793 Ga0500622_0177546
794 Ga0500596_000172
795 Ga0500661_006113
796 Ga0590075_088469

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01741

MscL

Large-conductance mechanosensitive channel, MscL

34

170

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hzq-assembly1.cif.gz_A structure of a tetrameric mscl in an expanded intermediate state 0.6368 11 114
3hzq-assembly1.cif.gz_A structure of a tetrameric mscl in an expanded intermediate state 0.5642 11 114
6ctd-assembly2.cif.gz_H c-terminal domain truncation of the mycobacterium tuberculosis mechanosensitive channel of large conductance mscl 0.5069 3 107
6ctd-assembly1.cif.gz_C c-terminal domain truncation of the mycobacterium tuberculosis mechanosensitive channel of large conductance mscl 0.5011 4 107
6ctd-assembly2.cif.gz_H c-terminal domain truncation of the mycobacterium tuberculosis mechanosensitive channel of large conductance mscl 0.4757 3 107
ID Description Score Start End Superfamily
3hzqA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.6368 11 114 1.10.1200.120
af_P68805_1_94_1.10.1200.120 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.5878 1 116 1.10.1200.120
af_P68805_1_94_1.10.1200.120 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.5777 1 116 1.10.1200.120
3hzqA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.5642 11 114 1.10.1200.120
2oarA01 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.4736 1 111 1.10.1200.120
ID Description Score Start End GO Terms
AF-A0A2V6KIB6-F1-model_v4 Large conductance mechanosensitive channel protein MscL 0.8436 20 121 GO:0005886
GO:0008381
AF-A0A1G1INJ4-F1-model_v4 Mechanosensitive ion channel protein MscL 0.8319 29 121 GO:0008381
GO:0016020
AF-A0A5C7ZBQ9-F1-model_v4 Large conductance mechanosensitive channel protein MscL 0.7632 2 102 GO:0005886
GO:0008381
AF-A0A1Y1YNH5-F1-model_v4 MscL-domain-containing protein 0.7616 1 113 GO:0005886
GO:0008381
AF-A0A2V9LH26-F1-model_v4 Large conductance mechanosensitive channel protein MscL 0.7606 12 113 GO:0005886
GO:0008381

Map