F434342

General Info

Members Datasets Scaffolds Average Seq Length
399 224 798 138

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0068542|Ga0436361_0068542_3113_3589
Length 158
Sequence VSLVLDSSVTLAWIYSEETTEPIRQVFYAVAEHGATVPTLWRLEVANSLTVAVRRGRIDADFRSAALADLALLDITTVPHNDSLAWGQTLALADRFRLTVYDAAYLELAQRRALPLATLDEELGAAAAGLGLPVLGAWSCRVKCFQPRCGRLERFRLQ

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
218 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2643221688 Rhizobium sp. Root482 Isolate Unclassified
224 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 1.25
Rhizosphere 92.73
Stem 0
Stem Tuber 0
Unclassified 24.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0068542 3300039447 Bacteria 6137
2 JGI24739J22299_10158714 3300001989 Unclassified 668
3 JGI25406J46586_10090358 3300003203 Bacteria 925
4 rootH2_10029865 3300003320 Bacteria 8334
5 Ga0065707_10862061 3300005295 Unclassified 578
6 Ga0070683_100055159 3300005329 Bacteria 3687
7 Ga0068868_100941283 3300005338 Bacteria 787
8 Ga0070689_101724789 3300005340 Unclassified 570
9 Ga0070691_10116630 3300005341 Bacteria 1340
10 Ga0070668_100378131 3300005347 Bacteria 1205
11 Ga0070669_100616534 3300005353 Bacteria 910
12 Ga0070669_101099789 3300005353 Bacteria 684
13 Ga0070675_100557974 3300005354 Unclassified 1036
14 Ga0070671_100096151 3300005355 Bacteria 2483
15 Ga0070673_100703377 3300005364 Bacteria 928
16 Ga0070659_100030039 3300005366 Bacteria 4204
17 Ga0070659_100257917 3300005366 Bacteria 1446
18 Ga0070709_10179957 3300005434 Bacteria 1484
19 Ga0070709_11518283 3300005434 Unclassified 544
20 Ga0070713_100993514 3300005436 Unclassified 809
21 Ga0070711_100297988 3300005439 Unclassified 1281
22 Ga0070708_100122006 3300005445 Bacteria 2405
23 Ga0070708_100183799 3300005445 Bacteria 1954
24 Ga0070663_101155269 3300005455 Bacteria 679
25 Ga0070678_100517247 3300005456 Bacteria 1055
26 Ga0070681_10036931 3300005458 Bacteria 4903
27 Ga0070681_10711332 3300005458 Unclassified 920
28 Ga0070706_100034834 3300005467 Bacteria 4649
29 Ga0070706_100687185 3300005467 Unclassified 949
30 Ga0070707_100049507 3300005468 Bacteria 4028
31 Ga0070707_100346556 3300005468 Bacteria 1443
32 Ga0070707_100802104 3300005468 Bacteria 905
33 Ga0070698_100001583 3300005471 Bacteria 25310
34 Ga0070698_100258569 3300005471 Bacteria 1673
35 Ga0070698_101197412 3300005471 Unclassified 709
36 Ga0070699_100023052 3300005518 Bacteria 5364
37 Ga0070699_100085084 3300005518 Bacteria 2760
38 Ga0070679_100047219 3300005530 Bacteria 4292
39 Ga0070679_100381643 3300005530 Bacteria 1356
40 Ga0070697_100157917 3300005536 Bacteria 1915
41 Ga0070697_100241047 3300005536 Bacteria 1544
42 Ga0070697_100835111 3300005536 Unclassified 816
43 Ga0068853_100002914 3300005539 Bacteria 13010
44 Ga0070695_100016221 3300005545 Bacteria 4507
45 Ga0070696_100076409 3300005546 Bacteria 2365
46 Ga0070696_100305496 3300005546 Unclassified 1220
47 Ga0070696_101981342 3300005546 Bacteria 505
48 Ga0070704_100025546 3300005549 Bacteria 3890
49 Ga0068855_100006956 3300005563 Bacteria 13727
50 Ga0068855_100016628 3300005563 Bacteria 8844
51 Ga0068855_100112989 3300005563 Bacteria 3117
52 Ga0068855_100481442 3300005563 Bacteria 1351
53 Ga0070664_100840607 3300005564 Unclassified 859
54 Ga0068856_100026569 3300005614 Bacteria 5645
55 Ga0068856_100050272 3300005614 Bacteria 4110
56 Ga0068856_100722518 3300005614 Unclassified 1016
57 Ga0068852_100252113 3300005616 Bacteria 1691
58 Ga0068859_100737045 3300005617 Bacteria 1075
59 Ga0068866_10851934 3300005718 Unclassified 637
60 Ga0068861_102073903 3300005719 Bacteria 568
61 Ga0068858_101296680 3300005842 Bacteria 717
62 Ga0068860_101174877 3300005843 Unclassified 787
63 Ga0081455_10085143 3300005937 Bacteria 2578
64 Ga0081538_10016756 3300005981 Bacteria 5601
65 Ga0081539_10000090 3300005985 Bacteria 212006
66 Ga0081539_10011328 3300005985 Bacteria 7074
67 Ga0081539_10185062 3300005985 Unclassified 974
68 Ga0070717_10730510 3300006028 Bacteria 900
69 Ga0070712_100343875 3300006175 Bacteria 1219
70 Ga0075369_10160870 3300006186 Unclassified 1029
71 Ga0097621_101647573 3300006237 Bacteria 610
72 Ga0075430_100090745 3300006846 Bacteria 2555
73 Ga0075430_100133268 3300006846 Bacteria 2071
74 Ga0075434_101130267 3300006871 Unclassified 796
75 Ga0075436_101352897 3300006914 Unclassified 539
76 Ga0097620_100737114 3300006931 Bacteria 1075
77 Ga0075435_100200816 3300007076 Unclassified 1689
78 Ga0099795_10342826 3300007788 Unclassified 666
79 Ga0105240_10001682 3300009093 Bacteria 37512
80 Ga0105240_10048752 3300009093 Bacteria 5351
81 Ga0111539_11151423 3300009094 Bacteria 901
82 Ga0105245_12053754 3300009098 Bacteria 625
83 Ga0114129_10151405 3300009147 Bacteria 3175
84 Ga0114129_11092604 3300009147 Bacteria 999
85 Ga0105248_10681807 3300009177 Bacteria 1159
86 Ga0105237_10041547 3300009545 Bacteria 4637
87 Ga0105238_10005212 3300009551 Bacteria 12844
88 Ga0105238_10131156 3300009551 Bacteria 2484
89 Ga0105238_10237754 3300009551 Bacteria 1799
90 Ga0099796_10014141 3300010159 Bacteria 2298
91 Ga0157373_10112670 3300013100 Bacteria 1912
92 Ga0157371_10081569 3300013102 Bacteria 2290
93 Ga0157370_10162328 3300013104 Bacteria 2079
94 Ga0157370_10630082 3300013104 Bacteria 981
95 Ga0157369_10009052 3300013105 Bacteria 11400
96 Ga0157369_10033714 3300013105 Bacteria 5624
97 Ga0157369_10131170 3300013105 Bacteria 2656
98 Ga0157374_10013884 3300013296 Bacteria 7039
99 Ga0157374_10381857 3300013296 Bacteria 1403
100 Ga0163162_12023357 3300013306 Unclassified 660
101 Ga0163162_12240139 3300013306 Unclassified 627
102 Ga0157372_10001562 3300013307 Bacteria 24933
103 Ga0157372_10195971 3300013307 Bacteria 2340
104 Ga0157375_10873598 3300013308 Unclassified 1044
105 Ga0163163_10237016 3300014325 Bacteria 1874
106 Ga0163163_10358037 3300014325 Unclassified 1516
107 Ga0157379_10231310 3300014968 Bacteria 1675
108 Ga0157379_10349681 3300014968 Bacteria 1353
109 Ga0157379_12357676 3300014968 Unclassified 531
110 Ga0157376_10079126 3300014969 Bacteria 2817
111 Ga0157376_10531079 3300014969 Unclassified 1161
112 Ga0157376_11089800 3300014969 Bacteria 824
113 Ga0213873_10000022 3300021358 Bacteria 103149
114 Ga0213874_10014456 3300021377 Bacteria 2065
115 Ga0213876_10000090 3300021384 Bacteria 103041
116 Ga0213876_10482920 3300021384 Bacteria 659
117 Ga0213875_10367061 3300021388 Bacteria 685
118 Ga0213875_10506353 3300021388 Unclassified 580
119 Ga0213871_10149886 3300021441 Bacteria 709
120 Ga0213871_10322272 3300021441 Unclassified 502
121 Ga0207688_10601936 3300025901 Bacteria 693
122 Ga0207699_10205768 3300025906 Bacteria 1336
123 Ga0207684_10113776 3300025910 Bacteria 2317
124 Ga0207654_10231189 3300025911 Unclassified 1231
125 Ga0207707_10001221 3300025912 Bacteria 24149
126 Ga0207707_10096433 3300025912 Bacteria 2584
127 Ga0207695_10044035 3300025913 Bacteria 4751
128 Ga0207695_10108155 3300025913 Unclassified 2765
129 Ga0207671_10171243 3300025914 Unclassified 1686
130 Ga0207671_10436547 3300025914 Unclassified 1042
131 Ga0207693_10093757 3300025915 Bacteria 2353
132 Ga0207693_11206580 3300025915 Unclassified 570
133 Ga0207663_10628199 3300025916 Unclassified 846
134 Ga0207660_10076079 3300025917 Unclassified 2454
135 Ga0207652_10257128 3300025921 Unclassified 1575
136 Ga0207652_10760229 3300025921 Bacteria 862
137 Ga0207646_10173663 3300025922 Bacteria 1946
138 Ga0207646_10243507 3300025922 Bacteria 1624
139 Ga0207646_11128226 3300025922 Bacteria 689
140 Ga0207694_10174824 3300025924 Bacteria 1740
141 Ga0207694_10204570 3300025924 Bacteria 1607
142 Ga0207659_10438821 3300025926 Unclassified 1098
143 Ga0207690_10345122 3300025932 Unclassified 1176
144 Ga0207711_10908619 3300025941 Bacteria 818
145 Ga0207679_10761812 3300025945 Unclassified 881
146 Ga0207667_10038556 3300025949 Bacteria 5101
147 Ga0207667_10057987 3300025949 Bacteria 4063
148 Ga0207651_10742127 3300025960 Bacteria 867
149 Ga0207712_10379460 3300025961 Unclassified 1183
150 Ga0207677_11673013 3300026023 Unclassified 590
151 Ga0207703_10493457 3300026035 Bacteria 1148
152 Ga0207703_10855466 3300026035 Bacteria 870
153 Ga0207639_10052365 3300026041 Bacteria 3111
154 Ga0207639_11312589 3300026041 Bacteria 679
155 Ga0207702_10026642 3300026078 Bacteria 4800
156 Ga0207702_10065299 3300026078 Bacteria 3117
157 Ga0207676_12234303 3300026095 Bacteria 545
158 Ga0207698_10057734 3300026142 Bacteria 3004
159 Ga0265334_10014436 3300028573 Plasmid 3292
160 Ga0265334_10050199 3300028573 Bacteria 1603
161 Ga0265334_10246161 3300028573 Bacteria 616
162 Ga0265318_10000015 3300028577 Bacteria 187234
163 Ga0265338_10013798 3300028800 Bacteria 9079
164 Ga0265338_10147191 3300028800 Bacteria 1836
165 Ga0265338_10356928 3300028800 Bacteria 1050
166 Ga0265324_10002260 3300029957 Bacteria 10038
167 Ga0265324_10109719 3300029957 Bacteria 937
168 Ga0265320_10149771 3300031240 Bacteria 1054
169 Ga0265339_10008610 3300031249 Bacteria 6479
170 Ga0265316_10013539 3300031344 Bacteria 7240
171 Ga0265316_10438022 3300031344 Bacteria 938
172 Ga0265316_10832790 3300031344 Unclassified 646
173 Ga0307408_100063137 3300031548 Bacteria 2709
174 Ga0265313_10198322 3300031595 Bacteria 836
175 Ga0265314_10352479 3300031711 Bacteria 809
176 Ga0316576_10063564 3300031727 Unclassified 2709
177 Ga0316578_10037753 3300031728 Unclassified 2783
178 Ga0307406_10411078 3300031901 Bacteria 1075
179 Ga0307406_11167764 3300031901 Unclassified 667
180 Ga0307407_10314649 3300031903 Bacteria 1096
181 Ga0307416_100085493 3300032002 Bacteria 2685
182 Ga0307414_10779629 3300032004 Bacteria 871
183 Ga0316214_1064984 3300033545 Unclassified 535
184 Ga0373923_0220605 3300035111 Unclassified 881
185 Ga0373932_0000575 3300035112 Bacteria 11236
186 Ga0373953_0075354 3300035117 Bacteria 1397
187 Ga0373956_0316648 3300035119 Bacteria 743
188 Ga0373955_0635585 3300035172 Bacteria 654
189 Ga0316574_0042413 3300035398 Bacteria 2807
190 Ga0373924_0371614 3300035410 Unclassified 638
191 Ga0373933_0039854 3300035724 Plasmid 2765
192 Ga0373933_0231413 3300035724 Bacteria 1187
193 Ga0373937_0016580 3300036401 Bacteria 6544
194 Ga0373937_0060998 3300036401 Bacteria 3466
195 Ga0373937_0708658 3300036401 Bacteria 953
196 Ga0373937_0968458 3300036401 Bacteria 799
197 Ga0373937_1031982 3300036401 Bacteria 771
198 Ga0436364_0157626 3300037853 Bacteria 1546
199 Ga0436364_1199574 3300037853 Bacteria 1281
200 Ga0436364_1252158 3300037853 Bacteria 1557
201 Ga0436364_1381005 3300037853 Unclassified 2231
202 Ga0436364_1386530 3300037853 Unclassified 1952
203 Ga0436365_0313028 3300039437 Unclassified 619
204 Ga0436365_0572332 3300039437 Bacteria 1019
205 Ga0436365_0863570 3300039437 Bacteria 121422
206 Ga0436365_1368768 3300039437 Unclassified 771
207 Ga0436365_1650439 3300039437 Bacteria 1200
208 Ga0436360_0357859 3300039438 Unclassified 1529
209 Ga0436360_0517524 3300039438 Bacteria 626
210 Ga0436360_0724526 3300039438 Unclassified 580
211 Ga0436360_1134614 3300039438 Bacteria 1332
212 Ga0436363_1503491 3300039450 Bacteria 1576
213 Ga0436362_0072752 3300039453 Bacteria 2880
214 Ga0436362_0592983 3300039453 Bacteria 296966
215 Ga0439444_0095426 3300042437 Bacteria 668
216 Ga0451577_0133310 3300042876 Unclassified 2230
217 Ga0451577_0823837 3300042876 Bacteria 838
218 Ga0451577_1089824 3300042876 Unclassified 715
219 Ga0466969_0092036 3300044656 Unclassified 1436
220 Ga0466961_0121372 3300044693 Unclassified 1641
221 Ga0466963_0104533 3300044694 Bacteria 1941
222 Ga0466963_0291216 3300044694 Unclassified 1148
223 Ga0466963_0495842 3300044694 Bacteria 862
224 Ga0466963_0523104 3300044694 Bacteria 838
225 Ga0466963_0846433 3300044694 Unclassified 645
226 Ga0453684_0020331 3300044712 Bacteria 10023
227 Ga0453684_0142674 3300044712 Bacteria 2857
228 Ga0466971_0384306 3300044719 Unclassified 683
229 Ga0466959_0025130 3300045049 Bacteria 4412
230 Ga0466958_0993070 3300045836 Bacteria 548
231 Ga0466967_0086393 3300045976 Bacteria 2842
232 Ga0495592_0303088 3300046454 Bacteria 1038
233 Ga0495592_0891279 3300046454 Bacteria 523
234 Ga0495629_0179498 3300046459 Bacteria 1468
235 Ga0495651_0247450 3300046462 Bacteria 1219
236 Ga0495653_0361104 3300046463 Unclassified 932
237 Ga0495653_0677300 3300046463 Bacteria 628
238 Ga0495664_0013756 3300046477 Bacteria 4588
239 Ga0495608_0008815 3300046511 Bacteria 7058
240 Ga0495608_0259332 3300046511 Bacteria 1082
241 Ga0495628_0791457 3300046516 Bacteria 664
242 Ga0495637_0013204 3300046520 Bacteria 3927
243 Ga0495643_0153189 3300046522 Bacteria 1140
244 Ga0495652_0266975 3300046529 Bacteria 1260
245 Ga0495652_0294138 3300046529 Bacteria 1183
246 Ga0495652_0492733 3300046529 Unclassified 851
247 Ga0495652_0764241 3300046529 Unclassified 646
248 Ga0495640_0243946 3300046533 Unclassified 1127
249 Ga0495587_0028489 3300046536 Plasmid 3396
250 Ga0495587_0097007 3300046536 Bacteria 1700
251 Ga0495645_0000602 3300046543 Bacteria 24779
252 Ga0495645_0368853 3300046543 Bacteria 921
253 Ga0495645_0516266 3300046543 Bacteria 745
254 Ga0495667_0048070 3300046559 Bacteria 2817
255 Ga0495667_0094532 3300046559 Bacteria 1935
256 Ga0495667_0212794 3300046559 Bacteria 1235
257 Ga0495667_0521397 3300046559 Unclassified 744
258 Ga0495625_0251801 3300046660 Unclassified 1146
259 Ga0495625_0739554 3300046660 Unclassified 577
260 Ga0495635_0153761 3300046663 Unclassified 1566
261 Ga0495657_0208718 3300046675 Bacteria 1188
262 Ga0495599_0466158 3300046678 Unclassified 746
263 Ga0495623_0034716 3300046679 Bacteria 3234
264 Ga0495623_0216454 3300046679 Bacteria 1094
265 Ga0495646_0114276 3300046680 Unclassified 1534
266 Ga0495646_0295450 3300046680 Bacteria 858
267 Ga0495624_0216717 3300046690 Bacteria 1161
268 Ga0495600_0324637 3300046809 Bacteria 967
269 Ga0495600_0342912 3300046809 Bacteria 937
270 Ga0495604_0028150 3300047317 Bacteria 4470
271 Ga0495604_0139909 3300047317 Bacteria 1730
272 Ga0495674_0243337 3300047319 Unclassified 1482
273 Ga0495674_0250024 3300047319 Bacteria 1459
274 Ga0495674_0445971 3300047319 Bacteria 1040
275 Ga0495674_0816755 3300047319 Unclassified 724
276 Ga0495680_0236247 3300047322 Unclassified 1299
277 Ga0495680_0320308 3300047322 Bacteria 1085
278 Ga0495675_0053913 3300047444 Bacteria 2552
279 Ga0495675_0070571 3300047444 Unclassified 2206
280 Ga0495684_0108290 3300047471 Bacteria 2099
281 Ga0495684_0198272 3300047471 Bacteria 1481
282 Ga0495602_0000131 3300048088 Bacteria 70438
283 Ga0495615_0130965 3300048090 Bacteria 733
284 Ga0496100_0362662 3300048903 Bacteria 1097
285 Ga0496104_1563360 3300048907 Bacteria 562
286 Ga0496108_0920576 3300048911 Unclassified 750
287 Ga0496109_0971418 3300048912 Bacteria 787
288 Ga0496112_0150129 3300048915 Bacteria 2297
289 Ga0501031_0265480 3300049568 Bacteria 1115
290 Ga0501033_0834573 3300049570 Unclassified 622
291 Ga0501033_0852112 3300049570 Unclassified 614
292 Ga0501034_0000780 3300049571 Bacteria 47710
293 Ga0501034_0011702 3300049571 Bacteria 9076
294 Ga0501034_0487238 3300049571 Bacteria 1148
295 Ga0501036_0088144 3300049572 Bacteria 2623
296 Ga0501036_0107909 3300049572 Bacteria 2354
297 Ga0501036_0550856 3300049572 Unclassified 958
298 Ga0501038_0353588 3300049574 Bacteria 1144
299 Ga0501038_0727221 3300049574 Bacteria 742
300 Ga0501039_0600450 3300049575 Bacteria 863
301 Ga0501039_0951419 3300049575 Bacteria 668
302 Ga0501040_0106307 3300049576 Bacteria 1961
303 Ga0501040_0195940 3300049576 Unclassified 1434
304 Ga0501040_0250227 3300049576 Unclassified 1264
305 Ga0501041_0196394 3300049577 Bacteria 1264
306 Ga0501041_0229978 3300049577 Bacteria 1164
307 Ga0501041_0275097 3300049577 Bacteria 1059
308 Ga0501041_0435473 3300049577 Bacteria 832
309 Ga0501042_0113248 3300049578 Bacteria 1953
310 Ga0501042_0141877 3300049578 Bacteria 1732
311 Ga0501042_0378659 3300049578 Bacteria 1024
312 Ga0501042_0381350 3300049578 Bacteria 1021
313 Ga0501042_0843355 3300049578 Unclassified 667
314 Ga0501046_0770915 3300049580 Bacteria 675
315 Ga0501046_0828238 3300049580 Bacteria 648
316 Ga0501048_0203310 3300049582 Bacteria 1404
317 Ga0501048_0491569 3300049582 Unclassified 880
318 Ga0501048_0611356 3300049582 Bacteria 783
319 Ga0501048_1191142 3300049582 Bacteria 548
320 Ga0501068_0110638 3300049584 Bacteria 1708
321 Ga0501068_0703571 3300049584 Unclassified 661
322 Ga0501069_0617505 3300049585 Unclassified 651
323 Ga0501070_0076474 3300049586 Bacteria 2772
324 Ga0501070_0777767 3300049586 Bacteria 753
325 Ga0501071_0027706 3300049587 Bacteria 3989
326 Ga0501071_0092229 3300049587 Bacteria 2226
327 Ga0501071_0323900 3300049587 Bacteria 1170
328 Ga0501071_0680813 3300049587 Unclassified 792
329 Ga0501071_1543033 3300049587 Unclassified 513
330 Ga0501072_0148944 3300049588 Bacteria 1866
331 Ga0501072_0223978 3300049588 Bacteria 1499
332 Ga0501072_0514519 3300049588 Bacteria 946
333 Ga0501074_0233625 3300049590 Unclassified 1309
334 Ga0501074_0500530 3300049590 Bacteria 861
335 Ga0501075_0007367 3300049591 Bacteria 7634
336 Ga0501075_0061851 3300049591 Bacteria 2822
337 Ga0501075_0172567 3300049591 Bacteria 1650
338 Ga0501075_0831763 3300049591 Bacteria 702
339 Ga0501075_0897371 3300049591 Unclassified 674
340 Ga0501076_0054785 3300049592 Bacteria 3161
341 Ga0501076_0076546 3300049592 Bacteria 2683
342 Ga0501076_0408050 3300049592 Unclassified 1117
343 Ga0501076_0573687 3300049592 Bacteria 930
344 Ga0501076_0652627 3300049592 Bacteria 868
345 Ga0501076_0898964 3300049592 Unclassified 730
346 Ga0501076_1039085 3300049592 Unclassified 675
347 Ga0501077_0032279 3300049593 Bacteria 3334
348 Ga0501077_0330265 3300049593 Bacteria 972
349 Ga0501079_0350900 3300049741 Unclassified 1156
350 Ga0501079_0706483 3300049741 Bacteria 794
351 Ga0501080_0050520 3300049742 Bacteria 3870
352 Ga0501080_1626207 3300049742 Bacteria 546
353 Ga0501081_0177350 3300049743 Bacteria 1540
354 Ga0501081_0240735 3300049743 Bacteria 1319
355 Ga0501081_0507134 3300049743 Unclassified 899
356 Ga0501035_0607029 3300049822 Bacteria 891
357 Ga0501044_0118295 3300049823 Bacteria 2653
358 Ga0501044_1468381 3300049823 Bacteria 547
359 Ga0501045_0020259 3300049824 Bacteria 4749
360 Ga0501045_0094355 3300049824 Bacteria 2213
361 Ga0501045_0189930 3300049824 Bacteria 1531
362 Ga0501045_0305018 3300049824 Bacteria 1185
363 Ga0501045_0593360 3300049824 Bacteria 820
364 nmdc:mga05p37_1137109_c1 3300050507 Bacteria 814
365 nmdc:mga05p37_76636_c1 3300050507 Bacteria 4116
366 nmdc:mga09592_1187092_c1 3300050508 Bacteria 631
367 nmdc:mga0qj67_228288_c1 3300050509 Bacteria 1511
368 nmdc:mga0qj67_326935_c1 3300050509 Bacteria 1241
369 nmdc:mga06r32_471976_c1 3300050510 Archaea 1233
370 nmdc:mga0rr50_206912_c1 3300050513 Unclassified 1615
371 nmdc:mga0a205_218702_c1 3300050515 Bacteria 1791
372 Ga0495601_0267486 3300053077 Bacteria 1115
373 Ga0495612_0022245 3300053078 Bacteria 2542
374 Ga0495595_0061206 3300053084 Unclassified 1763
375 Ga0495595_0070246 3300053084 Bacteria 1654
376 Ga0495595_0127032 3300053084 Bacteria 1244
377 Ga0495619_0162937 3300053085 Bacteria 1540
378 Ga0495619_0357825 3300053085 Bacteria 1009
379 Ga0495619_0549961 3300053085 Bacteria 792
380 Ga0495619_0569680 3300053085 Bacteria 776
381 Ga0500641_0000740 3300053096 Bacteria 11834
382 Ga0500655_020486 3300053133 Bacteria 1236
383 Ga0500590_009085 3300053148 Bacteria 4986
384 Ga0500636_0209923 3300053177 Bacteria 1023
385 Ga0501084_0022513 3300054114 Bacteria 5259
386 Ga0501084_0140449 3300054114 Bacteria 2034
387 Ga0501084_0261919 3300054114 Bacteria 1460
388 Ga0501084_0373942 3300054114 Bacteria 1204
389 Ga0501084_1764191 3300054114 Bacteria 517
390 Ga0501082_0068241 3300060353 Bacteria 3062
391 Ga0501082_0256333 3300060353 Bacteria 1522
392 Ga0501082_0342387 3300060353 Bacteria 1303
393 Ga0501082_0668454 3300060353 Bacteria 909
394 Ga0530510_0020638 3300061734 Bacteria 4684
395 Ga0530510_0180377 3300061734 Bacteria 1566
396 Ga0530510_0376333 3300061734 Bacteria 1069
397 Ga0530510_0946952 3300061734 Unclassified 658
398 2644493619 2643221688 Bacteria 5260751
399 2937848056 2937843397 Bacteria 5256375
400 Ga0436361_0068542
401 JGI24739J22299_10158714
402 JGI25406J46586_10090358
403 rootH2_10029865
404 Ga0065707_10862061
405 Ga0070683_100055159
406 Ga0068868_100941283
407 Ga0070689_101724789
408 Ga0070691_10116630
409 Ga0070668_100378131
410 Ga0070669_100616534
411 Ga0070669_101099789
412 Ga0070675_100557974
413 Ga0070671_100096151
414 Ga0070673_100703377
415 Ga0070659_100030039
416 Ga0070659_100257917
417 Ga0070709_10179957
418 Ga0070709_11518283
419 Ga0070713_100993514
420 Ga0070711_100297988
421 Ga0070708_100122006
422 Ga0070708_100183799
423 Ga0070663_101155269
424 Ga0070678_100517247
425 Ga0070681_10036931
426 Ga0070681_10711332
427 Ga0070706_100034834
428 Ga0070706_100687185
429 Ga0070707_100049507
430 Ga0070707_100346556
431 Ga0070707_100802104
432 Ga0070698_100001583
433 Ga0070698_100258569
434 Ga0070698_101197412
435 Ga0070699_100023052
436 Ga0070699_100085084
437 Ga0070679_100047219
438 Ga0070679_100381643
439 Ga0070697_100157917
440 Ga0070697_100241047
441 Ga0070697_100835111
442 Ga0068853_100002914
443 Ga0070695_100016221
444 Ga0070696_100076409
445 Ga0070696_100305496
446 Ga0070696_101981342
447 Ga0070704_100025546
448 Ga0068855_100006956
449 Ga0068855_100016628
450 Ga0068855_100112989
451 Ga0068855_100481442
452 Ga0070664_100840607
453 Ga0068856_100026569
454 Ga0068856_100050272
455 Ga0068856_100722518
456 Ga0068852_100252113
457 Ga0068859_100737045
458 Ga0068866_10851934
459 Ga0068861_102073903
460 Ga0068858_101296680
461 Ga0068860_101174877
462 Ga0081455_10085143
463 Ga0081538_10016756
464 Ga0081539_10000090
465 Ga0081539_10011328
466 Ga0081539_10185062
467 Ga0070717_10730510
468 Ga0070712_100343875
469 Ga0075369_10160870
470 Ga0097621_101647573
471 Ga0075430_100090745
472 Ga0075430_100133268
473 Ga0075434_101130267
474 Ga0075436_101352897
475 Ga0097620_100737114
476 Ga0075435_100200816
477 Ga0099795_10342826
478 Ga0105240_10001682
479 Ga0105240_10048752
480 Ga0111539_11151423
481 Ga0105245_12053754
482 Ga0114129_10151405
483 Ga0114129_11092604
484 Ga0105248_10681807
485 Ga0105237_10041547
486 Ga0105238_10005212
487 Ga0105238_10131156
488 Ga0105238_10237754
489 Ga0099796_10014141
490 Ga0157373_10112670
491 Ga0157371_10081569
492 Ga0157370_10162328
493 Ga0157370_10630082
494 Ga0157369_10009052
495 Ga0157369_10033714
496 Ga0157369_10131170
497 Ga0157374_10013884
498 Ga0157374_10381857
499 Ga0163162_12023357
500 Ga0163162_12240139
501 Ga0157372_10001562
502 Ga0157372_10195971
503 Ga0157375_10873598
504 Ga0163163_10237016
505 Ga0163163_10358037
506 Ga0157379_10231310
507 Ga0157379_10349681
508 Ga0157379_12357676
509 Ga0157376_10079126
510 Ga0157376_10531079
511 Ga0157376_11089800
512 Ga0213873_10000022
513 Ga0213874_10014456
514 Ga0213876_10000090
515 Ga0213876_10482920
516 Ga0213875_10367061
517 Ga0213875_10506353
518 Ga0213871_10149886
519 Ga0213871_10322272
520 Ga0207688_10601936
521 Ga0207699_10205768
522 Ga0207684_10113776
523 Ga0207654_10231189
524 Ga0207707_10001221
525 Ga0207707_10096433
526 Ga0207695_10044035
527 Ga0207695_10108155
528 Ga0207671_10171243
529 Ga0207671_10436547
530 Ga0207693_10093757
531 Ga0207693_11206580
532 Ga0207663_10628199
533 Ga0207660_10076079
534 Ga0207652_10257128
535 Ga0207652_10760229
536 Ga0207646_10173663
537 Ga0207646_10243507
538 Ga0207646_11128226
539 Ga0207694_10174824
540 Ga0207694_10204570
541 Ga0207659_10438821
542 Ga0207690_10345122
543 Ga0207711_10908619
544 Ga0207679_10761812
545 Ga0207667_10038556
546 Ga0207667_10057987
547 Ga0207651_10742127
548 Ga0207712_10379460
549 Ga0207677_11673013
550 Ga0207703_10493457
551 Ga0207703_10855466
552 Ga0207639_10052365
553 Ga0207639_11312589
554 Ga0207702_10026642
555 Ga0207702_10065299
556 Ga0207676_12234303
557 Ga0207698_10057734
558 Ga0265334_10014436
559 Ga0265334_10050199
560 Ga0265334_10246161
561 Ga0265318_10000015
562 Ga0265338_10013798
563 Ga0265338_10147191
564 Ga0265338_10356928
565 Ga0265324_10002260
566 Ga0265324_10109719
567 Ga0265320_10149771
568 Ga0265339_10008610
569 Ga0265316_10013539
570 Ga0265316_10438022
571 Ga0265316_10832790
572 Ga0307408_100063137
573 Ga0265313_10198322
574 Ga0265314_10352479
575 Ga0316576_10063564
576 Ga0316578_10037753
577 Ga0307406_10411078
578 Ga0307406_11167764
579 Ga0307407_10314649
580 Ga0307416_100085493
581 Ga0307414_10779629
582 Ga0316214_1064984
583 Ga0373923_0220605
584 Ga0373932_0000575
585 Ga0373953_0075354
586 Ga0373956_0316648
587 Ga0373955_0635585
588 Ga0316574_0042413
589 Ga0373924_0371614
590 Ga0373933_0039854
591 Ga0373933_0231413
592 Ga0373937_0016580
593 Ga0373937_0060998
594 Ga0373937_0708658
595 Ga0373937_0968458
596 Ga0373937_1031982
597 Ga0436364_0157626
598 Ga0436364_1199574
599 Ga0436364_1252158
600 Ga0436364_1381005
601 Ga0436364_1386530
602 Ga0436365_0313028
603 Ga0436365_0572332
604 Ga0436365_0863570
605 Ga0436365_1368768
606 Ga0436365_1650439
607 Ga0436360_0357859
608 Ga0436360_0517524
609 Ga0436360_0724526
610 Ga0436360_1134614
611 Ga0436363_1503491
612 Ga0436362_0072752
613 Ga0436362_0592983
614 Ga0439444_0095426
615 Ga0451577_0133310
616 Ga0451577_0823837
617 Ga0451577_1089824
618 Ga0466969_0092036
619 Ga0466961_0121372
620 Ga0466963_0104533
621 Ga0466963_0291216
622 Ga0466963_0495842
623 Ga0466963_0523104
624 Ga0466963_0846433
625 Ga0453684_0020331
626 Ga0453684_0142674
627 Ga0466971_0384306
628 Ga0466959_0025130
629 Ga0466958_0993070
630 Ga0466967_0086393
631 Ga0495592_0303088
632 Ga0495592_0891279
633 Ga0495629_0179498
634 Ga0495651_0247450
635 Ga0495653_0361104
636 Ga0495653_0677300
637 Ga0495664_0013756
638 Ga0495608_0008815
639 Ga0495608_0259332
640 Ga0495628_0791457
641 Ga0495637_0013204
642 Ga0495643_0153189
643 Ga0495652_0266975
644 Ga0495652_0294138
645 Ga0495652_0492733
646 Ga0495652_0764241
647 Ga0495640_0243946
648 Ga0495587_0028489
649 Ga0495587_0097007
650 Ga0495645_0000602
651 Ga0495645_0368853
652 Ga0495645_0516266
653 Ga0495667_0048070
654 Ga0495667_0094532
655 Ga0495667_0212794
656 Ga0495667_0521397
657 Ga0495625_0251801
658 Ga0495625_0739554
659 Ga0495635_0153761
660 Ga0495657_0208718
661 Ga0495599_0466158
662 Ga0495623_0034716
663 Ga0495623_0216454
664 Ga0495646_0114276
665 Ga0495646_0295450
666 Ga0495624_0216717
667 Ga0495600_0324637
668 Ga0495600_0342912
669 Ga0495604_0028150
670 Ga0495604_0139909
671 Ga0495674_0243337
672 Ga0495674_0250024
673 Ga0495674_0445971
674 Ga0495674_0816755
675 Ga0495680_0236247
676 Ga0495680_0320308
677 Ga0495675_0053913
678 Ga0495675_0070571
679 Ga0495684_0108290
680 Ga0495684_0198272
681 Ga0495602_0000131
682 Ga0495615_0130965
683 Ga0496100_0362662
684 Ga0496104_1563360
685 Ga0496108_0920576
686 Ga0496109_0971418
687 Ga0496112_0150129
688 Ga0501031_0265480
689 Ga0501033_0834573
690 Ga0501033_0852112
691 Ga0501034_0000780
692 Ga0501034_0011702
693 Ga0501034_0487238
694 Ga0501036_0088144
695 Ga0501036_0107909
696 Ga0501036_0550856
697 Ga0501038_0353588
698 Ga0501038_0727221
699 Ga0501039_0600450
700 Ga0501039_0951419
701 Ga0501040_0106307
702 Ga0501040_0195940
703 Ga0501040_0250227
704 Ga0501041_0196394
705 Ga0501041_0229978
706 Ga0501041_0275097
707 Ga0501041_0435473
708 Ga0501042_0113248
709 Ga0501042_0141877
710 Ga0501042_0378659
711 Ga0501042_0381350
712 Ga0501042_0843355
713 Ga0501046_0770915
714 Ga0501046_0828238
715 Ga0501048_0203310
716 Ga0501048_0491569
717 Ga0501048_0611356
718 Ga0501048_1191142
719 Ga0501068_0110638
720 Ga0501068_0703571
721 Ga0501069_0617505
722 Ga0501070_0076474
723 Ga0501070_0777767
724 Ga0501071_0027706
725 Ga0501071_0092229
726 Ga0501071_0323900
727 Ga0501071_0680813
728 Ga0501071_1543033
729 Ga0501072_0148944
730 Ga0501072_0223978
731 Ga0501072_0514519
732 Ga0501074_0233625
733 Ga0501074_0500530
734 Ga0501075_0007367
735 Ga0501075_0061851
736 Ga0501075_0172567
737 Ga0501075_0831763
738 Ga0501075_0897371
739 Ga0501076_0054785
740 Ga0501076_0076546
741 Ga0501076_0408050
742 Ga0501076_0573687
743 Ga0501076_0652627
744 Ga0501076_0898964
745 Ga0501076_1039085
746 Ga0501077_0032279
747 Ga0501077_0330265
748 Ga0501079_0350900
749 Ga0501079_0706483
750 Ga0501080_0050520
751 Ga0501080_1626207
752 Ga0501081_0177350
753 Ga0501081_0240735
754 Ga0501081_0507134
755 Ga0501035_0607029
756 Ga0501044_0118295
757 Ga0501044_1468381
758 Ga0501045_0020259
759 Ga0501045_0094355
760 Ga0501045_0189930
761 Ga0501045_0305018
762 Ga0501045_0593360
763 nmdc:mga05p37_1137109_c1
764 nmdc:mga05p37_76636_c1
765 nmdc:mga09592_1187092_c1
766 nmdc:mga0qj67_228288_c1
767 nmdc:mga0qj67_326935_c1
768 nmdc:mga06r32_471976_c1
769 nmdc:mga0rr50_206912_c1
770 nmdc:mga0a205_218702_c1
771 Ga0495601_0267486
772 Ga0495612_0022245
773 Ga0495595_0061206
774 Ga0495595_0070246
775 Ga0495595_0127032
776 Ga0495619_0162937
777 Ga0495619_0357825
778 Ga0495619_0549961
779 Ga0495619_0569680
780 Ga0500641_0000740
781 Ga0500655_020486
782 Ga0500590_009085
783 Ga0500636_0209923
784 Ga0501084_0022513
785 Ga0501084_0140449
786 Ga0501084_0261919
787 Ga0501084_0373942
788 Ga0501084_1764191
789 Ga0501082_0068241
790 Ga0501082_0256333
791 Ga0501082_0342387
792 Ga0501082_0668454
793 Ga0530510_0020638
794 Ga0530510_0180377
795 Ga0530510_0376333
796 Ga0530510_0946952
797 2644493619
798 2937848056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

3

129

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8o-assembly2.cif.gz_H crystal structure of pae2754 from pyrobaculum aerophilum 0.8429 2 128
1v8p-assembly2.cif.gz_F crystal structure of pae2754 from pyrobaculum aerophilum 0.8341 2 128
1v8p-assembly1.cif.gz_D crystal structure of pae2754 from pyrobaculum aerophilum 0.8263 2 128
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.7953 4 122
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.7841 4 136
ID Description Score Start End Superfamily
af_P9WFA9_1_117_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8946 4 128 3.40.50.1010
af_P9WFA9_1_117_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8663 4 128 3.40.50.1010
af_P9WFB7_11_132_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.862 4 128 3.40.50.1010
af_P9WFB7_11_132_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8298 4 128 3.40.50.1010
1v8pB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8239 2 125 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A831M587-F1-model_v4 PIN domain-containing protein 0.9751 1 136
AF-A0A3A4PBJ7-F1-model_v4 PIN domain-containing protein 0.9743 1 136
AF-A0A4P5VP71-F1-model_v4 Ribonuclease VapC 0.9741 2 138
AF-A0A661KMZ3-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.9737 2 136
AF-A0A662ELI9-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9703 3 136 GO:0000287
GO:0004540
GO:0090729

Map