F434263

General Info

Members Datasets Scaffolds Average Seq Length
399 255 798 160

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10171153|Ga0075365_101711532
Length 170
Sequence MSKTTLEVINVEAPAGADVRALSICAAHDNRPDELLEIFHDLQHELGYIPDQVLPVIANALNRSRAEIYGVLTFYHEFRRTPGGRHNVKICRAEACQAMHTQALCRHAEEKLGIKFGETTSDGQFSLEAVYCLGNCALSPAIMIDGDLFGCVDKERFDSIIADLDRGAAA

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
72 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
73 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
74 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
75 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
76 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
77 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
141 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
142 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
151 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
152 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
153 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
158 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
161 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
162 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
163 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
164 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
169 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
240 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
243 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
244 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
245 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
248 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.54
Nodule 3.01
Rhizoplane 4.76
Rhizosphere 70.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10171153 3300006038 Bacteria 1516
2 JGI25151J46595_10030399 3300003187 Bacteria 2125
3 JGI25160J50197_1000097 3300003354 Bacteria 87619
4 JGI25161J50226_1003735 3300003374 Bacteria 3386
5 Ga0055526_1003114 3300003771 Bacteria 10751
6 Ga0055524_1003524 3300003775 Bacteria 7567
7 Ga0055524_1008547 3300003775 Bacteria 4245
8 Ga0055528_1009856 3300003790 Bacteria 3949
9 Ga0055540_1005080 3300003792 Bacteria 5681
10 Ga0055540_1046283 3300003792 Bacteria 915
11 Ga0055531_10006425 3300003794 Bacteria 6676
12 Ga0055543_1002404 3300004625 Bacteria 6219
13 Ga0065165_1000427 3300005262 Bacteria 66083
14 Ga0070658_10929197 3300005327 Bacteria 756
15 Ga0068868_100732301 3300005338 Bacteria 887
16 Ga0070692_10885364 3300005345 Bacteria 616
17 Ga0070671_101009814 3300005355 Bacteria 729
18 Ga0070673_101493989 3300005364 Bacteria 637
19 Ga0070709_10000881 3300005434 Bacteria 16815
20 Ga0070714_100023781 3300005435 Bacteria 5038
21 Ga0070713_100016318 3300005436 Bacteria 5584
22 Ga0070710_10000290 3300005437 Bacteria 23755
23 Ga0070711_100005804 3300005439 Bacteria 7412
24 Ga0070663_100041954 3300005455 Bacteria 3213
25 Ga0070663_101279252 3300005455 Bacteria 647
26 Ga0070678_100972904 3300005456 Bacteria 779
27 Ga0070678_102211564 3300005456 Bacteria 522
28 Ga0070662_101111340 3300005457 Bacteria 678
29 Ga0068867_100159889 3300005459 Bacteria 1776
30 Ga0070699_100567272 3300005518 Bacteria 1034
31 Ga0070679_101861503 3300005530 Bacteria 550
32 Ga0068853_101090998 3300005539 Bacteria 770
33 Ga0068853_102102039 3300005539 Bacteria 548
34 Ga0070665_100187298 3300005548 Bacteria 2070
35 Ga0070665_100230399 3300005548 Bacteria 1852
36 Ga0068855_100184868 3300005563 Bacteria 2354
37 Ga0068854_100678141 3300005578 Bacteria 887
38 Ga0068856_100076569 3300005614 Bacteria 3314
39 Ga0070702_100323314 3300005615 Bacteria 1076
40 Ga0068866_10454905 3300005718 Bacteria 838
41 Ga0068861_100946000 3300005719 Bacteria 819
42 Ga0068851_10245671 3300005834 Bacteria 1014
43 Ga0068863_101503911 3300005841 Bacteria 682
44 Ga0081538_10233788 3300005981 Bacteria 715
45 Ga0070717_10232697 3300006028 Bacteria 1623
46 Ga0075365_10005518 3300006038 Bacteria 6830
47 Ga0075363_100046577 3300006048 Bacteria 2301
48 Ga0075363_100112369 3300006048 Bacteria 1515
49 Ga0075364_10006126 3300006051 Bacteria 7042
50 Ga0070712_100255273 3300006175 Bacteria 1403
51 Ga0075362_10181437 3300006177 Bacteria 1020
52 Ga0075367_10001037 3300006178 Bacteria 11468
53 Ga0075367_10735530 3300006178 Bacteria 628
54 Ga0075369_10000686 3300006186 Bacteria 10826
55 Ga0075370_10119171 3300006353 Bacteria 1535
56 Ga0075370_10634402 3300006353 Bacteria 648
57 Ga0075434_100005448 3300006871 Bacteria 11592
58 Ga0075434_100078198 3300006871 Bacteria 3303
59 Ga0079104_1000207 3300006946 Bacteria 82261
60 Ga0075435_100942812 3300007076 Bacteria 753
61 Ga0105240_11207462 3300009093 Bacteria 801
62 Ga0111539_10594740 3300009094 Bacteria 1288
63 Ga0114129_10106203 3300009147 Bacteria 3879
64 Ga0105243_10577276 3300009148 Bacteria 1079
65 Ga0105241_10963655 3300009174 Bacteria 796
66 Ga0105237_10386218 3300009545 Bacteria 1405
67 Ga0105239_10327072 3300010375 Bacteria 1729
68 Ga0105239_11532114 3300010375 Bacteria 770
69 Ga0105246_10864373 3300011119 Bacteria 808
70 Ga0157370_10285531 3300013104 Bacteria 1525
71 Ga0157370_10652856 3300013104 Bacteria 961
72 Ga0157369_10647412 3300013105 Bacteria 1090
73 Ga0171463_1004 3300013249 Bacteria 437207
74 Ga0157374_10308576 3300013296 Bacteria 1566
75 Ga0157372_10252858 3300013307 Bacteria 2046
76 Ga0157375_11076171 3300013308 Bacteria 941
77 Ga0163163_11339160 3300014325 Bacteria 778
78 Ga0157380_10061810 3300014326 Bacteria 2998
79 Ga0157380_10148276 3300014326 Bacteria 2024
80 Ga0157380_10180383 3300014326 Bacteria 1855
81 Ga0157380_11713141 3300014326 Bacteria 686
82 Ga0182008_10075843 3300014497 Bacteria 1654
83 Ga0157379_10227892 3300014968 Bacteria 1689
84 Ga0157379_10930318 3300014968 Bacteria 826
85 Ga0157376_10508968 3300014969 Bacteria 1185
86 Ga0157376_10748748 3300014969 Bacteria 986
87 Ga0157376_11311962 3300014969 Bacteria 754
88 Ga0182006_1053461 3300015261 Bacteria 1548
89 Ga0182007_10008700 3300015262 Bacteria 4149
90 Ga0183363_1354 3300015690 Bacteria 5302
91 Ga0214544_1002560 3300021320 Bacteria 38129
92 Ga0214542_1000008 3300021321 Bacteria 278895
93 Ga0214543_1000031 3300021327 Bacteria 206436
94 Ga0228711_1000050 3300022739 Bacteria 81399
95 Ga0228710_1000063 3300022740 Bacteria 81399
96 Ga0209436_101650 3300025208 Bacteria 7442
97 Ga0209026_1000013 3300025250 Bacteria 415633
98 Ga0209148_1000032 3300025254 Bacteria 557660
99 Ga0209759_1000058 3300025256 Bacteria 203580
100 Ga0209455_1000277 3300025272 Bacteria 56172
101 Ga0209673_1004578 3300025273 Bacteria 7334
102 Ga0209130_1000027 3300025284 Bacteria 327700
103 Ga0209675_1018913 3300025291 Bacteria 1913
104 Ga0209676_1001367 3300025292 Bacteria 23952
105 Ga0209676_1033036 3300025292 Bacteria 1547
106 Ga0209025_1000706 3300025294 Bacteria 56897
107 Ga0209025_1034595 3300025294 Bacteria 2302
108 Ga0209564_1000111 3300025295 Bacteria 212210
109 Ga0209564_1038098 3300025295 Bacteria 1343
110 Ga0209564_1041199 3300025295 Bacteria 1242
111 Ga0209758_1007821 3300025297 Bacteria 7135
112 Ga0209758_1040238 3300025297 Bacteria 1766
113 Ga0209758_1060825 3300025297 Bacteria 1248
114 Ga0209256_1000132 3300025299 Bacteria 160806
115 Ga0209256_1002798 3300025299 Bacteria 13359
116 Ga0209256_1016132 3300025299 Bacteria 2566
117 Ga0207426_1000072 3300025302 Bacteria 327700
118 Ga0207426_1000595 3300025302 Bacteria 47697
119 Ga0209051_1004414 3300025303 Bacteria 8686
120 Ga0209051_1018156 3300025303 Bacteria 3120
121 Ga0207656_10148764 3300025321 Bacteria 1108
122 Ga0207692_10009071 3300025898 Bacteria 4142
123 Ga0207647_10059332 3300025904 Bacteria 2342
124 Ga0207647_10137388 3300025904 Bacteria 1434
125 Ga0207699_10010244 3300025906 Bacteria 4696
126 Ga0207705_11098673 3300025909 Bacteria 613
127 Ga0207654_10703899 3300025911 Bacteria 726
128 Ga0207695_10665766 3300025913 Bacteria 922
129 Ga0207663_10042082 3300025916 Bacteria 2789
130 Ga0207657_10066322 3300025919 Bacteria 3073
131 Ga0207649_10326641 3300025920 Bacteria 1129
132 Ga0207694_10277690 3300025924 Bacteria 1375
133 Ga0207687_10392128 3300025927 Bacteria 1140
134 Ga0207700_10028044 3300025928 Bacteria 3951
135 Ga0207664_10010923 3300025929 Bacteria 6431
136 Ga0207664_10258084 3300025929 Bacteria 1523
137 Ga0207690_10154582 3300025932 Bacteria 1704
138 Ga0207706_10228709 3300025933 Bacteria 1628
139 Ga0207686_10131784 3300025934 Bacteria 1715
140 Ga0207669_10091356 3300025937 Bacteria 1983
141 Ga0207704_11802116 3300025938 Bacteria 526
142 Ga0207679_11581447 3300025945 Bacteria 601
143 Ga0207667_10539472 3300025949 Bacteria 1180
144 Ga0207667_11804751 3300025949 Bacteria 576
145 Ga0207668_10024031 3300025972 Bacteria 3928
146 Ga0207640_11054363 3300025981 Bacteria 717
147 Ga0207677_10489099 3300026023 Bacteria 1062
148 Ga0207678_10041734 3300026067 Bacteria 3978
149 Ga0207678_10402201 3300026067 Bacteria 1186
150 Ga0207678_10461451 3300026067 Bacteria 1105
151 Ga0207702_11925003 3300026078 Bacteria 582
152 Ga0207641_11300396 3300026088 Bacteria 728
153 Ga0207676_11598055 3300026095 Bacteria 650
154 Ga0207674_10054321 3300026116 Bacteria 4078
155 Ga0207674_10066275 3300026116 Bacteria 3637
156 Ga0207675_100505435 3300026118 Bacteria 1203
157 Ga0207698_11039254 3300026142 Bacteria 831
158 Ga0209281_1000028 3300027111 Bacteria 440027
159 Ga0209281_1000030 3300027111 Bacteria 425931
160 Ga0209282_1000004 3300027666 Bacteria 425931
161 Ga0268266_10011769 3300028379 Bacteria 7586
162 Ga0268266_10081307 3300028379 Bacteria 2825
163 Ga0268266_10089377 3300028379 Bacteria 2697
164 Ga0268266_10217592 3300028379 Bacteria 1754
165 Ga0268266_10226003 3300028379 Bacteria 1722
166 Ga0265327_10001155 3300031251 Bacteria 35957
167 Ga0307513_10085781 3300031456 Bacteria 3230
168 Ga0307408_100002251 3300031548 Bacteria 13767
169 Ga0307408_101249211 3300031548 Bacteria 694
170 Ga0307405_10000923 3300031731 Bacteria 11683
171 Ga0307405_10200575 3300031731 Bacteria 1449
172 Ga0307405_10526646 3300031731 Bacteria 952
173 Ga0307413_10017324 3300031824 Bacteria 3749
174 Ga0307410_10034106 3300031852 Bacteria 3292
175 Ga0307406_11320761 3300031901 Bacteria 630
176 Ga0307407_10043585 3300031903 Bacteria 2523
177 Ga0307412_10063708 3300031911 Bacteria 2488
178 Ga0315914_1013044 3300031967 Bacteria 9349
179 Ga0307409_100052964 3300031995 Bacteria 3115
180 Ga0307416_100000215 3300032002 Bacteria 30330
181 Ga0307416_100163538 3300032002 Bacteria 2061
182 Ga0307411_10003135 3300032005 Bacteria 7581
183 Ga0307415_100000500 3300032126 Bacteria 17010
184 Ga0315913_1012652 3300033430 Bacteria 9341
185 Ga0315915_1000002 3300033464 Bacteria 425854
186 Ga0373958_0029658 3300034819 Bacteria 1066
187 Ga0373949_0242972 3300035090 Bacteria 554
188 Ga0373939_0222704 3300035114 Bacteria 723
189 Ga0395899_0170524 3300037312 Bacteria 1533
190 Ga0395900_0156069 3300037418 Bacteria 2331
191 Ga0395905_0094273 3300037471 Bacteria 2808
192 Ga0395901_0313812 3300038443 Bacteria 1623
193 Ga0395901_0556286 3300038443 Bacteria 1162
194 Ga0395901_0786868 3300038443 Bacteria 941
195 Ga0395901_1124285 3300038443 Bacteria 755
196 Ga0436365_1931591 3300039437 Bacteria 707
197 Ga0439438_024157 3300041405 Bacteria 1667
198 Ga0439447_089213 3300041407 Bacteria 709
199 Ga0439453_0004975 3300041408 Bacteria 2003
200 Ga0451787_171694 3300041441 Bacteria 735
201 Ga0451807_2692984 3300041486 Bacteria 713
202 Ga0451851_0276730 3300041507 Bacteria 521
203 Ga0439431_0043705 3300041997 Bacteria 1147
204 Ga0439441_002644 3300042001 Bacteria 2546
205 Ga0439443_005356 3300042003 Bacteria 1712
206 Ga0439449_0007782 3300042007 Bacteria 4069
207 Ga0439451_034776 3300042009 Bacteria 1013
208 Ga0439456_034122 3300042013 Bacteria 1096
209 Ga0450923_019792 3300042125 Bacteria 1299
210 Ga0450894_003948 3300042131 Bacteria 1937
211 Ga0450910_022991 3300042147 Bacteria 951
212 Ga0439446_0000368 3300042156 Bacteria 8643
213 Ga0439446_0057642 3300042156 Bacteria 1169
214 Ga0450908_003314 3300042184 Bacteria 3132
215 Ga0439434_0003322 3300042435 Bacteria 4720
216 Ga0439435_0000199 3300042436 Bacteria 8496
217 Ga0439444_0002841 3300042437 Bacteria 2404
218 Ga0439460_0010368 3300042461 Bacteria 2382
219 Ga0450918_015581 3300042531 Bacteria 1321
220 Ga0466972_0234461 3300044658 Bacteria 858
221 Ga0495603_0170593 3300046455 Bacteria 1260
222 Ga0495638_0033723 3300046460 Bacteria 3272
223 Ga0495638_0192200 3300046460 Bacteria 1158
224 Ga0495585_0088948 3300046492 Bacteria 1665
225 Ga0495607_0144798 3300046501 Bacteria 1222
226 Ga0495610_0097496 3300046512 Bacteria 1322
227 Ga0495620_0087831 3300046515 Bacteria 1250
228 Ga0495668_0375364 3300046616 Bacteria 781
229 Ga0495625_0187982 3300046660 Bacteria 1370
230 Ga0495625_0615938 3300046660 Bacteria 650
231 Ga0495589_0051499 3300046794 Bacteria 2036
232 Ga0495589_0302737 3300046794 Bacteria 741
233 Ga0495660_0196043 3300046810 Bacteria 967
234 Ga0495686_0121157 3300047472 Bacteria 1559
235 Ga0496101_0417294 3300048904 Bacteria 1058
236 Ga0496101_0514285 3300048904 Bacteria 946
237 Ga0496102_0740107 3300048905 Bacteria 906
238 Ga0496102_1010863 3300048905 Bacteria 752
239 Ga0496102_1195571 3300048905 Bacteria 680
240 Ga0496103_0079966 3300048906 Bacteria 2055
241 Ga0496104_0291878 3300048907 Bacteria 1543
242 Ga0496105_0592805 3300048908 Bacteria 861
243 Ga0496107_0167645 3300048910 Bacteria 1629
244 Ga0496108_0481326 3300048911 Bacteria 1084
245 Ga0496109_1183260 3300048912 Bacteria 701
246 Ga0496110_0374380 3300048913 Bacteria 1298
247 Ga0496110_1013159 3300048913 Bacteria 738
248 Ga0496111_0673862 3300048914 Bacteria 754
249 Ga0496111_0740298 3300048914 Bacteria 714
250 Ga0496112_0053700 3300048915 Bacteria 3958
251 Ga0496115_0456581 3300048918 Bacteria 1031
252 Ga0496117_0181995 3300048920 Bacteria 1207
253 Ga0496118_0394833 3300048921 Bacteria 721
254 Ga0496120_0002017 3300048923 Bacteria 22080
255 Ga0496120_0301254 3300048923 Bacteria 734
256 Ga0496122_0001589 3300048925 Bacteria 35626
257 Ga0496123_0000907 3300048926 Bacteria 46644
258 Ga0496124_0095868 3300048927 Bacteria 2411
259 Ga0496124_0201281 3300048927 Bacteria 1514
260 Ga0496124_0313772 3300048927 Bacteria 1126
261 Ga0496125_0204897 3300048928 Bacteria 1287
262 Ga0496126_0317521 3300048929 Bacteria 1281
263 Ga0496126_0795277 3300048929 Bacteria 726
264 Ga0501031_0021636 3300049568 Bacteria 4193
265 Ga0501031_0109269 3300049568 Bacteria 1806
266 Ga0501031_0329079 3300049568 Bacteria 989
267 Ga0501032_0002015 3300049569 Bacteria 16009
268 Ga0501032_0031941 3300049569 Bacteria 3609
269 Ga0501033_0002377 3300049570 Bacteria 16023
270 Ga0501033_0002612 3300049570 Bacteria 15179
271 Ga0501033_0055517 3300049570 Bacteria 2928
272 Ga0501033_0117917 3300049570 Bacteria 1928
273 Ga0501033_0230334 3300049570 Bacteria 1316
274 Ga0501033_0609628 3300049570 Bacteria 748
275 Ga0501034_0000296 3300049571 Bacteria 88355
276 Ga0501034_0048345 3300049571 Bacteria 4294
277 Ga0501034_0073086 3300049571 Bacteria 3438
278 Ga0501034_0680233 3300049571 Bacteria 929
279 Ga0501034_0738790 3300049571 Bacteria 880
280 Ga0501036_0000034 3300049572 Bacteria 88355
281 Ga0501036_0962742 3300049572 Bacteria 699
282 Ga0501037_0000079 3300049573 Bacteria 88355
283 Ga0501037_0007504 3300049573 Bacteria 7984
284 Ga0501037_0037374 3300049573 Bacteria 3580
285 Ga0501038_0000063 3300049574 Bacteria 88355
286 Ga0501038_0158344 3300049574 Bacteria 1842
287 Ga0501038_0158686 3300049574 Bacteria 1840
288 Ga0501038_0248803 3300049574 Bacteria 1409
289 Ga0501038_0504818 3300049574 Bacteria 924
290 Ga0501039_0000058 3300049575 Bacteria 88355
291 Ga0501039_0247211 3300049575 Bacteria 1403
292 Ga0501040_0402702 3300049576 Bacteria 983
293 Ga0501040_0870266 3300049576 Bacteria 652
294 Ga0501041_0587438 3300049577 Bacteria 711
295 Ga0501043_0000005 3300049579 Bacteria 254466
296 Ga0501043_0011743 3300049579 Bacteria 6858
297 Ga0501043_0079127 3300049579 Bacteria 2583
298 Ga0501043_0219042 3300049579 Bacteria 1473
299 Ga0501043_0237152 3300049579 Bacteria 1408
300 Ga0501046_0058269 3300049580 Bacteria 3028
301 Ga0501046_0837306 3300049580 Bacteria 644
302 Ga0501047_0003776 3300049581 Bacteria 14257
303 Ga0501047_0065158 3300049581 Bacteria 3512
304 Ga0501047_0090036 3300049581 Bacteria 2945
305 Ga0501047_0305658 3300049581 Bacteria 1432
306 Ga0501047_0342045 3300049581 Bacteria 1333
307 Ga0501047_0689862 3300049581 Bacteria 839
308 Ga0501048_0372681 3300049582 Bacteria 1019
309 Ga0501067_0068851 3300049583 Bacteria 1960
310 Ga0501069_0000033 3300049585 Bacteria 92477
311 Ga0501069_0106272 3300049585 Bacteria 1596
312 Ga0501069_0130352 3300049585 Bacteria 1439
313 Ga0501069_0280721 3300049585 Bacteria 975
314 Ga0501070_0000055 3300049586 Bacteria 99156
315 Ga0501070_0000949 3300049586 Bacteria 26162
316 Ga0501070_0003899 3300049586 Bacteria 12868
317 Ga0501070_0005651 3300049586 Bacteria 10666
318 Ga0501070_0073935 3300049586 Bacteria 2821
319 Ga0501070_0114733 3300049586 Bacteria 2225
320 Ga0501070_0426358 3300049586 Bacteria 1071
321 Ga0501070_0559511 3300049586 Bacteria 915
322 Ga0501070_0571354 3300049586 Bacteria 903
323 Ga0501071_0010135 3300049587 Bacteria 6305
324 Ga0501071_0218204 3300049587 Bacteria 1435
325 Ga0501073_0078334 3300049589 Bacteria 2300
326 Ga0501073_0079001 3300049589 Bacteria 2290
327 Ga0501073_0083877 3300049589 Bacteria 2217
328 Ga0501074_0000053 3300049590 Bacteria 56031
329 Ga0501074_0311576 3300049590 Bacteria 1118
330 Ga0501076_0489660 3300049592 Bacteria 1013
331 Ga0501076_0788122 3300049592 Bacteria 784
332 Ga0501079_0064638 3300049741 Bacteria 2822
333 Ga0501079_0084148 3300049741 Bacteria 2461
334 Ga0501079_0194509 3300049741 Bacteria 1583
335 Ga0501080_0000448 3300049742 Bacteria 32030
336 Ga0501080_0053362 3300049742 Bacteria 3763
337 Ga0501080_0094256 3300049742 Bacteria 2780
338 Ga0501080_0303972 3300049742 Bacteria 1446
339 Ga0501080_0491228 3300049742 Bacteria 1098
340 Ga0501080_0530480 3300049742 Bacteria 1050
341 Ga0501081_0039499 3300049743 Bacteria 3229
342 Ga0501083_0000063 3300049744 Bacteria 74976
343 Ga0501035_0000086 3300049822 Bacteria 115822
344 Ga0501035_0002075 3300049822 Bacteria 19934
345 Ga0501035_0003071 3300049822 Bacteria 16023
346 Ga0501035_0010191 3300049822 Bacteria 8723
347 Ga0501035_0015121 3300049822 Bacteria 7122
348 Ga0501035_0018487 3300049822 Bacteria 6421
349 Ga0501035_0034175 3300049822 Bacteria 4621
350 Ga0501035_0094641 3300049822 Bacteria 2626
351 Ga0501035_0217038 3300049822 Bacteria 1634
352 Ga0501035_0594248 3300049822 Bacteria 903
353 Ga0501044_0000142 3300049823 Bacteria 88355
354 Ga0501044_0000242 3300049823 Bacteria 69190
355 Ga0501044_0065371 3300049823 Bacteria 3709
356 Ga0501044_0077417 3300049823 Bacteria 3373
357 Ga0501044_0089583 3300049823 Bacteria 3105
358 Ga0501044_0092035 3300049823 Bacteria 3058
359 Ga0501044_0142215 3300049823 Bacteria 2387
360 Ga0501044_0197804 3300049823 Bacteria 1969
361 Ga0501044_0554174 3300049823 Bacteria 1046
362 Ga0501044_0758818 3300049823 Bacteria 852
363 Ga0501044_1254221 3300049823 Bacteria 608
364 nmdc:mga03n38_34441_c1 3300050490 Bacteria 2163
365 nmdc:mga00v17_148761_c1 3300050491 Bacteria 1504
366 nmdc:mga0yw44_110508_c1 3300050492 Bacteria 1760
367 nmdc:mga0yw44_218079_c1 3300050492 Bacteria 1263
368 nmdc:mga0yw44_229076_c1 3300050492 Bacteria 1233
369 nmdc:mga0yw44_27105_c1 3300050492 Bacteria 3279
370 nmdc:mga07m45_110127_c1 3300050496 Bacteria 1585
371 nmdc:mga07m45_172200_c1 3300050496 Bacteria 935
372 nmdc:mga09592_250526_c1 3300050508 Bacteria 1535
373 nmdc:mga08y16_579744_c1 3300050511 Bacteria 1133
374 nmdc:mga0n895_143046_c1 3300050512 Bacteria 2421
375 nmdc:mga0n895_82291_c1 3300050512 Bacteria 3209
376 nmdc:mga0a205_22295_c1 3300050515 Bacteria 5997
377 nmdc:mga0a205_325667_c1 3300050515 Bacteria 1407
378 Ga0500644_0229105 3300053088 Bacteria 777
379 Ga0500660_162861 3300053100 Bacteria 841
380 Ga0500556_0000032 3300053104 Bacteria 150774
381 Ga0500562_022315 3300053108 Bacteria 1650
382 Ga0500592_039049 3300053116 Bacteria 768
383 Ga0500595_047582 3300053119 Bacteria 1343
384 Ga0500618_000288 3300053125 Bacteria 38455
385 Ga0500568_0000436 3300053139 Bacteria 31383
386 Ga0500573_0019147 3300053140 Bacteria 3914
387 Ga0500577_0200451 3300053142 Bacteria 861
388 Ga0500604_0013943 3300053151 Bacteria 2184
389 Ga0500604_0044707 3300053151 Bacteria 1350
390 Ga0500616_0001946 3300053153 Bacteria 18443
391 Ga0500627_0055933 3300053158 Bacteria 1729
392 Ga0500627_0057995 3300053158 Bacteria 1699
393 Ga0500645_021094 3300053730 Bacteria 2012
394 Ga0587077_049169 3300059493 Bacteria 876
395 Ga0587082_066232 3300059504 Bacteria 724
396 Ga0501082_0156911 3300060353 Bacteria 1977
397 Ga0501082_0289033 3300060353 Bacteria 1427
398 Ga0501082_0784255 3300060353 Bacteria 834
399 Ga0501082_1696594 3300060353 Bacteria 551
400 Ga0075365_10171153
401 JGI25151J46595_10030399
402 JGI25160J50197_1000097
403 JGI25161J50226_1003735
404 Ga0055526_1003114
405 Ga0055524_1003524
406 Ga0055524_1008547
407 Ga0055528_1009856
408 Ga0055540_1005080
409 Ga0055540_1046283
410 Ga0055531_10006425
411 Ga0055543_1002404
412 Ga0065165_1000427
413 Ga0070658_10929197
414 Ga0068868_100732301
415 Ga0070692_10885364
416 Ga0070671_101009814
417 Ga0070673_101493989
418 Ga0070709_10000881
419 Ga0070714_100023781
420 Ga0070713_100016318
421 Ga0070710_10000290
422 Ga0070711_100005804
423 Ga0070663_100041954
424 Ga0070663_101279252
425 Ga0070678_100972904
426 Ga0070678_102211564
427 Ga0070662_101111340
428 Ga0068867_100159889
429 Ga0070699_100567272
430 Ga0070679_101861503
431 Ga0068853_101090998
432 Ga0068853_102102039
433 Ga0070665_100187298
434 Ga0070665_100230399
435 Ga0068855_100184868
436 Ga0068854_100678141
437 Ga0068856_100076569
438 Ga0070702_100323314
439 Ga0068866_10454905
440 Ga0068861_100946000
441 Ga0068851_10245671
442 Ga0068863_101503911
443 Ga0081538_10233788
444 Ga0070717_10232697
445 Ga0075365_10005518
446 Ga0075363_100046577
447 Ga0075363_100112369
448 Ga0075364_10006126
449 Ga0070712_100255273
450 Ga0075362_10181437
451 Ga0075367_10001037
452 Ga0075367_10735530
453 Ga0075369_10000686
454 Ga0075370_10119171
455 Ga0075370_10634402
456 Ga0075434_100005448
457 Ga0075434_100078198
458 Ga0079104_1000207
459 Ga0075435_100942812
460 Ga0105240_11207462
461 Ga0111539_10594740
462 Ga0114129_10106203
463 Ga0105243_10577276
464 Ga0105241_10963655
465 Ga0105237_10386218
466 Ga0105239_10327072
467 Ga0105239_11532114
468 Ga0105246_10864373
469 Ga0157370_10285531
470 Ga0157370_10652856
471 Ga0157369_10647412
472 Ga0171463_1004
473 Ga0157374_10308576
474 Ga0157372_10252858
475 Ga0157375_11076171
476 Ga0163163_11339160
477 Ga0157380_10061810
478 Ga0157380_10148276
479 Ga0157380_10180383
480 Ga0157380_11713141
481 Ga0182008_10075843
482 Ga0157379_10227892
483 Ga0157379_10930318
484 Ga0157376_10508968
485 Ga0157376_10748748
486 Ga0157376_11311962
487 Ga0182006_1053461
488 Ga0182007_10008700
489 Ga0183363_1354
490 Ga0214544_1002560
491 Ga0214542_1000008
492 Ga0214543_1000031
493 Ga0228711_1000050
494 Ga0228710_1000063
495 Ga0209436_101650
496 Ga0209026_1000013
497 Ga0209148_1000032
498 Ga0209759_1000058
499 Ga0209455_1000277
500 Ga0209673_1004578
501 Ga0209130_1000027
502 Ga0209675_1018913
503 Ga0209676_1001367
504 Ga0209676_1033036
505 Ga0209025_1000706
506 Ga0209025_1034595
507 Ga0209564_1000111
508 Ga0209564_1038098
509 Ga0209564_1041199
510 Ga0209758_1007821
511 Ga0209758_1040238
512 Ga0209758_1060825
513 Ga0209256_1000132
514 Ga0209256_1002798
515 Ga0209256_1016132
516 Ga0207426_1000072
517 Ga0207426_1000595
518 Ga0209051_1004414
519 Ga0209051_1018156
520 Ga0207656_10148764
521 Ga0207692_10009071
522 Ga0207647_10059332
523 Ga0207647_10137388
524 Ga0207699_10010244
525 Ga0207705_11098673
526 Ga0207654_10703899
527 Ga0207695_10665766
528 Ga0207663_10042082
529 Ga0207657_10066322
530 Ga0207649_10326641
531 Ga0207694_10277690
532 Ga0207687_10392128
533 Ga0207700_10028044
534 Ga0207664_10010923
535 Ga0207664_10258084
536 Ga0207690_10154582
537 Ga0207706_10228709
538 Ga0207686_10131784
539 Ga0207669_10091356
540 Ga0207704_11802116
541 Ga0207679_11581447
542 Ga0207667_10539472
543 Ga0207667_11804751
544 Ga0207668_10024031
545 Ga0207640_11054363
546 Ga0207677_10489099
547 Ga0207678_10041734
548 Ga0207678_10402201
549 Ga0207678_10461451
550 Ga0207702_11925003
551 Ga0207641_11300396
552 Ga0207676_11598055
553 Ga0207674_10054321
554 Ga0207674_10066275
555 Ga0207675_100505435
556 Ga0207698_11039254
557 Ga0209281_1000028
558 Ga0209281_1000030
559 Ga0209282_1000004
560 Ga0268266_10011769
561 Ga0268266_10081307
562 Ga0268266_10089377
563 Ga0268266_10217592
564 Ga0268266_10226003
565 Ga0265327_10001155
566 Ga0307513_10085781
567 Ga0307408_100002251
568 Ga0307408_101249211
569 Ga0307405_10000923
570 Ga0307405_10200575
571 Ga0307405_10526646
572 Ga0307413_10017324
573 Ga0307410_10034106
574 Ga0307406_11320761
575 Ga0307407_10043585
576 Ga0307412_10063708
577 Ga0315914_1013044
578 Ga0307409_100052964
579 Ga0307416_100000215
580 Ga0307416_100163538
581 Ga0307411_10003135
582 Ga0307415_100000500
583 Ga0315913_1012652
584 Ga0315915_1000002
585 Ga0373958_0029658
586 Ga0373949_0242972
587 Ga0373939_0222704
588 Ga0395899_0170524
589 Ga0395900_0156069
590 Ga0395905_0094273
591 Ga0395901_0313812
592 Ga0395901_0556286
593 Ga0395901_0786868
594 Ga0395901_1124285
595 Ga0436365_1931591
596 Ga0439438_024157
597 Ga0439447_089213
598 Ga0439453_0004975
599 Ga0451787_171694
600 Ga0451807_2692984
601 Ga0451851_0276730
602 Ga0439431_0043705
603 Ga0439441_002644
604 Ga0439443_005356
605 Ga0439449_0007782
606 Ga0439451_034776
607 Ga0439456_034122
608 Ga0450923_019792
609 Ga0450894_003948
610 Ga0450910_022991
611 Ga0439446_0000368
612 Ga0439446_0057642
613 Ga0450908_003314
614 Ga0439434_0003322
615 Ga0439435_0000199
616 Ga0439444_0002841
617 Ga0439460_0010368
618 Ga0450918_015581
619 Ga0466972_0234461
620 Ga0495603_0170593
621 Ga0495638_0033723
622 Ga0495638_0192200
623 Ga0495585_0088948
624 Ga0495607_0144798
625 Ga0495610_0097496
626 Ga0495620_0087831
627 Ga0495668_0375364
628 Ga0495625_0187982
629 Ga0495625_0615938
630 Ga0495589_0051499
631 Ga0495589_0302737
632 Ga0495660_0196043
633 Ga0495686_0121157
634 Ga0496101_0417294
635 Ga0496101_0514285
636 Ga0496102_0740107
637 Ga0496102_1010863
638 Ga0496102_1195571
639 Ga0496103_0079966
640 Ga0496104_0291878
641 Ga0496105_0592805
642 Ga0496107_0167645
643 Ga0496108_0481326
644 Ga0496109_1183260
645 Ga0496110_0374380
646 Ga0496110_1013159
647 Ga0496111_0673862
648 Ga0496111_0740298
649 Ga0496112_0053700
650 Ga0496115_0456581
651 Ga0496117_0181995
652 Ga0496118_0394833
653 Ga0496120_0002017
654 Ga0496120_0301254
655 Ga0496122_0001589
656 Ga0496123_0000907
657 Ga0496124_0095868
658 Ga0496124_0201281
659 Ga0496124_0313772
660 Ga0496125_0204897
661 Ga0496126_0317521
662 Ga0496126_0795277
663 Ga0501031_0021636
664 Ga0501031_0109269
665 Ga0501031_0329079
666 Ga0501032_0002015
667 Ga0501032_0031941
668 Ga0501033_0002377
669 Ga0501033_0002612
670 Ga0501033_0055517
671 Ga0501033_0117917
672 Ga0501033_0230334
673 Ga0501033_0609628
674 Ga0501034_0000296
675 Ga0501034_0048345
676 Ga0501034_0073086
677 Ga0501034_0680233
678 Ga0501034_0738790
679 Ga0501036_0000034
680 Ga0501036_0962742
681 Ga0501037_0000079
682 Ga0501037_0007504
683 Ga0501037_0037374
684 Ga0501038_0000063
685 Ga0501038_0158344
686 Ga0501038_0158686
687 Ga0501038_0248803
688 Ga0501038_0504818
689 Ga0501039_0000058
690 Ga0501039_0247211
691 Ga0501040_0402702
692 Ga0501040_0870266
693 Ga0501041_0587438
694 Ga0501043_0000005
695 Ga0501043_0011743
696 Ga0501043_0079127
697 Ga0501043_0219042
698 Ga0501043_0237152
699 Ga0501046_0058269
700 Ga0501046_0837306
701 Ga0501047_0003776
702 Ga0501047_0065158
703 Ga0501047_0090036
704 Ga0501047_0305658
705 Ga0501047_0342045
706 Ga0501047_0689862
707 Ga0501048_0372681
708 Ga0501067_0068851
709 Ga0501069_0000033
710 Ga0501069_0106272
711 Ga0501069_0130352
712 Ga0501069_0280721
713 Ga0501070_0000055
714 Ga0501070_0000949
715 Ga0501070_0003899
716 Ga0501070_0005651
717 Ga0501070_0073935
718 Ga0501070_0114733
719 Ga0501070_0426358
720 Ga0501070_0559511
721 Ga0501070_0571354
722 Ga0501071_0010135
723 Ga0501071_0218204
724 Ga0501073_0078334
725 Ga0501073_0079001
726 Ga0501073_0083877
727 Ga0501074_0000053
728 Ga0501074_0311576
729 Ga0501076_0489660
730 Ga0501076_0788122
731 Ga0501079_0064638
732 Ga0501079_0084148
733 Ga0501079_0194509
734 Ga0501080_0000448
735 Ga0501080_0053362
736 Ga0501080_0094256
737 Ga0501080_0303972
738 Ga0501080_0491228
739 Ga0501080_0530480
740 Ga0501081_0039499
741 Ga0501083_0000063
742 Ga0501035_0000086
743 Ga0501035_0002075
744 Ga0501035_0003071
745 Ga0501035_0010191
746 Ga0501035_0015121
747 Ga0501035_0018487
748 Ga0501035_0034175
749 Ga0501035_0094641
750 Ga0501035_0217038
751 Ga0501035_0594248
752 Ga0501044_0000142
753 Ga0501044_0000242
754 Ga0501044_0065371
755 Ga0501044_0077417
756 Ga0501044_0089583
757 Ga0501044_0092035
758 Ga0501044_0142215
759 Ga0501044_0197804
760 Ga0501044_0554174
761 Ga0501044_0758818
762 Ga0501044_1254221
763 nmdc:mga03n38_34441_c1
764 nmdc:mga00v17_148761_c1
765 nmdc:mga0yw44_110508_c1
766 nmdc:mga0yw44_218079_c1
767 nmdc:mga0yw44_229076_c1
768 nmdc:mga0yw44_27105_c1
769 nmdc:mga07m45_110127_c1
770 nmdc:mga07m45_172200_c1
771 nmdc:mga09592_250526_c1
772 nmdc:mga08y16_579744_c1
773 nmdc:mga0n895_143046_c1
774 nmdc:mga0n895_82291_c1
775 nmdc:mga0a205_22295_c1
776 nmdc:mga0a205_325667_c1
777 Ga0500644_0229105
778 Ga0500660_162861
779 Ga0500556_0000032
780 Ga0500562_022315
781 Ga0500592_039049
782 Ga0500595_047582
783 Ga0500618_000288
784 Ga0500568_0000436
785 Ga0500573_0019147
786 Ga0500577_0200451
787 Ga0500604_0013943
788 Ga0500604_0044707
789 Ga0500616_0001946
790 Ga0500627_0055933
791 Ga0500627_0057995
792 Ga0500645_021094
793 Ga0587077_049169
794 Ga0587082_066232
795 Ga0501082_0156911
796 Ga0501082_0289033
797 Ga0501082_0784255
798 Ga0501082_1696594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

21

165

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t30-assembly1.cif.gz_H structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/nad(h) bound state 0.9147 8 77
7t30-assembly1.cif.gz_H structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/nad(h) bound state 0.8796 8 77
6vw7-assembly1.cif.gz_A formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound 0.8784 11 158
6vw7-assembly1.cif.gz_A formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound 0.8627 11 158
8e9i-assembly1.cif.gz_E mycobacterial respiratory complex i, semi-inserted quinone 0.8356 6 159
ID Description Score Start End Superfamily
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9568 76 156 3.40.30.10
af_P9WIV5_106_200_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9484 76 158 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9468 75 156 3.40.30.10
3i9v201 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9453 28 75 1.10.10.1590
af_A4HX94_128_234_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.938 76 158 3.40.30.10
ID Description Score Start End GO Terms
AF-Q07HL5-F1-model_v4 NADH dehydrogenase (Ubiquinone), 24 kDa subunit 0.9257 11 159 GO:0016491
GO:0046872
GO:0051537
AF-A0A1Q9ALM0-F1-model_v4 Formate dehydrogenase subunit gamma 0.9166 5 159 GO:0016491
GO:0046872
GO:0051537
AF-A0A7R7CQA4-F1-model_v4 Formate dehydrogenase subunit gamma 0.9156 3 159 GO:0016491
GO:0046872
GO:0051537
AF-Q6NBU6-F1-model_v4 Formate dehydrogenase subunit gamma (NAD-dependent formate dehydrogenase gamma subunit (EC 1.2.1.2)) 0.914 12 159 GO:0016491
GO:0046872
GO:0051537
AF-A0A7Z0WFJ8-F1-model_v4 Formate dehydrogenase subunit gamma 0.9139 8 159 GO:0016491
GO:0046872
GO:0051537

Map