F434271

General Info

Members Datasets Scaffolds Average Seq Length
399 231 798 107

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_101158228|Ga0075435_1011582282
Length 124
Sequence VSVYKFNSLVFSFHFFMLLSFQFMICYNITIKIDPQIEQEWIRWQREEHIPEVMASKLFSDYKFFKLLEQEESEGITYVVQYFSSSIGNYKKYINDFAPLLREKAFAKWGNRFVAFRTVMEVVN

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
132 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
133 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
156 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
157 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
158 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
159 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
160 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
161 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
162 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
178 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
179 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
180 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
181 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
182 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
183 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
184 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
185 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
186 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
187 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
188 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
189 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
190 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
191 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
192 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
193 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
194 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
195 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
196 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
199 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
200 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
203 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
207 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
208 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
209 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
210 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
211 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
220 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
221 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
222 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
225 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
226 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
229 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.01
Nodule 0
Rhizoplane 2.51
Rhizosphere 90.73
Stem 0
Stem Tuber 0
Unclassified 16.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_101158228 3300007076 Bacteria 676
2 JGI24751J29686_10000750 3300002459 Bacteria 7725
3 JGI25154J39366_1004687 3300002738 Bacteria 2372
4 rootL2_10196168 3300003322 Bacteria 1245
5 Ga0065704_10442489 3300005289 Bacteria 712
6 Ga0065704_10749489 3300005289 Unclassified 542
7 Ga0070683_100018015 3300005329 Bacteria 6246
8 Ga0070683_100023521 3300005329 Bacteria 5511
9 Ga0070690_100050854 3300005330 Unclassified 2644
10 Ga0070690_101180527 3300005330 Bacteria 610
11 Ga0070670_100058981 3300005331 Bacteria 3295
12 Ga0070670_100093855 3300005331 Bacteria 2581
13 Ga0070670_100518656 3300005331 Bacteria 1061
14 Ga0070670_100659559 3300005331 Bacteria 939
15 Ga0070677_10515642 3300005333 Bacteria 650
16 Ga0068869_100010401 3300005334 Bacteria 6069
17 Ga0068869_100043971 3300005334 Bacteria 3211
18 Ga0068869_100304517 3300005334 Bacteria 1288
19 Ga0068869_100308980 3300005334 Bacteria 1279
20 Ga0068869_101145009 3300005334 Bacteria 682
21 Ga0070666_10004841 3300005335 Bacteria 8229
22 Ga0070666_10721347 3300005335 Bacteria 732
23 Ga0070682_100460037 3300005337 Bacteria 977
24 Ga0068868_100083509 3300005338 Bacteria 2564
25 Ga0068868_100161840 3300005338 Bacteria 1849
26 Ga0068868_100315765 3300005338 Bacteria 1330
27 Ga0068868_101175220 3300005338 Bacteria 708
28 Ga0070660_101032183 3300005339 Bacteria 695
29 Ga0070689_100054594 3300005340 Bacteria 3093
30 Ga0070689_100142967 3300005340 Bacteria 1925
31 Ga0070689_100461057 3300005340 Unclassified 1083
32 Ga0070689_100576185 3300005340 Unclassified 972
33 Ga0070689_101301741 3300005340 Bacteria 654
34 Ga0070691_10787111 3300005341 Bacteria 578
35 Ga0070661_100001083 3300005344 Bacteria 19276
36 Ga0070661_100002297 3300005344 Bacteria 13123
37 Ga0070668_100947083 3300005347 Bacteria 772
38 Ga0070668_102155293 3300005347 Bacteria 515
39 Ga0070669_100552375 3300005353 Bacteria 960
40 Ga0070675_100047019 3300005354 Bacteria 3535
41 Ga0070675_100135579 3300005354 Unclassified 2101
42 Ga0070671_100065819 3300005355 Bacteria 3019
43 Ga0070671_100112743 3300005355 Unclassified 2285
44 Ga0070671_101487242 3300005355 Bacteria 599
45 Ga0070673_101324567 3300005364 Bacteria 677
46 Ga0070688_100026778 3300005365 Bacteria 3428
47 Ga0070688_100054600 3300005365 Bacteria 2503
48 Ga0070659_100002045 3300005366 Bacteria 14417
49 Ga0070659_100816517 3300005366 Bacteria 812
50 Ga0070667_100030751 3300005367 Bacteria 4478
51 Ga0070667_100031681 3300005367 Bacteria 4408
52 Ga0070667_100084464 3300005367 Unclassified 2721
53 Ga0070663_100014701 3300005455 Bacteria 5030
54 Ga0070663_101276829 3300005455 Bacteria 647
55 Ga0070663_101578738 3300005455 Bacteria 585
56 Ga0070678_100038203 3300005456 Bacteria 3378
57 Ga0070678_100562812 3300005456 Unclassified 1013
58 Ga0070662_100016163 3300005457 Bacteria 5008
59 Ga0070662_100017643 3300005457 Bacteria 4815
60 Ga0070662_100072719 3300005457 Bacteria 2539
61 Ga0070662_100350552 3300005457 Bacteria 1209
62 Ga0070662_100494559 3300005457 Bacteria 1019
63 Ga0070662_101181923 3300005457 Bacteria 657
64 Ga0068867_100065327 3300005459 Bacteria 2707
65 Ga0070679_100944493 3300005530 Bacteria 806
66 Ga0070684_100250045 3300005535 Bacteria 1620
67 Ga0070684_100443250 3300005535 Bacteria 1200
68 Ga0070684_101061455 3300005535 Bacteria 761
69 Ga0068853_100003955 3300005539 Bacteria 11385
70 Ga0068853_100196526 3300005539 Bacteria 1835
71 Ga0068853_100806083 3300005539 Bacteria 899
72 Ga0070672_100255524 3300005543 Bacteria 1477
73 Ga0070672_102115072 3300005543 Bacteria 507
74 Ga0070686_100018207 3300005544 Unclassified 4118
75 Ga0070686_100028097 3300005544 Bacteria 3409
76 Ga0070686_100217275 3300005544 Bacteria 1379
77 Ga0070665_100752441 3300005548 Unclassified 987
78 Ga0070665_100928587 3300005548 Unclassified 883
79 Ga0070664_100001057 3300005564 Bacteria 21659
80 Ga0070664_100045613 3300005564 Bacteria 3702
81 Ga0070664_100320395 3300005564 Bacteria 1404
82 Ga0070664_101816397 3300005564 Bacteria 578
83 Ga0068857_100000353 3300005577 Bacteria 31896
84 Ga0068857_100078546 3300005577 Bacteria 2946
85 Ga0068857_100313789 3300005577 Bacteria 1447
86 Ga0068854_100151498 3300005578 Bacteria 1789
87 Ga0068854_100631084 3300005578 Bacteria 918
88 Ga0068852_100012836 3300005616 Bacteria 6385
89 Ga0068859_100029400 3300005617 Bacteria 5513
90 Ga0068859_100063950 3300005617 Bacteria 3711
91 Ga0068859_100855891 3300005617 Bacteria 995
92 Ga0068864_100002568 3300005618 Bacteria 14986
93 Ga0068864_100013747 3300005618 Bacteria 6714
94 Ga0068864_100025199 3300005618 Bacteria 5007
95 Ga0068864_100260265 3300005618 Bacteria 1614
96 Ga0068866_10554918 3300005718 Unclassified 769
97 Ga0068866_10946907 3300005718 Bacteria 608
98 Ga0068861_100265378 3300005719 Bacteria 1472
99 Ga0068861_100533476 3300005719 Bacteria 1066
100 Ga0068861_100634308 3300005719 Bacteria 985
101 Ga0068861_101130713 3300005719 Bacteria 754
102 Ga0068851_10056505 3300005834 Bacteria 2002
103 Ga0068851_10364082 3300005834 Bacteria 844
104 Ga0068851_10711711 3300005834 Bacteria 619
105 Ga0068863_100662530 3300005841 Bacteria 1036
106 Ga0068863_100702050 3300005841 Unclassified 1005
107 Ga0068863_100709577 3300005841 Bacteria 1000
108 Ga0068863_101344772 3300005841 Unclassified 722
109 Ga0068858_100033964 3300005842 Bacteria 4732
110 Ga0068858_100298503 3300005842 Unclassified 1536
111 Ga0068860_100201831 3300005843 Bacteria 1927
112 Ga0068860_101660470 3300005843 Unclassified 661
113 Ga0068862_100020995 3300005844 Bacteria 5457
114 Ga0068862_101160672 3300005844 Bacteria 769
115 Ga0070715_10028945 3300006163 Bacteria 2227
116 Ga0075366_10030873 3300006195 Bacteria 3151
117 Ga0075366_10076179 3300006195 Bacteria 2002
118 Ga0075366_10131312 3300006195 Unclassified 1511
119 Ga0097621_100065849 3300006237 Unclassified 2983
120 Ga0097621_101092532 3300006237 Bacteria 748
121 Ga0097621_101163350 3300006237 Bacteria 726
122 Ga0068871_100133897 3300006358 Bacteria 2103
123 Ga0068871_100538519 3300006358 Bacteria 1056
124 Ga0068871_101763763 3300006358 Unclassified 587
125 Ga0068865_100456400 3300006881 Unclassified 1058
126 Ga0097620_100029399 3300006931 Bacteria 5513
127 Ga0097620_100063960 3300006931 Bacteria 3711
128 Ga0097620_100090037 3300006931 Bacteria 3119
129 Ga0097620_100856101 3300006931 Bacteria 995
130 Ga0105247_10004101 3300009101 Bacteria 9361
131 Ga0114129_10001062 3300009147 Bacteria 36084
132 Ga0105241_10355627 3300009174 Bacteria 1273
133 Ga0105241_11946205 3300009174 Bacteria 577
134 Ga0105242_13170194 3300009176 Unclassified 510
135 Ga0105242_13181273 3300009176 Unclassified 510
136 Ga0105248_13035068 3300009177 Bacteria 535
137 Ga0105249_10001056 3300009553 Bacteria 24413
138 Ga0105249_10007493 3300009553 Bacteria 9521
139 Ga0105249_10141265 3300009553 Bacteria 2309
140 Ga0105249_11293833 3300009553 Bacteria 801
141 Ga0105239_10020600 3300010375 Bacteria 7276
142 Ga0105239_10175981 3300010375 Bacteria 2393
143 Ga0105239_11603495 3300010375 Bacteria 753
144 Ga0105246_10644466 3300011119 Bacteria 921
145 Ga0157373_10557628 3300013100 Bacteria 831
146 Ga0157371_10320881 3300013102 Bacteria 1124
147 Ga0157370_10006839 3300013104 Bacteria 12493
148 Ga0157374_10003629 3300013296 Bacteria 12978
149 Ga0157374_10004535 3300013296 Bacteria 11663
150 Ga0157374_10037158 3300013296 Bacteria 4467
151 Ga0157374_10392549 3300013296 Bacteria 1383
152 Ga0157378_10176605 3300013297 Bacteria 2007
153 Ga0157378_10705307 3300013297 Bacteria 1029
154 Ga0157378_11358538 3300013297 Bacteria 753
155 Ga0163162_10050333 3300013306 Bacteria 4178
156 Ga0163162_10175254 3300013306 Bacteria 2270
157 Ga0163162_10208151 3300013306 Bacteria 2085
158 Ga0163162_10796704 3300013306 Unclassified 1062
159 Ga0157372_10165710 3300013307 Bacteria 2555
160 Ga0157372_10851737 3300013307 Bacteria 1058
161 Ga0157372_11392009 3300013307 Unclassified 809
162 Ga0157372_13461930 3300013307 Unclassified 502
163 Ga0157375_10006789 3300013308 Bacteria 9967
164 Ga0157375_10469584 3300013308 Bacteria 1423
165 Ga0157375_10496200 3300013308 Unclassified 1385
166 Ga0157375_13817367 3300013308 Bacteria 500
167 Ga0163163_10000362 3300014325 Bacteria 43575
168 Ga0163163_10066676 3300014325 Bacteria 3576
169 Ga0163163_10094168 3300014325 Bacteria 3013
170 Ga0163163_10789046 3300014325 Bacteria 1013
171 Ga0157380_10842423 3300014326 Unclassified 938
172 Ga0157380_11614633 3300014326 Unclassified 704
173 Ga0157377_10015439 3300014745 Bacteria 3908
174 Ga0157377_10305882 3300014745 Unclassified 1051
175 Ga0157379_10064441 3300014968 Bacteria 3275
176 Ga0157379_10144906 3300014968 Bacteria 2142
177 Ga0157379_10704170 3300014968 Unclassified 948
178 Ga0157379_11027822 3300014968 Unclassified 787
179 Ga0157376_10062961 3300014969 Bacteria 3123
180 Ga0157376_10399979 3300014969 Bacteria 1328
181 Ga0157376_11090617 3300014969 Unclassified 824
182 Ga0163161_10006312 3300017792 Bacteria 8204
183 Ga0209258_111170 3300025242 Bacteria 1141
184 Ga0209646_1001778 3300025246 Bacteria 5402
185 Ga0207697_10022873 3300025315 Bacteria 2560
186 Ga0207697_10181386 3300025315 Bacteria 923
187 Ga0207713_1072521 3300025735 Bacteria 1267
188 Ga0207682_10133372 3300025893 Bacteria 1110
189 Ga0207710_10002364 3300025900 Bacteria 8816
190 Ga0207680_10018421 3300025903 Bacteria 3711
191 Ga0207647_10085451 3300025904 Bacteria 1887
192 Ga0207647_10243982 3300025904 Unclassified 1031
193 Ga0207685_10315843 3300025905 Unclassified 778
194 Ga0207643_10701792 3300025908 Bacteria 654
195 Ga0207657_10258928 3300025919 Bacteria 1385
196 Ga0207657_10805795 3300025919 Unclassified 726
197 Ga0207649_10023892 3300025920 Bacteria 3545
198 Ga0207649_10039206 3300025920 Unclassified 2871
199 Ga0207646_10721306 3300025922 Unclassified 891
200 Ga0207681_10488295 3300025923 Bacteria 1007
201 Ga0207681_10581066 3300025923 Bacteria 924
202 Ga0207681_11831415 3300025923 Bacteria 506
203 Ga0207650_10012500 3300025925 Bacteria 5861
204 Ga0207650_10384167 3300025925 Unclassified 1160
205 Ga0207650_10468816 3300025925 Bacteria 1050
206 Ga0207659_10012438 3300025926 Bacteria 5416
207 Ga0207659_11146824 3300025926 Bacteria 668
208 Ga0207644_10139564 3300025931 Unclassified 1865
209 Ga0207644_10524107 3300025931 Bacteria 979
210 Ga0207690_10019936 3300025932 Bacteria 4135
211 Ga0207690_10185165 3300025932 Bacteria 1571
212 Ga0207706_10007535 3300025933 Bacteria 10072
213 Ga0207706_10069608 3300025933 Bacteria 3095
214 Ga0207706_10457688 3300025933 Bacteria 1103
215 Ga0207706_10846511 3300025933 Bacteria 775
216 Ga0207686_10050270 3300025934 Bacteria 2592
217 Ga0207670_10049396 3300025936 Bacteria 2814
218 Ga0207670_10101029 3300025936 Bacteria 2060
219 Ga0207670_10258312 3300025936 Bacteria 1349
220 Ga0207670_11902198 3300025936 Bacteria 506
221 Ga0207704_10023663 3300025938 Bacteria 3314
222 Ga0207691_10198021 3300025940 Bacteria 1749
223 Ga0207691_11721708 3300025940 Bacteria 507
224 Ga0207689_10002498 3300025942 Bacteria 17089
225 Ga0207661_10018507 3300025944 Bacteria 5175
226 Ga0207661_10046947 3300025944 Bacteria 3426
227 Ga0207661_11200177 3300025944 Bacteria 698
228 Ga0207679_10005758 3300025945 Bacteria 7780
229 Ga0207679_10013265 3300025945 Bacteria 5400
230 Ga0207667_10770855 3300025949 Bacteria 960
231 Ga0207651_11721741 3300025960 Bacteria 564
232 Ga0207712_10003635 3300025961 Bacteria 9725
233 Ga0207712_10010167 3300025961 Bacteria 5966
234 Ga0207712_10254640 3300025961 Bacteria 1421
235 Ga0207668_11102429 3300025972 Bacteria 712
236 Ga0207658_10070573 3300025986 Bacteria 2643
237 Ga0207658_10427447 3300025986 Bacteria 1169
238 Ga0207658_10802565 3300025986 Bacteria 854
239 Ga0207677_10036276 3300026023 Bacteria 3212
240 Ga0207677_10514426 3300026023 Bacteria 1037
241 Ga0207703_10197331 3300026035 Bacteria 1786
242 Ga0207703_10244928 3300026035 Bacteria 1613
243 Ga0207639_10001459 3300026041 Bacteria 15922
244 Ga0207639_11022993 3300026041 Bacteria 774
245 Ga0207678_10015687 3300026067 Bacteria 6657
246 Ga0207678_10158043 3300026067 Bacteria 1936
247 Ga0207641_10080039 3300026088 Bacteria 2834
248 Ga0207641_10498616 3300026088 Bacteria 1182
249 Ga0207641_10651516 3300026088 Unclassified 1034
250 Ga0207641_11076057 3300026088 Bacteria 802
251 Ga0207648_10022524 3300026089 Bacteria 5654
252 Ga0207676_10018820 3300026095 Bacteria 5028
253 Ga0207676_10020355 3300026095 Bacteria 4854
254 Ga0207676_10052476 3300026095 Bacteria 3188
255 Ga0207676_10054249 3300026095 Bacteria 3141
256 Ga0207674_10008703 3300026116 Bacteria 11683
257 Ga0207674_10009802 3300026116 Bacteria 10908
258 Ga0207674_10066328 3300026116 Bacteria 3636
259 Ga0207675_100033909 3300026118 Bacteria 4758
260 Ga0207675_100337592 3300026118 Bacteria 1474
261 Ga0207675_100749666 3300026118 Unclassified 988
262 Ga0207675_101356649 3300026118 Bacteria 732
263 Ga0207675_101877960 3300026118 Bacteria 618
264 Ga0207683_10001651 3300026121 Bacteria 19982
265 Ga0207698_10011140 3300026142 Bacteria 5815
266 Ga0207698_10690837 3300026142 Bacteria 1014
267 Ga0268266_10002468 3300028379 Bacteria 19775
268 Ga0268266_10135701 3300028379 Unclassified 2204
269 Ga0268266_10553180 3300028379 Unclassified 1103
270 Ga0268266_10908971 3300028379 Bacteria 851
271 Ga0268265_10061178 3300028380 Bacteria 2889
272 Ga0268265_10752916 3300028380 Bacteria 946
273 Ga0268265_10821595 3300028380 Bacteria 907
274 Ga0268264_10242611 3300028381 Bacteria 1670
275 Ga0268264_10508110 3300028381 Unclassified 1176
276 Ga0265338_10067291 3300028800 Bacteria 3095
277 Ga0265320_10557966 3300031240 Unclassified 506
278 Ga0265325_10269761 3300031241 Bacteria 766
279 Ga0307513_10158011 3300031456 Bacteria 2164
280 Ga0307513_10257499 3300031456 Bacteria 1537
281 Ga0265314_10017944 3300031711 Bacteria 5538
282 Ga0307516_10709895 3300031730 Unclassified 663
283 Ga0307405_10922784 3300031731 Bacteria 740
284 Ga0307414_10223639 3300032004 Bacteria 1547
285 Ga0373931_0490711 3300035691 Bacteria 791
286 Ga0451787_702492 3300041441 Bacteria 637
287 Ga0451789_0788166 3300041443 Bacteria 551
288 Ga0451802_2194494 3300041460 Bacteria 949
289 Ga0451807_0396408 3300041486 Bacteria 590
290 Ga0451807_2658811 3300041486 Bacteria 695
291 Ga0451853_0151413 3300041512 Bacteria 813
292 Ga0439445_0079514 3300042004 Bacteria 915
293 Ga0466969_0000190 3300044656 Bacteria 33133
294 Ga0466972_0000676 3300044658 Bacteria 16399
295 Ga0466972_0169401 3300044658 Bacteria 1025
296 Ga0453683_0511097 3300044673 Unclassified 780
297 Ga0466966_0036809 3300044684 Bacteria 3158
298 Ga0466964_0019940 3300044706 Bacteria 2580
299 Ga0466968_0054956 3300044735 Bacteria 1708
300 Ga0466970_0109216 3300044765 Bacteria 1510
301 Ga0466957_0001546 3300044842 Bacteria 12103
302 Ga0466957_0001652 3300044842 Bacteria 11702
303 Ga0466959_0000003 3300045049 Bacteria 285164
304 Ga0495638_0256427 3300046460 Bacteria 962
305 Ga0495580_0154465 3300046472 Bacteria 1590
306 Ga0495598_0200778 3300046537 Bacteria 720
307 Ga0495611_0017346 3300046648 Bacteria 3080
308 Ga0495686_0053608 3300047472 Bacteria 2527
309 Ga0495686_0093581 3300047472 Unclassified 1822
310 Ga0496108_0225552 3300048911 Bacteria 1629
311 Ga0496109_0403134 3300048912 Bacteria 1292
312 Ga0496109_1845901 3300048912 Bacteria 537
313 Ga0496110_0110698 3300048913 Bacteria 2468
314 Ga0496111_0841611 3300048914 Bacteria 663
315 Ga0501290_005076 3300049513 Bacteria 1644
316 Ga0501291_011118 3300049514 Bacteria 1292
317 Ga0501293_001103 3300049516 Bacteria 2032
318 Ga0501294_020925 3300049517 Bacteria 708
319 Ga0501297_001662 3300049520 Unclassified 2073
320 Ga0501298_000437 3300049521 Bacteria 5608
321 Ga0501299_002367 3300049522 Unclassified 2603
322 Ga0501302_018787 3300049525 Bacteria 580
323 Ga0501031_0478884 3300049568 Bacteria 803
324 Ga0501032_0010324 3300049569 Bacteria 6737
325 Ga0501034_0035864 3300049571 Bacteria 5028
326 Ga0501034_1553372 3300049571 Unclassified 535
327 Ga0501036_0022006 3300049572 Bacteria 5361
328 Ga0501037_0800176 3300049573 Bacteria 622
329 Ga0501038_0015262 3300049574 Bacteria 6984
330 Ga0501043_0010690 3300049579 Bacteria 7189
331 Ga0501046_0016366 3300049580 Bacteria 6212
332 Ga0501047_0009030 3300049581 Bacteria 9412
333 Ga0501047_0054326 3300049581 Bacteria 3874
334 Ga0501047_0123032 3300049581 Bacteria 2475
335 Ga0501048_0023532 3300049582 Bacteria 4501
336 Ga0501068_0457107 3300049584 Bacteria 826
337 Ga0501070_0006613 3300049586 Bacteria 9866
338 Ga0501073_0027520 3300049589 Bacteria 4065
339 Ga0501074_0012286 3300049590 Bacteria 6224
340 Ga0501198_013268 3300049649 Unclassified 1245
341 Ga0501201_001297 3300049651 Unclassified 2347
342 Ga0501202_000691 3300049652 Bacteria 5040
343 Ga0501206_003172 3300049653 Unclassified 2089
344 Ga0501207_004189 3300049654 Unclassified 1953
345 Ga0501209_034270 3300049656 Unclassified 1308
346 Ga0501217_004605 3300049661 Bacteria 2841
347 Ga0501222_002938 3300049662 Bacteria 2349
348 Ga0501223_009458 3300049663 Unclassified 1974
349 Ga0501224_001681 3300049664 Bacteria 2968
350 Ga0501228_003371 3300049666 Unclassified 1314
351 Ga0501233_016480 3300049668 Bacteria 1533
352 Ga0501235_000263 3300049669 Bacteria 9693
353 Ga0501236_025385 3300049670 Bacteria 906
354 Ga0501240_008996 3300049673 Bacteria 1295
355 Ga0501242_029557 3300049674 Bacteria 736
356 Ga0501243_002654 3300049675 Bacteria 2632
357 Ga0501250_001574 3300049680 Unclassified 1919
358 Ga0501251_004151 3300049681 Unclassified 1482
359 Ga0501252_007600 3300049682 Unclassified 1230
360 Ga0501257_010077 3300049686 Bacteria 2140
361 Ga0501259_001694 3300049688 Bacteria 3663
362 Ga0501261_002954 3300049690 Bacteria 2089
363 Ga0501221_003714 3300049704 Bacteria 2517
364 Ga0501225_0011772 3300049705 Bacteria 2460
365 Ga0501234_027072 3300049707 Bacteria 921
366 Ga0501245_002688 3300049708 Bacteria 2381
367 Ga0501080_0164554 3300049742 Bacteria 2047
368 Ga0501083_0042934 3300049744 Bacteria 3064
369 Ga0501264_016787 3300049761 Bacteria 748
370 Ga0501266_005834 3300049763 Unclassified 1530
371 Ga0501267_002495 3300049764 Unclassified 1645
372 Ga0501270_036820 3300049767 Unclassified 835
373 Ga0501279_006885 3300049775 Unclassified 1505
374 Ga0501283_110782 3300049779 Bacteria 542
375 Ga0501035_0043191 3300049822 Bacteria 4063
376 Ga0501044_0068107 3300049823 Bacteria 3626
377 Ga0501044_0073906 3300049823 Bacteria 3464
378 Ga0501045_0057147 3300049824 Bacteria 2855
379 Ga0501212_014226 3300049851 Unclassified 1175
380 nmdc:mga0k408_148265_c1 3300050493 Unclassified 1397
381 nmdc:mga0k408_26107_c1 3300050493 Bacteria 3311
382 nmdc:mga0k408_40819_c1 3300050493 Bacteria 2671
383 nmdc:mga0k408_828811_c1 3300050493 Bacteria 538
384 nmdc:mga05p37_482_c1 3300050507 Bacteria 43621
385 nmdc:mga0rr50_1756715_c1 3300050513 Bacteria 522
386 Ga0500578_0001568 3300053086 Bacteria 22320
387 Ga0500578_0091390 3300053086 Bacteria 1931
388 Ga0500556_0090817 3300053104 Bacteria 1166
389 Ga0500572_158948 3300053111 Bacteria 739
390 Ga0500642_0157466 3300053130 Bacteria 1065
391 Ga0500568_0000208 3300053139 Bacteria 51266
392 Ga0500585_141010 3300053144 Bacteria 848
393 Ga0500603_005882 3300053150 Bacteria 2656
394 Ga0500604_0319674 3300053151 Bacteria 539
395 Ga0500616_0116592 3300053153 Bacteria 1282
396 Ga0500584_176127 3300053726 Bacteria 756
397 Ga0500611_000001 3300053727 Bacteria 385744
398 Ga0501084_0193878 3300054114 Bacteria 1714
399 Ga0501082_0212638 3300060353 Bacteria 1682
400 Ga0075435_101158228
401 JGI24751J29686_10000750
402 JGI25154J39366_1004687
403 rootL2_10196168
404 Ga0065704_10442489
405 Ga0065704_10749489
406 Ga0070683_100018015
407 Ga0070683_100023521
408 Ga0070690_100050854
409 Ga0070690_101180527
410 Ga0070670_100058981
411 Ga0070670_100093855
412 Ga0070670_100518656
413 Ga0070670_100659559
414 Ga0070677_10515642
415 Ga0068869_100010401
416 Ga0068869_100043971
417 Ga0068869_100304517
418 Ga0068869_100308980
419 Ga0068869_101145009
420 Ga0070666_10004841
421 Ga0070666_10721347
422 Ga0070682_100460037
423 Ga0068868_100083509
424 Ga0068868_100161840
425 Ga0068868_100315765
426 Ga0068868_101175220
427 Ga0070660_101032183
428 Ga0070689_100054594
429 Ga0070689_100142967
430 Ga0070689_100461057
431 Ga0070689_100576185
432 Ga0070689_101301741
433 Ga0070691_10787111
434 Ga0070661_100001083
435 Ga0070661_100002297
436 Ga0070668_100947083
437 Ga0070668_102155293
438 Ga0070669_100552375
439 Ga0070675_100047019
440 Ga0070675_100135579
441 Ga0070671_100065819
442 Ga0070671_100112743
443 Ga0070671_101487242
444 Ga0070673_101324567
445 Ga0070688_100026778
446 Ga0070688_100054600
447 Ga0070659_100002045
448 Ga0070659_100816517
449 Ga0070667_100030751
450 Ga0070667_100031681
451 Ga0070667_100084464
452 Ga0070663_100014701
453 Ga0070663_101276829
454 Ga0070663_101578738
455 Ga0070678_100038203
456 Ga0070678_100562812
457 Ga0070662_100016163
458 Ga0070662_100017643
459 Ga0070662_100072719
460 Ga0070662_100350552
461 Ga0070662_100494559
462 Ga0070662_101181923
463 Ga0068867_100065327
464 Ga0070679_100944493
465 Ga0070684_100250045
466 Ga0070684_100443250
467 Ga0070684_101061455
468 Ga0068853_100003955
469 Ga0068853_100196526
470 Ga0068853_100806083
471 Ga0070672_100255524
472 Ga0070672_102115072
473 Ga0070686_100018207
474 Ga0070686_100028097
475 Ga0070686_100217275
476 Ga0070665_100752441
477 Ga0070665_100928587
478 Ga0070664_100001057
479 Ga0070664_100045613
480 Ga0070664_100320395
481 Ga0070664_101816397
482 Ga0068857_100000353
483 Ga0068857_100078546
484 Ga0068857_100313789
485 Ga0068854_100151498
486 Ga0068854_100631084
487 Ga0068852_100012836
488 Ga0068859_100029400
489 Ga0068859_100063950
490 Ga0068859_100855891
491 Ga0068864_100002568
492 Ga0068864_100013747
493 Ga0068864_100025199
494 Ga0068864_100260265
495 Ga0068866_10554918
496 Ga0068866_10946907
497 Ga0068861_100265378
498 Ga0068861_100533476
499 Ga0068861_100634308
500 Ga0068861_101130713
501 Ga0068851_10056505
502 Ga0068851_10364082
503 Ga0068851_10711711
504 Ga0068863_100662530
505 Ga0068863_100702050
506 Ga0068863_100709577
507 Ga0068863_101344772
508 Ga0068858_100033964
509 Ga0068858_100298503
510 Ga0068860_100201831
511 Ga0068860_101660470
512 Ga0068862_100020995
513 Ga0068862_101160672
514 Ga0070715_10028945
515 Ga0075366_10030873
516 Ga0075366_10076179
517 Ga0075366_10131312
518 Ga0097621_100065849
519 Ga0097621_101092532
520 Ga0097621_101163350
521 Ga0068871_100133897
522 Ga0068871_100538519
523 Ga0068871_101763763
524 Ga0068865_100456400
525 Ga0097620_100029399
526 Ga0097620_100063960
527 Ga0097620_100090037
528 Ga0097620_100856101
529 Ga0105247_10004101
530 Ga0114129_10001062
531 Ga0105241_10355627
532 Ga0105241_11946205
533 Ga0105242_13170194
534 Ga0105242_13181273
535 Ga0105248_13035068
536 Ga0105249_10001056
537 Ga0105249_10007493
538 Ga0105249_10141265
539 Ga0105249_11293833
540 Ga0105239_10020600
541 Ga0105239_10175981
542 Ga0105239_11603495
543 Ga0105246_10644466
544 Ga0157373_10557628
545 Ga0157371_10320881
546 Ga0157370_10006839
547 Ga0157374_10003629
548 Ga0157374_10004535
549 Ga0157374_10037158
550 Ga0157374_10392549
551 Ga0157378_10176605
552 Ga0157378_10705307
553 Ga0157378_11358538
554 Ga0163162_10050333
555 Ga0163162_10175254
556 Ga0163162_10208151
557 Ga0163162_10796704
558 Ga0157372_10165710
559 Ga0157372_10851737
560 Ga0157372_11392009
561 Ga0157372_13461930
562 Ga0157375_10006789
563 Ga0157375_10469584
564 Ga0157375_10496200
565 Ga0157375_13817367
566 Ga0163163_10000362
567 Ga0163163_10066676
568 Ga0163163_10094168
569 Ga0163163_10789046
570 Ga0157380_10842423
571 Ga0157380_11614633
572 Ga0157377_10015439
573 Ga0157377_10305882
574 Ga0157379_10064441
575 Ga0157379_10144906
576 Ga0157379_10704170
577 Ga0157379_11027822
578 Ga0157376_10062961
579 Ga0157376_10399979
580 Ga0157376_11090617
581 Ga0163161_10006312
582 Ga0209258_111170
583 Ga0209646_1001778
584 Ga0207697_10022873
585 Ga0207697_10181386
586 Ga0207713_1072521
587 Ga0207682_10133372
588 Ga0207710_10002364
589 Ga0207680_10018421
590 Ga0207647_10085451
591 Ga0207647_10243982
592 Ga0207685_10315843
593 Ga0207643_10701792
594 Ga0207657_10258928
595 Ga0207657_10805795
596 Ga0207649_10023892
597 Ga0207649_10039206
598 Ga0207646_10721306
599 Ga0207681_10488295
600 Ga0207681_10581066
601 Ga0207681_11831415
602 Ga0207650_10012500
603 Ga0207650_10384167
604 Ga0207650_10468816
605 Ga0207659_10012438
606 Ga0207659_11146824
607 Ga0207644_10139564
608 Ga0207644_10524107
609 Ga0207690_10019936
610 Ga0207690_10185165
611 Ga0207706_10007535
612 Ga0207706_10069608
613 Ga0207706_10457688
614 Ga0207706_10846511
615 Ga0207686_10050270
616 Ga0207670_10049396
617 Ga0207670_10101029
618 Ga0207670_10258312
619 Ga0207670_11902198
620 Ga0207704_10023663
621 Ga0207691_10198021
622 Ga0207691_11721708
623 Ga0207689_10002498
624 Ga0207661_10018507
625 Ga0207661_10046947
626 Ga0207661_11200177
627 Ga0207679_10005758
628 Ga0207679_10013265
629 Ga0207667_10770855
630 Ga0207651_11721741
631 Ga0207712_10003635
632 Ga0207712_10010167
633 Ga0207712_10254640
634 Ga0207668_11102429
635 Ga0207658_10070573
636 Ga0207658_10427447
637 Ga0207658_10802565
638 Ga0207677_10036276
639 Ga0207677_10514426
640 Ga0207703_10197331
641 Ga0207703_10244928
642 Ga0207639_10001459
643 Ga0207639_11022993
644 Ga0207678_10015687
645 Ga0207678_10158043
646 Ga0207641_10080039
647 Ga0207641_10498616
648 Ga0207641_10651516
649 Ga0207641_11076057
650 Ga0207648_10022524
651 Ga0207676_10018820
652 Ga0207676_10020355
653 Ga0207676_10052476
654 Ga0207676_10054249
655 Ga0207674_10008703
656 Ga0207674_10009802
657 Ga0207674_10066328
658 Ga0207675_100033909
659 Ga0207675_100337592
660 Ga0207675_100749666
661 Ga0207675_101356649
662 Ga0207675_101877960
663 Ga0207683_10001651
664 Ga0207698_10011140
665 Ga0207698_10690837
666 Ga0268266_10002468
667 Ga0268266_10135701
668 Ga0268266_10553180
669 Ga0268266_10908971
670 Ga0268265_10061178
671 Ga0268265_10752916
672 Ga0268265_10821595
673 Ga0268264_10242611
674 Ga0268264_10508110
675 Ga0265338_10067291
676 Ga0265320_10557966
677 Ga0265325_10269761
678 Ga0307513_10158011
679 Ga0307513_10257499
680 Ga0265314_10017944
681 Ga0307516_10709895
682 Ga0307405_10922784
683 Ga0307414_10223639
684 Ga0373931_0490711
685 Ga0451787_702492
686 Ga0451789_0788166
687 Ga0451802_2194494
688 Ga0451807_0396408
689 Ga0451807_2658811
690 Ga0451853_0151413
691 Ga0439445_0079514
692 Ga0466969_0000190
693 Ga0466972_0000676
694 Ga0466972_0169401
695 Ga0453683_0511097
696 Ga0466966_0036809
697 Ga0466964_0019940
698 Ga0466968_0054956
699 Ga0466970_0109216
700 Ga0466957_0001546
701 Ga0466957_0001652
702 Ga0466959_0000003
703 Ga0495638_0256427
704 Ga0495580_0154465
705 Ga0495598_0200778
706 Ga0495611_0017346
707 Ga0495686_0053608
708 Ga0495686_0093581
709 Ga0496108_0225552
710 Ga0496109_0403134
711 Ga0496109_1845901
712 Ga0496110_0110698
713 Ga0496111_0841611
714 Ga0501290_005076
715 Ga0501291_011118
716 Ga0501293_001103
717 Ga0501294_020925
718 Ga0501297_001662
719 Ga0501298_000437
720 Ga0501299_002367
721 Ga0501302_018787
722 Ga0501031_0478884
723 Ga0501032_0010324
724 Ga0501034_0035864
725 Ga0501034_1553372
726 Ga0501036_0022006
727 Ga0501037_0800176
728 Ga0501038_0015262
729 Ga0501043_0010690
730 Ga0501046_0016366
731 Ga0501047_0009030
732 Ga0501047_0054326
733 Ga0501047_0123032
734 Ga0501048_0023532
735 Ga0501068_0457107
736 Ga0501070_0006613
737 Ga0501073_0027520
738 Ga0501074_0012286
739 Ga0501198_013268
740 Ga0501201_001297
741 Ga0501202_000691
742 Ga0501206_003172
743 Ga0501207_004189
744 Ga0501209_034270
745 Ga0501217_004605
746 Ga0501222_002938
747 Ga0501223_009458
748 Ga0501224_001681
749 Ga0501228_003371
750 Ga0501233_016480
751 Ga0501235_000263
752 Ga0501236_025385
753 Ga0501240_008996
754 Ga0501242_029557
755 Ga0501243_002654
756 Ga0501250_001574
757 Ga0501251_004151
758 Ga0501252_007600
759 Ga0501257_010077
760 Ga0501259_001694
761 Ga0501261_002954
762 Ga0501221_003714
763 Ga0501225_0011772
764 Ga0501234_027072
765 Ga0501245_002688
766 Ga0501080_0164554
767 Ga0501083_0042934
768 Ga0501264_016787
769 Ga0501266_005834
770 Ga0501267_002495
771 Ga0501270_036820
772 Ga0501279_006885
773 Ga0501283_110782
774 Ga0501035_0043191
775 Ga0501044_0068107
776 Ga0501044_0073906
777 Ga0501045_0057147
778 Ga0501212_014226
779 nmdc:mga0k408_148265_c1
780 nmdc:mga0k408_26107_c1
781 nmdc:mga0k408_40819_c1
782 nmdc:mga0k408_828811_c1
783 nmdc:mga05p37_482_c1
784 nmdc:mga0rr50_1756715_c1
785 Ga0500578_0001568
786 Ga0500578_0091390
787 Ga0500556_0090817
788 Ga0500572_158948
789 Ga0500642_0157466
790 Ga0500568_0000208
791 Ga0500585_141010
792 Ga0500603_005882
793 Ga0500604_0319674
794 Ga0500616_0116592
795 Ga0500584_176127
796 Ga0500611_000001
797 Ga0501084_0193878
798 Ga0501082_0212638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14114

DUF4286

Domain of unknown function (DUF4286)

24

123

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2od6-assembly2.cif.gz_C crystal structure of a dimeric ferredoxin-like protein (jcvi_pep_1096682647733) from uncultured marine organism at 1.85 a resolution 0.7842 2 101
2od6-assembly2.cif.gz_C crystal structure of a dimeric ferredoxin-like protein (jcvi_pep_1096682647733) from uncultured marine organism at 1.85 a resolution 0.7709 2 101
6fxd-assembly1.cif.gz_B-2 crystal structure of mupz from pseudomonas fluorescens 0.7701 2 96
1iuj-assembly1.cif.gz_B the structure of tt1380 protein from thermus thermophilus 0.7577 1 101
2fb0-assembly1.cif.gz_A-2 crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase 0.7523 2 97
ID Description Score Start End Superfamily
af_Q54JF5_9_115_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.864 4 99 3.30.70.100
af_Q54JF5_9_115_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8178 4 99 3.30.70.100
2od4A01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7908 1 98 3.30.70.100
2od4A01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7828 1 98 3.30.70.100
af_P9WLA3_28_227_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7468 2 100 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A519NJ29-F1-model_v4 DUF4286 family protein 0.9898 2 101
AF-A0A1M4ZTR4-F1-model_v4 DUF4286 domain-containing protein 0.9859 2 101
AF-A0A1M6NPT2-F1-model_v4 DUF4286 domain-containing protein 0.9817 1 101
AF-A0A0E9MWL9-F1-model_v4 DUF4286 domain-containing protein 0.9812 1 101
AF-A0A512RHV2-F1-model_v4 DUF4286 domain-containing protein 0.9809 1 100

Map