F434147

General Info

Members Datasets Scaffolds Average Seq Length
398 283 796 195

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0005323|Ga0495686_0005323_3866_4483
Length 205
Sequence LIHHEKESNMSNTEFIDTIFRNARSQNGWREQPVSDERLKEVYDLMKWGPTSVNCSPARVVFVRSEEGKSKLKSALAPGNVDKSMAAPVVAIVAYDTEFYEKLPQLFPHNPAVKDWFDGEAKAAFAEKTAFRNGTLQGAYLIIAARAAGLDCGPMSGFDNAKLDEAFFAGTSWKSNFICALGHGDPTKVHPRSPRLSFEEACKLA

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
122 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
138 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
139 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
142 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
146 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
199 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
211 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
214 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
215 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
216 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
217 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
218 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
219 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
220 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
221 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
222 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
225 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
226 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
227 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
228 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
233 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
234 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
235 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
236 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
237 2643221582 Rhizobium sp. Root651 Isolate Unclassified
238 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
239 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
240 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
241 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
242 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
243 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
244 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
245 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
246 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
247 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
248 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
249 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
250 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
251 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
252 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
253 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
254 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
255 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
256 2847085930 Erwinia persicina B64 Isolate Bulb
257 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
258 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
259 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
260 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
261 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
262 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
263 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
264 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
265 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
266 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
267 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
268 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
269 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
270 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
271 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
272 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
273 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
274 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
275 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
276 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
277 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
278 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
279 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
280 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
281 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
282 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
283 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.93
Metatranscriptomes 0
Isolates 13.07

Biome Distribution

Category Percentage (%)
Aerial Root 1.01
Bulb 0.25
Endosphere 10.05
Nodule 7.04
Rhizoplane 1.01
Rhizosphere 69.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0005323 3300047472 Bacteria 10194
2 JGI24737J22298_10096132 3300001990 Bacteria 878
3 JGI24735J21928_10009445 3300002067 Bacteria 3131
4 JGI24735J21928_10012493 3300002067 Bacteria 2684
5 JGI25165J46597_1000124 3300003214 Bacteria 131341
6 Ga0058692_1004974 3300003856 Bacteria 3856
7 Ga0058692_1005282 3300003856 Bacteria 3707
8 Ga0070658_10003660 3300005327 Bacteria 12586
9 Ga0070658_10017856 3300005327 Bacteria 5673
10 Ga0070658_10085059 3300005327 Bacteria 2601
11 Ga0070683_100020697 3300005329 Bacteria 5858
12 Ga0070683_100874138 3300005329 Bacteria 862
13 Ga0070666_10154602 3300005335 Bacteria 1601
14 Ga0070680_100112990 3300005336 Bacteria 2262
15 Ga0068868_100344510 3300005338 Bacteria 1275
16 Ga0070660_100026706 3300005339 Bacteria 4302
17 Ga0070660_100108860 3300005339 Bacteria 2203
18 Ga0070661_100003945 3300005344 Bacteria 10202
19 Ga0070661_100149296 3300005344 Bacteria 1766
20 Ga0070692_10443332 3300005345 Bacteria 829
21 Ga0070674_100057228 3300005356 Bacteria 2706
22 Ga0070659_100004570 3300005366 Bacteria 9895
23 Ga0070667_100013267 3300005367 Bacteria 6807
24 Ga0070709_10136619 3300005434 Bacteria 1680
25 Ga0070709_10286816 3300005434 Bacteria 1198
26 Ga0070714_100002566 3300005435 Bacteria 13379
27 Ga0070714_100010877 3300005435 Bacteria 7207
28 Ga0070713_100000011 3300005436 Bacteria 146314
29 Ga0070705_100059523 3300005440 Bacteria 2262
30 Ga0070663_100002845 3300005455 Bacteria 9837
31 Ga0070663_100038186 3300005455 Bacteria 3348
32 Ga0070663_100513312 3300005455 Bacteria 997
33 Ga0070678_100185751 3300005456 Bacteria 1705
34 Ga0070662_100003998 3300005457 Bacteria 9244
35 Ga0070662_100994815 3300005457 Bacteria 718
36 Ga0070681_10010730 3300005458 Bacteria 9052
37 Ga0068867_100233455 3300005459 Bacteria 1488
38 Ga0070699_100756591 3300005518 Bacteria 889
39 Ga0070679_100063255 3300005530 Bacteria 3689
40 Ga0070684_100158709 3300005535 Bacteria 2051
41 Ga0070697_100161010 3300005536 Bacteria 1896
42 Ga0068853_100002089 3300005539 Bacteria 14817
43 Ga0068853_100009051 3300005539 Bacteria 8017
44 Ga0070672_100033184 3300005543 Bacteria 3907
45 Ga0070695_100054578 3300005545 Bacteria 2572
46 Ga0070665_100001308 3300005548 Bacteria 29745
47 Ga0068855_100004053 3300005563 Bacteria 17877
48 Ga0068855_100020022 3300005563 Bacteria 8034
49 Ga0068855_100114813 3300005563 Bacteria 3087
50 Ga0068855_100125801 3300005563 Bacteria 2931
51 Ga0070664_100001119 3300005564 Bacteria 21198
52 Ga0068857_100000131 3300005577 Bacteria 45365
53 Ga0068857_100002260 3300005577 Bacteria 15661
54 Ga0068854_100411748 3300005578 Bacteria 1121
55 Ga0068856_100001764 3300005614 Bacteria 22636
56 Ga0068856_100021277 3300005614 Bacteria 6301
57 Ga0068856_100050192 3300005614 Bacteria 4112
58 Ga0068852_100002634 3300005616 Bacteria 12393
59 Ga0068851_10370477 3300005834 Bacteria 837
60 Ga0068863_100160920 3300005841 Bacteria 2151
61 Ga0068863_101383041 3300005841 Bacteria 711
62 Ga0068858_100128744 3300005842 Bacteria 2373
63 Ga0068860_100503472 3300005843 Bacteria 1209
64 Ga0075364_10012341 3300006051 Bacteria 5222
65 Ga0070712_100000014 3300006175 Bacteria 108668
66 Ga0075366_10060881 3300006195 Bacteria 2243
67 Ga0097621_100899179 3300006237 Bacteria 825
68 Ga0075370_10039894 3300006353 Bacteria 2647
69 Ga0075370_10050701 3300006353 Bacteria 2354
70 Ga0075436_100000047 3300006914 Bacteria 72907
71 Ga0075435_100357168 3300007076 Bacteria 1253
72 Ga0105244_10009582 3300009036 Bacteria 5938
73 Ga0105244_10027197 3300009036 Bacteria 3085
74 Ga0105250_10005696 3300009092 Bacteria 5561
75 Ga0105240_10000353 3300009093 Bacteria 86068
76 Ga0105240_10000355 3300009093 Bacteria 86025
77 Ga0105240_10000838 3300009093 Bacteria 55365
78 Ga0105240_10006563 3300009093 Bacteria 17085
79 Ga0105240_10043035 3300009093 Bacteria 5750
80 Ga0105241_10006494 3300009174 Bacteria 8621
81 Ga0105248_10322611 3300009177 Bacteria 1739
82 Ga0105237_10006560 3300009545 Bacteria 12870
83 Ga0105237_10095666 3300009545 Bacteria 2960
84 Ga0105238_10001566 3300009551 Bacteria 22947
85 Ga0105238_10001828 3300009551 Bacteria 21327
86 Ga0105239_10004849 3300010375 Bacteria 15916
87 Ga0105239_10042265 3300010375 Bacteria 4995
88 Ga0105239_10723685 3300010375 Bacteria 1138
89 Ga0157373_10003426 3300013100 Bacteria 12004
90 Ga0157370_10000080 3300013104 Bacteria 105872
91 Ga0157370_10005949 3300013104 Bacteria 13583
92 Ga0157370_10006365 3300013104 Bacteria 13033
93 Ga0157369_10014179 3300013105 Bacteria 9005
94 Ga0157369_10014583 3300013105 Bacteria 8867
95 Ga0157369_10017627 3300013105 Bacteria 8027
96 Ga0157369_10947497 3300013105 Bacteria 882
97 Ga0157374_10193933 3300013296 Bacteria 1987
98 Ga0157374_10408964 3300013296 Bacteria 1354
99 Ga0157378_10418225 3300013297 Bacteria 1324
100 Ga0157372_10007021 3300013307 Bacteria 11994
101 Ga0157372_10018126 3300013307 Bacteria 7568
102 Ga0157372_10023649 3300013307 Bacteria 6665
103 Ga0157375_10199938 3300013308 Bacteria 2154
104 Ga0157375_11330502 3300013308 Bacteria 845
105 Ga0163163_10051142 3300014325 Bacteria 4073
106 Ga0157379_10010103 3300014968 Bacteria 8227
107 Ga0157376_10392879 3300014969 Bacteria 1339
108 Ga0213874_10182361 3300021377 Bacteria 747
109 Ga0207427_101436 3300025231 Bacteria 8618
110 Ga0209026_1001068 3300025250 Bacteria 13281
111 Ga0209148_1001541 3300025254 Bacteria 11199
112 Ga0209233_1000189 3300025261 Bacteria 131465
113 Ga0209455_1000971 3300025272 Bacteria 14523
114 Ga0209025_1000255 3300025294 Bacteria 125764
115 Ga0207656_10270553 3300025321 Bacteria 836
116 Ga0207696_1007868 3300025711 Bacteria 4133
117 Ga0207655_1051535 3300025728 Bacteria 1663
118 Ga0207680_10083486 3300025903 Bacteria 2013
119 Ga0207647_10047644 3300025904 Bacteria 2665
120 Ga0207647_10067539 3300025904 Bacteria 2166
121 Ga0207699_10000233 3300025906 Bacteria 31418
122 Ga0207699_10240292 3300025906 Bacteria 1244
123 Ga0207705_10000014 3300025909 Bacteria 434286
124 Ga0207705_10003669 3300025909 Bacteria 11682
125 Ga0207705_10071427 3300025909 Bacteria 2516
126 Ga0207654_10083298 3300025911 Bacteria 1931
127 Ga0207707_10024797 3300025912 Bacteria 5247
128 Ga0207695_10001073 3300025913 Bacteria 47807
129 Ga0207695_10001110 3300025913 Bacteria 46818
130 Ga0207695_10022114 3300025913 Bacteria 7232
131 Ga0207695_10078038 3300025913 Bacteria 3361
132 Ga0207695_10116140 3300025913 Bacteria 2650
133 Ga0207671_10128061 3300025914 Bacteria 1947
134 Ga0207671_10160603 3300025914 Bacteria 1740
135 Ga0207693_10000018 3300025915 Bacteria 138365
136 Ga0207660_10059984 3300025917 Bacteria 2733
137 Ga0207657_10000630 3300025919 Bacteria 37349
138 Ga0207657_10023764 3300025919 Bacteria 5700
139 Ga0207657_10044173 3300025919 Bacteria 3919
140 Ga0207649_10003570 3300025920 Bacteria 8500
141 Ga0207652_10025491 3300025921 Bacteria 4918
142 Ga0207646_10795226 3300025922 Bacteria 843
143 Ga0207694_10001560 3300025924 Bacteria 19448
144 Ga0207694_10027946 3300025924 Bacteria 4299
145 Ga0207694_10046784 3300025924 Bacteria 3345
146 Ga0207700_10000005 3300025928 Bacteria 394836
147 Ga0207700_10042284 3300025928 Bacteria 3340
148 Ga0207664_10016923 3300025929 Bacteria 5332
149 Ga0207664_10122190 3300025929 Bacteria 2181
150 Ga0207664_10319909 3300025929 Bacteria 1369
151 Ga0207690_10009473 3300025932 Bacteria 5784
152 Ga0207690_10087860 3300025932 Bacteria 2188
153 Ga0207706_10028563 3300025933 Bacteria 4981
154 Ga0207669_10033448 3300025937 Bacteria 2902
155 Ga0207691_10040952 3300025940 Bacteria 4279
156 Ga0207661_10039548 3300025944 Bacteria 3702
157 Ga0207679_10006603 3300025945 Bacteria 7336
158 Ga0207667_10008594 3300025949 Bacteria 12119
159 Ga0207667_10023649 3300025949 Bacteria 6763
160 Ga0207667_10060708 3300025949 Bacteria 3957
161 Ga0207667_10110605 3300025949 Bacteria 2834
162 Ga0207640_10150016 3300025981 Bacteria 1711
163 Ga0207658_10098949 3300025986 Bacteria 2280
164 Ga0207677_10500190 3300026023 Bacteria 1051
165 Ga0207639_10007140 3300026041 Bacteria 7609
166 Ga0207639_10021357 3300026041 Bacteria 4649
167 Ga0207678_10001721 3300026067 Bacteria 20039
168 Ga0207678_10054504 3300026067 Bacteria 3444
169 Ga0207678_10380719 3300026067 Bacteria 1220
170 Ga0207702_10000680 3300026078 Bacteria 36910
171 Ga0207702_10001063 3300026078 Bacteria 28134
172 Ga0207702_10009734 3300026078 Bacteria 8071
173 Ga0207702_10009967 3300026078 Bacteria 7966
174 Ga0207641_10165228 3300026088 Bacteria 2015
175 Ga0207648_10022805 3300026089 Bacteria 5617
176 Ga0207674_10000112 3300026116 Bacteria 94220
177 Ga0207674_10001449 3300026116 Bacteria 30652
178 Ga0207683_10134271 3300026121 Bacteria 2227
179 Ga0207698_10019977 3300026142 Bacteria 4600
180 Ga0209371_1002941 3300027312 Bacteria 8883
181 Ga0209371_1003350 3300027312 Bacteria 7871
182 Ga0209998_10011461 3300027717 Bacteria 1835
183 Ga0209974_10017028 3300027876 Bacteria 2411
184 Ga0268266_10724064 3300028379 Bacteria 959
185 Ga0268264_10451817 3300028381 Bacteria 1245
186 Ga0307515_10109202 3300028794 Bacteria 3251
187 Ga0265338_10003597 3300028800 Bacteria 21634
188 Ga0265338_10253910 3300028800 Bacteria 1296
189 Ga0268256_1002891 3300030500 Bacteria 8238
190 Ga0268256_1017420 3300030500 Bacteria 2022
191 Ga0268256_1019969 3300030500 Bacteria 1819
192 Ga0268256_1057323 3300030500 Bacteria 794
193 Ga0316181_1065167 3300030744 Bacteria 2065
194 Ga0265325_10086611 3300031241 Bacteria 1550
195 Ga0265331_10053864 3300031250 Bacteria 1917
196 Ga0265327_10094284 3300031251 Bacteria 1455
197 Ga0307513_10010987 3300031456 Bacteria 11297
198 Ga0307513_10016486 3300031456 Bacteria 8906
199 Ga0307513_10195431 3300031456 Bacteria 1870
200 Ga0265313_10037970 3300031595 Bacteria 2403
201 Ga0265314_10064744 3300031711 Bacteria 2473
202 Ga0265314_10176973 3300031711 Bacteria 1282
203 Ga0307412_10529097 3300031911 Bacteria 986
204 Ga0373939_0036332 3300035114 Bacteria 1457
205 Ga0373927_0345266 3300035695 Bacteria 981
206 Ga0395899_0001244 3300037312 Bacteria 22134
207 Ga0395900_0140199 3300037418 Bacteria 2476
208 Ga0395900_0158879 3300037418 Bacteria 2307
209 Ga0395900_0690275 3300037418 Bacteria 955
210 Ga0395905_0466308 3300037471 Bacteria 1162
211 Ga0395905_0617057 3300037471 Bacteria 986
212 Ga0400483_161840 3300039062 Bacteria 3358
213 Ga0436363_1512733 3300039450 Bacteria 771
214 Ga0439438_004107 3300041405 Bacteria 5685
215 Ga0439447_006056 3300041407 Bacteria 3966
216 Ga0451851_1360998 3300041507 Bacteria 1022
217 Ga0439448_0003958 3300042005 Bacteria 4158
218 Ga0439448_0006212 3300042005 Bacteria 3428
219 Ga0439452_002044 3300042010 Bacteria 7681
220 Ga0439455_0017464 3300042012 Bacteria 1672
221 Ga0451577_0551069 3300042876 Bacteria 1047
222 Ga0451576_0672177 3300045051 Bacteria 1088
223 Ga0495590_0148477 3300046457 Bacteria 849
224 Ga0495591_001159 3300046458 Bacteria 17260
225 Ga0495651_0043401 3300046462 Bacteria 3489
226 Ga0495650_0000032 3300046471 Bacteria 425389
227 Ga0495650_0020093 3300046471 Bacteria 3266
228 Ga0495580_0052032 3300046472 Bacteria 2894
229 Ga0495605_0056275 3300046474 Bacteria 1897
230 Ga0495584_0006356 3300046491 Bacteria 6189
231 Ga0495607_0044030 3300046501 Bacteria 2634
232 Ga0495606_0000483 3300046507 Bacteria 65224
233 Ga0495606_0264078 3300046507 Bacteria 949
234 Ga0495610_0010684 3300046512 Bacteria 5683
235 Ga0495610_0048247 3300046512 Bacteria 2091
236 Ga0495616_0021460 3300046513 Bacteria 3498
237 Ga0495628_0515012 3300046516 Bacteria 862
238 Ga0495643_0023425 3300046522 Bacteria 3511
239 Ga0495644_0009273 3300046523 Bacteria 3792
240 Ga0495642_0102971 3300046528 Bacteria 1216
241 Ga0495654_0000052 3300046530 Bacteria 145382
242 Ga0495654_0110821 3300046530 Bacteria 1252
243 Ga0495587_0087998 3300046536 Bacteria 1797
244 Ga0495609_0018155 3300046538 Bacteria 3262
245 Ga0495597_0000352 3300046542 Bacteria 41199
246 Ga0495622_0007281 3300046557 Bacteria 5137
247 Ga0495668_0015415 3300046616 Bacteria 4464
248 Ga0495611_0233503 3300046648 Bacteria 854
249 Ga0495625_0137871 3300046660 Bacteria 1648
250 Ga0495625_0154917 3300046660 Bacteria 1538
251 Ga0495599_0002656 3300046678 Bacteria 10426
252 Ga0495623_0002133 3300046679 Bacteria 13213
253 Ga0495623_0211815 3300046679 Bacteria 1109
254 Ga0495658_0003755 3300046683 Bacteria 7515
255 Ga0495671_0008541 3300046692 Bacteria 5755
256 Ga0495649_0033619 3300046694 Bacteria 2822
257 Ga0495589_0116561 3300046794 Bacteria 1287
258 Ga0495660_0000021 3300046810 Bacteria 293250
259 Ga0495660_0037100 3300046810 Bacteria 2716
260 Ga0495604_0003722 3300047317 Bacteria 12154
261 Ga0495674_0054773 3300047319 Bacteria 3500
262 Ga0495674_0330087 3300047319 Bacteria 1241
263 Ga0495672_0000002 3300047320 Bacteria 740116
264 Ga0495672_0003774 3300047320 Bacteria 12768
265 Ga0495676_0173649 3300047321 Bacteria 1515
266 Ga0495680_0010183 3300047322 Bacteria 8400
267 Ga0495683_0068165 3300047323 Bacteria 1750
268 Ga0495683_0207924 3300047323 Bacteria 879
269 Ga0495687_000017 3300047443 Bacteria 350429
270 Ga0495675_0006613 3300047444 Bacteria 7097
271 Ga0495675_0175806 3300047444 Bacteria 1313
272 Ga0495679_000020 3300047446 Bacteria 228413
273 Ga0495673_0000095 3300047469 Bacteria 183429
274 Ga0495681_0000688 3300047470 Bacteria 25777
275 Ga0495681_0025691 3300047470 Bacteria 3077
276 Ga0495602_0023892 3300048088 Bacteria 5943
277 Ga0495602_0026620 3300048088 Bacteria 5575
278 Ga0496108_0972609 3300048911 Bacteria 726
279 Ga0496116_0013166 3300048919 Bacteria 6692
280 Ga0496116_0097637 3300048919 Bacteria 1765
281 Ga0496117_0028588 3300048920 Bacteria 4315
282 Ga0496118_0109923 3300048921 Bacteria 1833
283 Ga0496119_0000080 3300048922 Bacteria 139962
284 Ga0496119_0010211 3300048922 Bacteria 7923
285 Ga0496119_0036997 3300048922 Bacteria 3177
286 Ga0496119_0101303 3300048922 Bacteria 1617
287 Ga0496120_0000075 3300048923 Bacteria 163540
288 Ga0496120_0003436 3300048923 Bacteria 14444
289 Ga0496120_0033835 3300048923 Bacteria 3067
290 Ga0496120_0140271 3300048923 Bacteria 1228
291 Ga0496121_0000143 3300048924 Bacteria 159577
292 Ga0496121_0000710 3300048924 Bacteria 61765
293 Ga0496121_0244110 3300048924 Bacteria 1249
294 Ga0496122_0096628 3300048925 Bacteria 1991
295 Ga0496124_0000397 3300048927 Bacteria 79293
296 Ga0496124_0056079 3300048927 Bacteria 3325
297 Ga0496124_0125294 3300048927 Bacteria 2047
298 Ga0496124_0312865 3300048927 Bacteria 1128
299 Ga0496124_0346986 3300048927 Bacteria 1051
300 Ga0496124_0357019 3300048927 Bacteria 1031
301 Ga0496125_0004938 3300048928 Bacteria 15090
302 Ga0496125_0013012 3300048928 Bacteria 8213
303 Ga0496126_0140114 3300048929 Bacteria 2083
304 Ga0496126_0241314 3300048929 Bacteria 1509
305 Ga0495678_000326 3300049459 Bacteria 50497
306 Ga0495682_0000015 3300049460 Bacteria 235048
307 Ga0501069_0145601 3300049585 Bacteria 1360
308 Ga0501070_0040580 3300049586 Bacteria 3881
309 Ga0501073_0699739 3300049589 Bacteria 699
310 Ga0501080_0535627 3300049742 Bacteria 1044
311 Ga0501083_0012716 3300049744 Bacteria 5888
312 nmdc:mga00v17_10053_c1 3300050491 Bacteria 5152
313 nmdc:mga00v17_1012_c1 3300050491 Bacteria 15037
314 nmdc:mga00v17_526802_c1 3300050491 Bacteria 765
315 nmdc:mga0k408_219757_c1 3300050493 Bacteria 1134
316 nmdc:mga0rr50_95294_c1 3300050513 Bacteria 2326
317 nmdc:mga08x19_11335_c1 3300050514 Bacteria 5365
318 nmdc:mga08x19_62_c1 3300050514 Bacteria 114601
319 nmdc:mga0sz30_23852_c1 3300050516 Bacteria 2493
320 Ga0500635_0178239 3300053080 Bacteria 820
321 Ga0500578_0014194 3300053086 Bacteria 5124
322 Ga0500643_033177 3300053087 Bacteria 1562
323 Ga0500641_0001936 3300053096 Bacteria 7343
324 Ga0500556_0030618 3300053104 Bacteria 1824
325 Ga0500560_001783 3300053107 Bacteria 3876
326 Ga0500560_060194 3300053107 Bacteria 1236
327 Ga0500562_006671 3300053108 Bacteria 2909
328 Ga0500569_043175 3300053109 Bacteria 1330
329 Ga0500572_003354 3300053111 Bacteria 3679
330 Ga0500621_000001 3300053126 Bacteria 1049698
331 Ga0500573_0002805 3300053140 Bacteria 8833
332 Ga0500573_0009196 3300053140 Bacteria 5473
333 Ga0500577_0027899 3300053142 Bacteria 1939
334 Ga0500604_0020511 3300053151 Bacteria 1861
335 Ga0500616_0004694 3300053153 Bacteria 9622
336 Ga0500616_0006278 3300053153 Bacteria 7818
337 Ga0500616_0012283 3300053153 Bacteria 5014
338 Ga0500622_0226914 3300053156 Bacteria 834
339 Ga0500634_0070795 3300053161 Bacteria 1825
340 Ga0500639_095619 3300053163 Bacteria 1472
341 Ga0500636_0000009 3300053177 Bacteria 155504
342 Ga0500636_0000962 3300053177 Bacteria 15499
343 Ga0500637_0007241 3300053178 Bacteria 5535
344 Ga0500645_001141 3300053730 Bacteria 14389
345 Ga0501084_0131592 3300054114 Bacteria 2106
346 Ga0501082_0045233 3300060353 Bacteria 3796
347 2514053890 2513237166 Bacteria 10373764
348 2537877146 2537561587 Bacteria 5425293
349 2599602050 2599185210 Bacteria 5624189
350 2601609699 2600255279 Bacteria 5605316
351 2601746474 2600255308 Bacteria 5611129
352 2643919955 2643221582 Bacteria 5804683
353 2791925039 2791354903 Bacteria 4937680
354 2819559444 2818991439 Bacteria 6907412
355 2838675379 2838675328 Bacteria 4909118
356 2838714260 2838714209 Bacteria 5525906
357 2838721938 2838719591 Bacteria 5523910
358 2838725021 2838724970 Bacteria 4908691
359 2841848917 2841846520 Bacteria 5345850
360 2841862586 2841859092 Bacteria 5436171
361 2842125052 2842124991 Bacteria 5346824
362 2842130274 2842130223 Bacteria 4909145
363 2842154556 2842152218 Bacteria 4908957
364 2842170503 2842170452 Bacteria 5525737
365 2842178176 2842175837 Bacteria 4908771
366 2842187369 2842187318 Bacteria 5524014
367 2842211680 2842211629 Bacteria 5523832
368 2842226700 2842224351 Bacteria 5524473
369 2842519370 2842515876 Bacteria 5436280
370 2842779154 2842775625 Bacteria 5587290
371 2847088176 2847085930 Bacteria 5070450
372 2856318181 2856314179 Bacteria 6477897
373 2876384104 2876377896 Bacteria 6565995
374 2885278823 2885270888 Bacteria 9831543
375 2889013330 2889010040 Bacteria 6749192
376 2899795731 2899792073 Bacteria 4926588
377 2906360587 2906354277 Bacteria 6991324
378 2906418218 2906414383 Bacteria 6580790
379 2919114291 2919114240 Bacteria 5700270
380 2922188900 2922185730 Bacteria 7113964
381 2926755311 2926754445 Bacteria 5964435
382 2929141619 2929138655 Bacteria 5810547
383 2933009201 2933006813 Bacteria 4912075
384 2933014459 2933011516 Bacteria 5439334
385 2933596209 2933594066 Bacteria 5594265
386 2938021314 2938014810 Bacteria 6700592
387 2961175834 2961170736 Bacteria 7072258
388 2970508499 2970503327 Bacteria 7099517
389 2979104295 2979100975 Bacteria 5423623
390 2979811852 2979808191 Bacteria 7179355
391 2984511125 2984509177 Bacteria 5274802
392 2984522513 2984518228 Bacteria 5277463
393 2984541817 2984537506 Bacteria 5277481
394 2984604172 2984601300 Bacteria 5455244
395 651177568 651053060 Bacteria 4689946
396 8033234545 8033232454 Bacteria 3202805
397 8054464891 8054460903 Bacteria 4872905
398 8054844771 8054844752 Bacteria 4450330
399 Ga0495686_0005323
400 JGI24737J22298_10096132
401 JGI24735J21928_10009445
402 JGI24735J21928_10012493
403 JGI25165J46597_1000124
404 Ga0058692_1004974
405 Ga0058692_1005282
406 Ga0070658_10003660
407 Ga0070658_10017856
408 Ga0070658_10085059
409 Ga0070683_100020697
410 Ga0070683_100874138
411 Ga0070666_10154602
412 Ga0070680_100112990
413 Ga0068868_100344510
414 Ga0070660_100026706
415 Ga0070660_100108860
416 Ga0070661_100003945
417 Ga0070661_100149296
418 Ga0070692_10443332
419 Ga0070674_100057228
420 Ga0070659_100004570
421 Ga0070667_100013267
422 Ga0070709_10136619
423 Ga0070709_10286816
424 Ga0070714_100002566
425 Ga0070714_100010877
426 Ga0070713_100000011
427 Ga0070705_100059523
428 Ga0070663_100002845
429 Ga0070663_100038186
430 Ga0070663_100513312
431 Ga0070678_100185751
432 Ga0070662_100003998
433 Ga0070662_100994815
434 Ga0070681_10010730
435 Ga0068867_100233455
436 Ga0070699_100756591
437 Ga0070679_100063255
438 Ga0070684_100158709
439 Ga0070697_100161010
440 Ga0068853_100002089
441 Ga0068853_100009051
442 Ga0070672_100033184
443 Ga0070695_100054578
444 Ga0070665_100001308
445 Ga0068855_100004053
446 Ga0068855_100020022
447 Ga0068855_100114813
448 Ga0068855_100125801
449 Ga0070664_100001119
450 Ga0068857_100000131
451 Ga0068857_100002260
452 Ga0068854_100411748
453 Ga0068856_100001764
454 Ga0068856_100021277
455 Ga0068856_100050192
456 Ga0068852_100002634
457 Ga0068851_10370477
458 Ga0068863_100160920
459 Ga0068863_101383041
460 Ga0068858_100128744
461 Ga0068860_100503472
462 Ga0075364_10012341
463 Ga0070712_100000014
464 Ga0075366_10060881
465 Ga0097621_100899179
466 Ga0075370_10039894
467 Ga0075370_10050701
468 Ga0075436_100000047
469 Ga0075435_100357168
470 Ga0105244_10009582
471 Ga0105244_10027197
472 Ga0105250_10005696
473 Ga0105240_10000353
474 Ga0105240_10000355
475 Ga0105240_10000838
476 Ga0105240_10006563
477 Ga0105240_10043035
478 Ga0105241_10006494
479 Ga0105248_10322611
480 Ga0105237_10006560
481 Ga0105237_10095666
482 Ga0105238_10001566
483 Ga0105238_10001828
484 Ga0105239_10004849
485 Ga0105239_10042265
486 Ga0105239_10723685
487 Ga0157373_10003426
488 Ga0157370_10000080
489 Ga0157370_10005949
490 Ga0157370_10006365
491 Ga0157369_10014179
492 Ga0157369_10014583
493 Ga0157369_10017627
494 Ga0157369_10947497
495 Ga0157374_10193933
496 Ga0157374_10408964
497 Ga0157378_10418225
498 Ga0157372_10007021
499 Ga0157372_10018126
500 Ga0157372_10023649
501 Ga0157375_10199938
502 Ga0157375_11330502
503 Ga0163163_10051142
504 Ga0157379_10010103
505 Ga0157376_10392879
506 Ga0213874_10182361
507 Ga0207427_101436
508 Ga0209026_1001068
509 Ga0209148_1001541
510 Ga0209233_1000189
511 Ga0209455_1000971
512 Ga0209025_1000255
513 Ga0207656_10270553
514 Ga0207696_1007868
515 Ga0207655_1051535
516 Ga0207680_10083486
517 Ga0207647_10047644
518 Ga0207647_10067539
519 Ga0207699_10000233
520 Ga0207699_10240292
521 Ga0207705_10000014
522 Ga0207705_10003669
523 Ga0207705_10071427
524 Ga0207654_10083298
525 Ga0207707_10024797
526 Ga0207695_10001073
527 Ga0207695_10001110
528 Ga0207695_10022114
529 Ga0207695_10078038
530 Ga0207695_10116140
531 Ga0207671_10128061
532 Ga0207671_10160603
533 Ga0207693_10000018
534 Ga0207660_10059984
535 Ga0207657_10000630
536 Ga0207657_10023764
537 Ga0207657_10044173
538 Ga0207649_10003570
539 Ga0207652_10025491
540 Ga0207646_10795226
541 Ga0207694_10001560
542 Ga0207694_10027946
543 Ga0207694_10046784
544 Ga0207700_10000005
545 Ga0207700_10042284
546 Ga0207664_10016923
547 Ga0207664_10122190
548 Ga0207664_10319909
549 Ga0207690_10009473
550 Ga0207690_10087860
551 Ga0207706_10028563
552 Ga0207669_10033448
553 Ga0207691_10040952
554 Ga0207661_10039548
555 Ga0207679_10006603
556 Ga0207667_10008594
557 Ga0207667_10023649
558 Ga0207667_10060708
559 Ga0207667_10110605
560 Ga0207640_10150016
561 Ga0207658_10098949
562 Ga0207677_10500190
563 Ga0207639_10007140
564 Ga0207639_10021357
565 Ga0207678_10001721
566 Ga0207678_10054504
567 Ga0207678_10380719
568 Ga0207702_10000680
569 Ga0207702_10001063
570 Ga0207702_10009734
571 Ga0207702_10009967
572 Ga0207641_10165228
573 Ga0207648_10022805
574 Ga0207674_10000112
575 Ga0207674_10001449
576 Ga0207683_10134271
577 Ga0207698_10019977
578 Ga0209371_1002941
579 Ga0209371_1003350
580 Ga0209998_10011461
581 Ga0209974_10017028
582 Ga0268266_10724064
583 Ga0268264_10451817
584 Ga0307515_10109202
585 Ga0265338_10003597
586 Ga0265338_10253910
587 Ga0268256_1002891
588 Ga0268256_1017420
589 Ga0268256_1019969
590 Ga0268256_1057323
591 Ga0316181_1065167
592 Ga0265325_10086611
593 Ga0265331_10053864
594 Ga0265327_10094284
595 Ga0307513_10010987
596 Ga0307513_10016486
597 Ga0307513_10195431
598 Ga0265313_10037970
599 Ga0265314_10064744
600 Ga0265314_10176973
601 Ga0307412_10529097
602 Ga0373939_0036332
603 Ga0373927_0345266
604 Ga0395899_0001244
605 Ga0395900_0140199
606 Ga0395900_0158879
607 Ga0395900_0690275
608 Ga0395905_0466308
609 Ga0395905_0617057
610 Ga0400483_161840
611 Ga0436363_1512733
612 Ga0439438_004107
613 Ga0439447_006056
614 Ga0451851_1360998
615 Ga0439448_0003958
616 Ga0439448_0006212
617 Ga0439452_002044
618 Ga0439455_0017464
619 Ga0451577_0551069
620 Ga0451576_0672177
621 Ga0495590_0148477
622 Ga0495591_001159
623 Ga0495651_0043401
624 Ga0495650_0000032
625 Ga0495650_0020093
626 Ga0495580_0052032
627 Ga0495605_0056275
628 Ga0495584_0006356
629 Ga0495607_0044030
630 Ga0495606_0000483
631 Ga0495606_0264078
632 Ga0495610_0010684
633 Ga0495610_0048247
634 Ga0495616_0021460
635 Ga0495628_0515012
636 Ga0495643_0023425
637 Ga0495644_0009273
638 Ga0495642_0102971
639 Ga0495654_0000052
640 Ga0495654_0110821
641 Ga0495587_0087998
642 Ga0495609_0018155
643 Ga0495597_0000352
644 Ga0495622_0007281
645 Ga0495668_0015415
646 Ga0495611_0233503
647 Ga0495625_0137871
648 Ga0495625_0154917
649 Ga0495599_0002656
650 Ga0495623_0002133
651 Ga0495623_0211815
652 Ga0495658_0003755
653 Ga0495671_0008541
654 Ga0495649_0033619
655 Ga0495589_0116561
656 Ga0495660_0000021
657 Ga0495660_0037100
658 Ga0495604_0003722
659 Ga0495674_0054773
660 Ga0495674_0330087
661 Ga0495672_0000002
662 Ga0495672_0003774
663 Ga0495676_0173649
664 Ga0495680_0010183
665 Ga0495683_0068165
666 Ga0495683_0207924
667 Ga0495687_000017
668 Ga0495675_0006613
669 Ga0495675_0175806
670 Ga0495679_000020
671 Ga0495673_0000095
672 Ga0495681_0000688
673 Ga0495681_0025691
674 Ga0495602_0023892
675 Ga0495602_0026620
676 Ga0496108_0972609
677 Ga0496116_0013166
678 Ga0496116_0097637
679 Ga0496117_0028588
680 Ga0496118_0109923
681 Ga0496119_0000080
682 Ga0496119_0010211
683 Ga0496119_0036997
684 Ga0496119_0101303
685 Ga0496120_0000075
686 Ga0496120_0003436
687 Ga0496120_0033835
688 Ga0496120_0140271
689 Ga0496121_0000143
690 Ga0496121_0000710
691 Ga0496121_0244110
692 Ga0496122_0096628
693 Ga0496124_0000397
694 Ga0496124_0056079
695 Ga0496124_0125294
696 Ga0496124_0312865
697 Ga0496124_0346986
698 Ga0496124_0357019
699 Ga0496125_0004938
700 Ga0496125_0013012
701 Ga0496126_0140114
702 Ga0496126_0241314
703 Ga0495678_000326
704 Ga0495682_0000015
705 Ga0501069_0145601
706 Ga0501070_0040580
707 Ga0501073_0699739
708 Ga0501080_0535627
709 Ga0501083_0012716
710 nmdc:mga00v17_10053_c1
711 nmdc:mga00v17_1012_c1
712 nmdc:mga00v17_526802_c1
713 nmdc:mga0k408_219757_c1
714 nmdc:mga0rr50_95294_c1
715 nmdc:mga08x19_11335_c1
716 nmdc:mga08x19_62_c1
717 nmdc:mga0sz30_23852_c1
718 Ga0500635_0178239
719 Ga0500578_0014194
720 Ga0500643_033177
721 Ga0500641_0001936
722 Ga0500556_0030618
723 Ga0500560_001783
724 Ga0500560_060194
725 Ga0500562_006671
726 Ga0500569_043175
727 Ga0500572_003354
728 Ga0500621_000001
729 Ga0500573_0002805
730 Ga0500573_0009196
731 Ga0500577_0027899
732 Ga0500604_0020511
733 Ga0500616_0004694
734 Ga0500616_0006278
735 Ga0500616_0012283
736 Ga0500622_0226914
737 Ga0500634_0070795
738 Ga0500639_095619
739 Ga0500636_0000009
740 Ga0500636_0000962
741 Ga0500637_0007241
742 Ga0500645_001141
743 Ga0501084_0131592
744 Ga0501082_0045233
745 2514053890
746 2537877146
747 2599602050
748 2601609699
749 2601746474
750 2643919955
751 2791925039
752 2819559444
753 2838675379
754 2838714260
755 2838721938
756 2838725021
757 2841848917
758 2841862586
759 2842125052
760 2842130274
761 2842154556
762 2842170503
763 2842178176
764 2842187369
765 2842211680
766 2842226700
767 2842519370
768 2842779154
769 2847088176
770 2856318181
771 2876384104
772 2885278823
773 2889013330
774 2899795731
775 2906360587
776 2906418218
777 2919114291
778 2922188900
779 2926755311
780 2929141619
781 2933009201
782 2933014459
783 2933596209
784 2938021314
785 2961175834
786 2970508499
787 2979104295
788 2979811852
789 2984511125
790 2984522513
791 2984541817
792 2984604172
793 651177568
794 8033234545
795 8054464891
796 8054844771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

21

183

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vqk-assembly1.cif.gz_B catalytic manifolds of a fmn-dependent oxidoreductase rube7, expanding the functional diversity of the flavoenzyme superfamily 0.9547 3 195
3bem-assembly1.cif.gz_A crystal structure of putative nitroreductase ydfn (2632848) from bacillus subtilis at 1.65 a resolution 0.9021 6 195
3bem-assembly1.cif.gz_A crystal structure of putative nitroreductase ydfn (2632848) from bacillus subtilis at 1.65 a resolution 0.876 6 195
3ge5-assembly1.cif.gz_B crystal structure of a putative nad(p)h:fmn oxidoreductase (pg0310) from porphyromonas gingivalis w83 at 1.70 a resolution 0.8496 4 194
3ge6-assembly1.cif.gz_B crystal structure of a putative nitroreductase in complex with fmn (exig_2970) from exiguobacterium sibiricum 255-15 at 1.85 a resolution 0.8492 3 195
ID Description Score Start End Superfamily
af_P75894_8_194_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9752 9 193 3.40.109.10
af_P75894_8_194_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9599 9 193 3.40.109.10
3eofA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8474 11 193 3.40.109.10
3bemA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8433 8 194 3.40.109.10
3ge5B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8389 4 194 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A357L4Q7-F1-model_v4 Malonic semialdehyde reductase 0.9785 4 133 GO:0016491
AF-A0A2V9PCW3-F1-model_v4 Malonic semialdehyde reductase 0.9785 56 195 GO:0016491
AF-W1XBJ0-F1-model_v4 Putative malonic semialdehyde reductase RutE 0.9784 25 166 GO:0016491
AF-A0A3S4H715-F1-model_v4 Multifunctional fusion protein [Includes: Putative carbamate hydrolase RutD (EC 3.5.1.-) (Aminohydrolase); Probable malonic semialdehyde reductase RutE (EC 1.1.1.298)] 0.9776 1 195 GO:0006212
GO:0016746
GO:0016811
GO:0019740
GO:0035527
AF-A0A5M6IKL2-F1-model_v4 Putative NADH dehydrogenase/NAD(P)H nitroreductase F1189_27230 (EC 1.-.-.-) 0.9775 3 195 GO:0016491

Map