F434367

General Info

Members Datasets Scaffolds Average Seq Length
399 230 799 131

Family's Representative Sequence

Representative Sequence 3300046457|Ga0495590_0011093|Ga0495590_0011093_2775_3233
Length 152
Sequence VTTGDIAMTDNRDLQAQNASKVQAQPQSQPPXXXGASRAPQDERAMVPRVDVLEDEAGITLLADLPGVPREQLELKVEGDTLLIEGTVAAFAPEGLEALYAEVRLPRYRRAFTLSRELDTNAIQAQLRDGVLNLRIPKQAHAQPRRIDVQVG

Samples

Sample ID Description Type Environment
1 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
145 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
146 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
147 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
148 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
149 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
152 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
153 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
154 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
155 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
156 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
157 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
158 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
159 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
194 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
195 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
196 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
197 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
200 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
214 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
215 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
219 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
220 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
223 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
224 2643221585 Pelomonas sp. Root662 Isolate Unclassified
225 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
226 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
227 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
228 2643221656 Pelomonas sp. Root405 Isolate Unclassified
229 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
230 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.24
Metatranscriptomes 0.5
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.55
Nodule 0
Rhizoplane 1.75
Rhizosphere 67.92
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495590_0011093 3300046457 Bacteria 3377
2 rootH1_10016154 3300003316 Bacteria 6196
3 rootH1_10048792 3300003316 Bacteria 4403
4 rootH1_10103668 3300003316 Bacteria 1471
5 rootH2_10302748 3300003320 Bacteria 1913
6 rootL2_10029916 3300003322 Bacteria 7715
7 rootL2_10038151 3300003322 Bacteria 5854
8 rootH1_10022985 3300003316 Bacteria 2204
9 rootH1_10022985 3300003323 Bacteria 17952
10 rootH1_10183195 3300003323 Bacteria 1456
11 Ga0055531_10000134 3300003794 Bacteria 84304
12 Ga0055543_1003274 3300004625 Bacteria 4879
13 Ga0065165_1000233 3300005262 Bacteria 96768
14 Ga0065707_10900120 3300005295 Bacteria 567
15 Ga0070676_10561310 3300005328 Bacteria 818
16 Ga0070670_100638443 3300005331 Bacteria 955
17 Ga0068869_100843298 3300005334 Bacteria 790
18 Ga0068869_101394285 3300005334 Bacteria 620
19 Ga0068868_100050943 3300005338 Bacteria 3254
20 Ga0068868_100198372 3300005338 Bacteria 1672
21 Ga0068868_101541612 3300005338 Bacteria 623
22 Ga0070689_100218136 3300005340 Bacteria 1564
23 Ga0070687_100059572 3300005343 Bacteria 2011
24 Ga0070669_100208837 3300005353 Bacteria 1539
25 Ga0070675_100174358 3300005354 Bacteria 1856
26 Ga0070671_100013732 3300005355 Bacteria 6533
27 Ga0070671_100031634 3300005355 Bacteria 4372
28 Ga0070674_100124067 3300005356 Bacteria 1916
29 Ga0070674_100362240 3300005356 Bacteria 1174
30 Ga0070659_100093268 3300005366 Bacteria 2416
31 Ga0070667_100071445 3300005367 Bacteria 2956
32 Ga0070667_100306892 3300005367 Bacteria 1430
33 Ga0070667_101003480 3300005367 Bacteria 779
34 Ga0070667_101068549 3300005367 Bacteria 754
35 Ga0070667_102212909 3300005367 Bacteria 518
36 Ga0070700_100021124 3300005441 Bacteria 3781
37 Ga0070700_100844802 3300005441 Bacteria 741
38 Ga0070663_100535200 3300005455 Bacteria 977
39 Ga0070678_100275132 3300005456 Bacteria 1421
40 Ga0068867_100002610 3300005459 Bacteria 12706
41 Ga0068867_100071873 3300005459 Bacteria 2589
42 Ga0068867_100107165 3300005459 Bacteria 2142
43 Ga0070706_100000789 3300005467 Bacteria 35385
44 Ga0070707_100115017 3300005468 Bacteria 2611
45 Ga0070707_100451554 3300005468 Bacteria 1246
46 Ga0070698_100105217 3300005471 Bacteria 2792
47 Ga0070699_100171430 3300005518 Bacteria 1923
48 Ga0070672_100007169 3300005543 Bacteria 7545
49 Ga0070672_100099033 3300005543 Bacteria 2362
50 Ga0070686_100569710 3300005544 Bacteria 888
51 Ga0070665_100038803 3300005548 Bacteria 4788
52 Ga0070665_100060190 3300005548 Bacteria 3807
53 Ga0068856_100256370 3300005614 Bacteria 1764
54 Ga0070702_100421807 3300005615 Bacteria 960
55 Ga0070702_100524953 3300005615 Bacteria 874
56 Ga0068852_100259637 3300005616 Bacteria 1668
57 Ga0068859_100028152 3300005617 Bacteria 5634
58 Ga0068859_100734794 3300005617 Bacteria 1076
59 Ga0068864_100054499 3300005618 Bacteria 3451
60 Ga0068864_100166616 3300005618 Bacteria 2006
61 Ga0068866_10361705 3300005718 Bacteria 925
62 Ga0068861_100002798 3300005719 Bacteria 11463
63 Ga0068861_100695505 3300005719 Bacteria 944
64 Ga0068861_101404936 3300005719 Bacteria 682
65 Ga0068870_10317172 3300005840 Bacteria 989
66 Ga0068863_100074081 3300005841 Bacteria 3221
67 Ga0068863_100156062 3300005841 Bacteria 2185
68 Ga0068863_100951598 3300005841 Unclassified 860
69 Ga0068863_101184812 3300005841 Bacteria 770
70 Ga0068858_100027233 3300005842 Bacteria 5311
71 Ga0068858_100596459 3300005842 Bacteria 1071
72 Ga0068860_100001383 3300005843 Bacteria 26323
73 Ga0068860_100014759 3300005843 Bacteria 7640
74 Ga0068860_100056671 3300005843 Bacteria 3724
75 Ga0068862_100003437 3300005844 Bacteria 13623
76 Ga0068862_100043169 3300005844 Bacteria 3844
77 Ga0068862_100209370 3300005844 Bacteria 1761
78 Ga0075365_10083799 3300006038 Bacteria 2163
79 Ga0075368_10024741 3300006042 Bacteria 2301
80 Ga0075368_10087155 3300006042 Bacteria 1275
81 Ga0075363_100297930 3300006048 Bacteria 935
82 Ga0075363_100783904 3300006048 Bacteria 579
83 Ga0075364_10157623 3300006051 Bacteria 1531
84 Ga0075362_10022343 3300006177 Bacteria 2664
85 Ga0075362_10086422 3300006177 Bacteria 1451
86 Ga0075362_10444739 3300006177 Bacteria 658
87 Ga0075367_10098841 3300006178 Bacteria 1782
88 Ga0075367_10432713 3300006178 Bacteria 833
89 Ga0075369_10069088 3300006186 Bacteria 1553
90 Ga0075369_10262827 3300006186 Bacteria 802
91 Ga0075366_10005152 3300006195 Bacteria 7071
92 Ga0075366_10017365 3300006195 Bacteria 4142
93 Ga0075366_10033642 3300006195 Bacteria 3020
94 Ga0075366_10052758 3300006195 Bacteria 2416
95 Ga0075366_10059146 3300006195 Bacteria 2276
96 Ga0075366_10138162 3300006195 Bacteria 1472
97 Ga0075366_10159819 3300006195 Bacteria 1365
98 Ga0075366_10161528 3300006195 Bacteria 1358
99 Ga0075366_10170427 3300006195 Bacteria 1321
100 Ga0075366_10288793 3300006195 Bacteria 1003
101 Ga0075366_10424046 3300006195 Bacteria 820
102 Ga0075366_10530801 3300006195 Bacteria 728
103 Ga0097621_100173266 3300006237 Bacteria 1861
104 Ga0097621_100470912 3300006237 Bacteria 1134
105 Ga0075370_10002077 3300006353 Bacteria 9121
106 Ga0075370_10004911 3300006353 Bacteria 6568
107 Ga0075370_10025900 3300006353 Bacteria 3246
108 Ga0075370_10040147 3300006353 Bacteria 2639
109 Ga0075370_10041452 3300006353 Bacteria 2599
110 Ga0075370_10091360 3300006353 Bacteria 1756
111 Ga0075370_10742394 3300006353 Bacteria 597
112 Ga0075430_100020831 3300006846 Bacteria 5573
113 Ga0075429_100000422 3300006880 Bacteria 31585
114 Ga0075429_100465327 3300006880 Bacteria 1108
115 Ga0068865_100115792 3300006881 Bacteria 1985
116 Ga0097620_100028153 3300006931 Bacteria 5634
117 Ga0097620_100734774 3300006931 Bacteria 1076
118 Ga0105245_10008948 3300009098 Bacteria 8732
119 Ga0105245_10047974 3300009098 Bacteria 3819
120 Ga0105245_10729554 3300009098 Bacteria 1026
121 Ga0105243_10019900 3300009148 Bacteria 5089
122 Ga0105243_10057970 3300009148 Bacteria 3085
123 Ga0105243_10560438 3300009148 Bacteria 1093
124 Ga0105248_10075522 3300009177 Bacteria 3788
125 Ga0105249_10604465 3300009553 Bacteria 1151
126 Ga0105249_10674051 3300009553 Bacteria 1093
127 Ga0105249_10902078 3300009553 Bacteria 951
128 Ga0105249_10972938 3300009553 Bacteria 917
129 Ga0105239_11762353 3300010375 Bacteria 717
130 Ga0105246_10355378 3300011119 Bacteria 1202
131 Ga0157315_1049999 3300012508 Bacteria 559
132 Ga0157374_10037033 3300013296 Bacteria 4474
133 Ga0157374_10243980 3300013296 Bacteria 1767
134 Ga0157378_10053004 3300013297 Bacteria 3611
135 Ga0163162_10004516 3300013306 Bacteria 13402
136 Ga0157375_10034805 3300013308 Bacteria 4801
137 Ga0157375_10109336 3300013308 Bacteria 2860
138 Ga0157375_10120500 3300013308 Bacteria 2732
139 Ga0157375_10854883 3300013308 Bacteria 1056
140 Ga0157380_10017649 3300014326 Bacteria 5284
141 Ga0157380_10060700 3300014326 Bacteria 3022
142 Ga0157379_10020498 3300014968 Bacteria 5845
143 Ga0157379_10063850 3300014968 Bacteria 3292
144 Ga0157379_10148571 3300014968 Bacteria 2114
145 Ga0157379_10274037 3300014968 Bacteria 1535
146 Ga0157379_10854740 3300014968 Bacteria 861
147 Ga0157376_12261176 3300014969 Bacteria 583
148 Ga0163161_10079450 3300017792 Bacteria 2412
149 Ga0163161_10869242 3300017792 Bacteria 762
150 Ga0206351_10747366 3300020077 Bacteria 1102
151 Ga0209050_1004512 3300025298 Bacteria 9359
152 Ga0209051_1001621 3300025303 Bacteria 18339
153 Ga0209051_1002692 3300025303 Bacteria 12369
154 Ga0209257_1000053 3300025304 Bacteria 425160
155 Ga0207682_10012985 3300025893 Bacteria 3247
156 Ga0207642_10323279 3300025899 Bacteria 901
157 Ga0207643_10271567 3300025908 Bacteria 1049
158 Ga0207684_10003750 3300025910 Bacteria 14685
159 Ga0207671_10072885 3300025914 Bacteria 2564
160 Ga0207662_10073547 3300025918 Bacteria 2073
161 Ga0207662_11236169 3300025918 Bacteria 531
162 Ga0207646_10717745 3300025922 Bacteria 893
163 Ga0207650_10404640 3300025925 Bacteria 1130
164 Ga0207650_10792137 3300025925 Bacteria 803
165 Ga0207659_10067736 3300025926 Bacteria 2594
166 Ga0207687_10081249 3300025927 Bacteria 2342
167 Ga0207687_10166183 3300025927 Bacteria 1698
168 Ga0207687_10393323 3300025927 Bacteria 1138
169 Ga0207644_10016582 3300025931 Bacteria 4958
170 Ga0207644_10069917 3300025931 Bacteria 2564
171 Ga0207686_10362109 3300025934 Bacteria 1095
172 Ga0207709_10042763 3300025935 Bacteria 2727
173 Ga0207709_10073130 3300025935 Bacteria 2183
174 Ga0207709_10111752 3300025935 Bacteria 1828
175 Ga0207709_10416784 3300025935 Bacteria 1030
176 Ga0207670_10162206 3300025936 Bacteria 1669
177 Ga0207669_10081671 3300025937 Bacteria 2072
178 Ga0207704_10002656 3300025938 Bacteria 8071
179 Ga0207704_10860022 3300025938 Bacteria 760
180 Ga0207691_10018133 3300025940 Bacteria 6667
181 Ga0207691_10221806 3300025940 Bacteria 1639
182 Ga0207711_10095196 3300025941 Bacteria 2626
183 Ga0207689_10571898 3300025942 Bacteria 950
184 Ga0207689_11052410 3300025942 Bacteria 686
185 Ga0207712_10213583 3300025961 Bacteria 1538
186 Ga0207712_10743601 3300025961 Bacteria 859
187 Ga0207668_10058928 3300025972 Bacteria 2687
188 Ga0207640_10376975 3300025981 Bacteria 1148
189 Ga0207658_10010318 3300025986 Bacteria 6349
190 Ga0207658_10095762 3300025986 Bacteria 2313
191 Ga0207658_10246304 3300025986 Bacteria 1517
192 Ga0207658_10937922 3300025986 Bacteria 789
193 Ga0207658_11169164 3300025986 Bacteria 703
194 Ga0207677_10204710 3300026023 Bacteria 1571
195 Ga0207677_10466316 3300026023 Bacteria 1085
196 Ga0207677_10609505 3300026023 Bacteria 959
197 Ga0207703_10008960 3300026035 Bacteria 7883
198 Ga0207703_10462402 3300026035 Bacteria 1187
199 Ga0207639_10056990 3300026041 Bacteria 2998
200 Ga0207678_10527475 3300026067 Bacteria 1031
201 Ga0207678_10795330 3300026067 Bacteria 835
202 Ga0207708_10053750 3300026075 Bacteria 3069
203 Ga0207702_10270487 3300026078 Bacteria 1603
204 Ga0207641_10017347 3300026088 Bacteria 5894
205 Ga0207641_10938030 3300026088 Unclassified 860
206 Ga0207648_10000799 3300026089 Bacteria 35474
207 Ga0207648_10067429 3300026089 Bacteria 3119
208 Ga0207648_10094332 3300026089 Bacteria 2617
209 Ga0207648_10503496 3300026089 Bacteria 1108
210 Ga0207648_12211408 3300026089 Bacteria 511
211 Ga0207676_10015965 3300026095 Bacteria 5432
212 Ga0207676_10038658 3300026095 Bacteria 3644
213 Ga0207676_11219887 3300026095 Unclassified 746
214 Ga0207674_10292029 3300026116 Bacteria 1579
215 Ga0207675_100003220 3300026118 Bacteria 16019
216 Ga0207675_101100213 3300026118 Bacteria 814
217 Ga0207675_101668305 3300026118 Unclassified 657
218 Ga0207683_10929940 3300026121 Bacteria 807
219 Ga0207698_10412689 3300026142 Bacteria 1294
220 Ga0209813_10072026 3300027866 Bacteria 1126
221 Ga0209813_10215436 3300027866 Bacteria 717
222 Ga0268266_10082295 3300028379 Bacteria 2808
223 Ga0268265_10118348 3300028380 Bacteria 2178
224 Ga0268265_10138558 3300028380 Bacteria 2034
225 Ga0268265_10179555 3300028380 Bacteria 1817
226 Ga0268264_10002625 3300028381 Bacteria 15693
227 Ga0268264_10011276 3300028381 Bacteria 7385
228 Ga0268264_10080098 3300028381 Bacteria 2788
229 Ga0268264_11643711 3300028381 Bacteria 653
230 Ga0307517_10094857 3300028786 Bacteria 2406
231 Ga0307515_10015833 3300028794 Bacteria 13863
232 Ga0307515_10060390 3300028794 Bacteria 5407
233 Ga0307515_10148170 3300028794 Bacteria 2471
234 Ga0307515_10279419 3300028794 Bacteria 1379
235 Ga0307512_10025373 3300030522 Bacteria 5252
236 Ga0307513_10015205 3300031456 Bacteria 9341
237 Ga0307513_10089310 3300031456 Bacteria 3146
238 Ga0307513_10133169 3300031456 Unclassified 2427
239 Ga0307509_10147867 3300031507 Bacteria 2271
240 Ga0307408_100535837 3300031548 Bacteria 1031
241 Ga0307408_100582792 3300031548 Bacteria 991
242 Ga0307408_101680992 3300031548 Bacteria 604
243 Ga0307408_102207479 3300031548 Bacteria 532
244 Ga0307508_10034866 3300031616 Bacteria 4534
245 Ga0307508_10093023 3300031616 Bacteria 2605
246 Ga0307508_10238789 3300031616 Bacteria 1415
247 Ga0307514_10521340 3300031649 Bacteria 558
248 Ga0307516_10013229 3300031730 Bacteria 8810
249 Ga0307516_10216332 3300031730 Bacteria 1628
250 Ga0307516_10430254 3300031730 Bacteria 977
251 Ga0307516_10459824 3300031730 Bacteria 928
252 Ga0307405_10162738 3300031731 Bacteria 1583
253 Ga0307410_10559352 3300031852 Bacteria 949
254 Ga0307410_11114652 3300031852 Bacteria 685
255 Ga0307410_12061465 3300031852 Bacteria 510
256 Ga0307406_10440261 3300031901 Bacteria 1043
257 Ga0307412_10307399 3300031911 Bacteria 1256
258 Ga0307409_100864706 3300031995 Bacteria 916
259 Ga0307416_100283401 3300032002 Bacteria 1635
260 Ga0307414_11221227 3300032004 Bacteria 696
261 Ga0307411_10000087 3300032005 Bacteria 28540
262 Ga0307411_10099973 3300032005 Bacteria 2049
263 Ga0307415_100284439 3300032126 Bacteria 1362
264 Ga0307510_10013058 3300033180 Bacteria 9849
265 Ga0373941_0403370 3300035115 Bacteria 566
266 Ga0373925_0226977 3300037068 Bacteria 1492
267 Ga0373925_0538284 3300037068 Bacteria 960
268 Ga0395899_0019713 3300037312 Bacteria 5120
269 Ga0395900_0197969 3300037418 Bacteria 2034
270 Ga0395898_0113210 3300037466 Bacteria 2600
271 Ga0395905_0004144 3300037471 Bacteria 15172
272 Ga0395905_0014806 3300037471 Bacteria 7436
273 Ga0395905_0120696 3300037471 Bacteria 2464
274 Ga0395905_0163449 3300037471 Bacteria 2092
275 Ga0395905_0179258 3300037471 Bacteria 1989
276 Ga0395905_0645373 3300037471 Bacteria 960
277 Ga0395905_0701479 3300037471 Bacteria 914
278 Ga0395901_0093014 3300038443 Bacteria 3156
279 Ga0451793_0741937 3300041452 Bacteria 768
280 Ga0451793_1348609 3300041452 Bacteria 619
281 Ga0451795_1513579 3300041456 Unclassified 1201
282 Ga0451802_0450597 3300041460 Bacteria 526
283 Ga0451839_1513997 3300041496 Bacteria 1025
284 Ga0451851_0770704 3300041507 Bacteria 644
285 Ga0451843_1362482 3300041509 Bacteria 2226
286 Ga0451853_0507755 3300041512 Bacteria 756
287 Ga0451853_0542749 3300041512 Bacteria 964
288 Ga0439445_0126147 3300042004 Bacteria 737
289 Ga0450917_000811 3300042120 Bacteria 2307
290 Ga0450888_000125 3300042126 Bacteria 6200
291 Ga0450890_000238 3300042127 Bacteria 8252
292 Ga0450890_010914 3300042127 Bacteria 1170
293 Ga0450891_000099 3300042129 Bacteria 7345
294 Ga0450892_000278 3300042130 Bacteria 6108
295 Ga0450889_000041 3300042144 Bacteria 11391
296 Ga0450916_005069 3300042530 Bacteria 1511
297 Ga0450893_0061459 3300042532 Bacteria 717
298 Ga0451577_0071644 3300042876 Bacteria 3090
299 Ga0451577_1529030 3300042876 Unclassified 590
300 Ga0466972_0002120 3300044658 Bacteria 9740
301 Ga0453683_0672317 3300044673 Bacteria 678
302 Ga0466965_0211098 3300044683 Bacteria 1032
303 Ga0466965_0259624 3300044683 Bacteria 933
304 Ga0466961_0075678 3300044693 Bacteria 2134
305 Ga0466964_0154140 3300044706 Bacteria 1068
306 Ga0466964_0567597 3300044706 Bacteria 618
307 Ga0466960_0239381 3300044901 Bacteria 1004
308 Ga0451576_0017955 3300045051 Bacteria 7764
309 Ga0451576_0770723 3300045051 Bacteria 1010
310 Ga0451576_1019544 3300045051 Bacteria 867
311 Ga0466967_1971417 3300045976 Bacteria 581
312 Ga0495592_0000421 3300046454 Bacteria 32129
313 Ga0495638_0441474 3300046460 Bacteria 666
314 Ga0495580_0035433 3300046472 Bacteria 3589
315 Ga0495610_0130837 3300046512 Bacteria 1090
316 Ga0495632_0001485 3300046519 Bacteria 19446
317 Ga0495632_0021336 3300046519 Bacteria 3491
318 Ga0495632_0306722 3300046519 Bacteria 703
319 Ga0495643_0038648 3300046522 Bacteria 2613
320 Ga0495643_0080830 3300046522 Bacteria 1691
321 Ga0495648_0129197 3300046524 Bacteria 1346
322 Ga0495642_0172582 3300046528 Bacteria 940
323 Ga0495621_0410935 3300046539 Bacteria 575
324 Ga0495668_0096765 3300046616 Bacteria 1615
325 Ga0495625_0009057 3300046660 Bacteria 8402
326 Ga0495625_0171978 3300046660 Bacteria 1446
327 Ga0495660_0088078 3300046810 Bacteria 1618
328 Ga0495686_0075764 3300047472 Bacteria 2062
329 Ga0495602_0144137 3300048088 Bacteria 1882
330 Ga0495626_0204911 3300048091 Bacteria 807
331 Ga0496109_0017783 3300048912 Bacteria 6235
332 Ga0496110_0170877 3300048913 Bacteria 1972
333 Ga0496111_0154486 3300048914 Bacteria 1703
334 Ga0496121_0007596 3300048924 Bacteria 13052
335 Ga0496124_0003153 3300048927 Bacteria 20392
336 Ga0496125_0003117 3300048928 Bacteria 20619
337 Ga0496125_0277273 3300048928 Bacteria 1041
338 Ga0501322_029126 3300049538 Bacteria 515
339 Ga0501043_0031313 3300049579 Bacteria 4182
340 Ga0501067_0835032 3300049583 Bacteria 519
341 Ga0501206_049381 3300049653 Bacteria 667
342 Ga0501235_008853 3300049669 Bacteria 2194
343 Ga0501221_000089 3300049704 Bacteria 10670
344 Ga0501225_0056170 3300049705 Bacteria 1102
345 Ga0501229_002145 3300049706 Bacteria 2315
346 Ga0501079_1104308 3300049741 Bacteria 625
347 Ga0501267_005496 3300049764 Bacteria 1200
348 Ga0501272_006808 3300049769 Bacteria 1228
349 Ga0501045_0995286 3300049824 Bacteria 615
350 nmdc:mga03683_281457_c1 3300050489 Bacteria 777
351 nmdc:mga03683_34660_c1 3300050489 Bacteria 2044
352 nmdc:mga03683_55509_c1 3300050489 Bacteria 1664
353 nmdc:mga03n38_224011_c1 3300050490 Bacteria 983
354 nmdc:mga00v17_20043_c1 3300050491 Bacteria 3826
355 nmdc:mga0yw44_222484_c1 3300050492 Bacteria 1251
356 nmdc:mga0k408_150879_c1 3300050493 Bacteria 1384
357 nmdc:mga0k408_152982_c1 3300050493 Bacteria 1374
358 nmdc:mga0k408_156855_c1 3300050493 Bacteria 1356
359 nmdc:mga0k408_192081_c1 3300050493 Bacteria 1218
360 nmdc:mga0k408_27118_c1 3300050493 Bacteria 3252
361 nmdc:mga0k408_32766_c1 3300050493 Bacteria 2969
362 nmdc:mga0k408_49369_c1 3300050493 Bacteria 2435
363 nmdc:mga0k408_596923_c1 3300050493 Bacteria 651
364 nmdc:mga0k408_597965_c1 3300050493 Bacteria 651
365 nmdc:mga0k408_6822_c1 3300050493 Bacteria 6089
366 nmdc:mga06z11_38946_c1 3300050494 Bacteria 2364
367 nmdc:mga06z11_418816_c1 3300050494 Bacteria 807
368 nmdc:mga04h51_13087_c1 3300050495 Bacteria 2343
369 nmdc:mga04h51_189297_c1 3300050495 Bacteria 804
370 nmdc:mga07m45_271549_c1 3300050496 Bacteria 986
371 nmdc:mga07m45_33751_c1 3300050496 Bacteria 2843
372 nmdc:mga07m45_4979_c1 3300050496 Bacteria 6560
373 nmdc:mga07m45_5867_c1 3300050496 Bacteria 6164
374 nmdc:mga07m45_65155_c1 3300050496 Bacteria 2069
375 nmdc:mga07m45_71381_c1 3300050496 Bacteria 1976
376 nmdc:mga07m45_902139_c1 3300050496 Bacteria 506
377 nmdc:mga09592_12002_c1 3300050508 Bacteria 7048
378 nmdc:mga09592_434587_c1 3300050508 Bacteria 1133
379 nmdc:mga0qj67_66724_c1 3300050509 Bacteria 2264
380 nmdc:mga0sz30_100777_c1 3300050516 Bacteria 1261
381 nmdc:mga0sz30_248932_c1 3300050516 Bacteria 791
382 nmdc:mga0sz30_25734_c1 3300050516 Bacteria 2408
383 Ga0495655_0242511 3300053083 Bacteria 604
384 Ga0500647_0446266 3300053091 Bacteria 513
385 Ga0500583_0313514 3300053092 Bacteria 766
386 Ga0500651_0577363 3300053093 Bacteria 612
387 Ga0500559_0453523 3300053136 Bacteria 593
388 Ga0500564_042237 3300053138 Bacteria 2097
389 Ga0500619_061051 3300053154 Bacteria 1240
390 Ga0500587_006995 3300053739 Bacteria 1479
391 Ga0466962_0329973 3300061719 Bacteria 758
392 2587759736 2585428062 Bacteria 6842168
393 2643746892 2643221544 Bacteria 5886209
394 2643935563 2643221585 Bacteria 5812563
395 2644139478 2643221625 Bacteria 6512927
396 2644221025 2643221639 Bacteria 6649903
397 2644272292 2643221648 Bacteria 6521465
398 2644317346 2643221656 Bacteria 5809961
399 2834644196 2834641062 Bacteria 5559922
400 8003401900 8003400568 Bacteria 5535898
401 Ga0495590_0011093
402 rootH1_10016154
403 rootH1_10048792
404 rootH1_10103668
405 rootH2_10302748
406 rootL2_10029916
407 rootL2_10038151
408 rootH1_10022985
409 rootH1_10183195
410 Ga0055531_10000134
411 Ga0055543_1003274
412 Ga0065165_1000233
413 Ga0065707_10900120
414 Ga0070676_10561310
415 Ga0070670_100638443
416 Ga0068869_100843298
417 Ga0068869_101394285
418 Ga0068868_100050943
419 Ga0068868_100198372
420 Ga0068868_101541612
421 Ga0070689_100218136
422 Ga0070687_100059572
423 Ga0070669_100208837
424 Ga0070675_100174358
425 Ga0070671_100013732
426 Ga0070671_100031634
427 Ga0070674_100124067
428 Ga0070674_100362240
429 Ga0070659_100093268
430 Ga0070667_100071445
431 Ga0070667_100306892
432 Ga0070667_101003480
433 Ga0070667_101068549
434 Ga0070667_102212909
435 Ga0070700_100021124
436 Ga0070700_100844802
437 Ga0070663_100535200
438 Ga0070678_100275132
439 Ga0068867_100002610
440 Ga0068867_100071873
441 Ga0068867_100107165
442 Ga0070706_100000789
443 Ga0070707_100115017
444 Ga0070707_100451554
445 Ga0070698_100105217
446 Ga0070699_100171430
447 Ga0070672_100007169
448 Ga0070672_100099033
449 Ga0070686_100569710
450 Ga0070665_100038803
451 Ga0070665_100060190
452 Ga0068856_100256370
453 Ga0070702_100421807
454 Ga0070702_100524953
455 Ga0068852_100259637
456 Ga0068859_100028152
457 Ga0068859_100734794
458 Ga0068864_100054499
459 Ga0068864_100166616
460 Ga0068866_10361705
461 Ga0068861_100002798
462 Ga0068861_100695505
463 Ga0068861_101404936
464 Ga0068870_10317172
465 Ga0068863_100074081
466 Ga0068863_100156062
467 Ga0068863_100951598
468 Ga0068863_101184812
469 Ga0068858_100027233
470 Ga0068858_100596459
471 Ga0068860_100001383
472 Ga0068860_100014759
473 Ga0068860_100056671
474 Ga0068862_100003437
475 Ga0068862_100043169
476 Ga0068862_100209370
477 Ga0075365_10083799
478 Ga0075368_10024741
479 Ga0075368_10087155
480 Ga0075363_100297930
481 Ga0075363_100783904
482 Ga0075364_10157623
483 Ga0075362_10022343
484 Ga0075362_10086422
485 Ga0075362_10444739
486 Ga0075367_10098841
487 Ga0075367_10432713
488 Ga0075369_10069088
489 Ga0075369_10262827
490 Ga0075366_10005152
491 Ga0075366_10017365
492 Ga0075366_10033642
493 Ga0075366_10052758
494 Ga0075366_10059146
495 Ga0075366_10138162
496 Ga0075366_10159819
497 Ga0075366_10161528
498 Ga0075366_10170427
499 Ga0075366_10288793
500 Ga0075366_10424046
501 Ga0075366_10530801
502 Ga0097621_100173266
503 Ga0097621_100470912
504 Ga0075370_10002077
505 Ga0075370_10004911
506 Ga0075370_10025900
507 Ga0075370_10040147
508 Ga0075370_10041452
509 Ga0075370_10091360
510 Ga0075370_10742394
511 Ga0075430_100020831
512 Ga0075429_100000422
513 Ga0075429_100465327
514 Ga0068865_100115792
515 Ga0097620_100028153
516 Ga0097620_100734774
517 Ga0105245_10008948
518 Ga0105245_10047974
519 Ga0105245_10729554
520 Ga0105243_10019900
521 Ga0105243_10057970
522 Ga0105243_10560438
523 Ga0105248_10075522
524 Ga0105249_10604465
525 Ga0105249_10674051
526 Ga0105249_10902078
527 Ga0105249_10972938
528 Ga0105239_11762353
529 Ga0105246_10355378
530 Ga0157315_1049999
531 Ga0157374_10037033
532 Ga0157374_10243980
533 Ga0157378_10053004
534 Ga0163162_10004516
535 Ga0157375_10034805
536 Ga0157375_10109336
537 Ga0157375_10120500
538 Ga0157375_10854883
539 Ga0157380_10017649
540 Ga0157380_10060700
541 Ga0157379_10020498
542 Ga0157379_10063850
543 Ga0157379_10148571
544 Ga0157379_10274037
545 Ga0157379_10854740
546 Ga0157376_12261176
547 Ga0163161_10079450
548 Ga0163161_10869242
549 Ga0206351_10747366
550 Ga0209050_1004512
551 Ga0209051_1001621
552 Ga0209051_1002692
553 Ga0209257_1000053
554 Ga0207682_10012985
555 Ga0207642_10323279
556 Ga0207643_10271567
557 Ga0207684_10003750
558 Ga0207671_10072885
559 Ga0207662_10073547
560 Ga0207662_11236169
561 Ga0207646_10717745
562 Ga0207650_10404640
563 Ga0207650_10792137
564 Ga0207659_10067736
565 Ga0207687_10081249
566 Ga0207687_10166183
567 Ga0207687_10393323
568 Ga0207644_10016582
569 Ga0207644_10069917
570 Ga0207686_10362109
571 Ga0207709_10042763
572 Ga0207709_10073130
573 Ga0207709_10111752
574 Ga0207709_10416784
575 Ga0207670_10162206
576 Ga0207669_10081671
577 Ga0207704_10002656
578 Ga0207704_10860022
579 Ga0207691_10018133
580 Ga0207691_10221806
581 Ga0207711_10095196
582 Ga0207689_10571898
583 Ga0207689_11052410
584 Ga0207712_10213583
585 Ga0207712_10743601
586 Ga0207668_10058928
587 Ga0207640_10376975
588 Ga0207658_10010318
589 Ga0207658_10095762
590 Ga0207658_10246304
591 Ga0207658_10937922
592 Ga0207658_11169164
593 Ga0207677_10204710
594 Ga0207677_10466316
595 Ga0207677_10609505
596 Ga0207703_10008960
597 Ga0207703_10462402
598 Ga0207639_10056990
599 Ga0207678_10527475
600 Ga0207678_10795330
601 Ga0207708_10053750
602 Ga0207702_10270487
603 Ga0207641_10017347
604 Ga0207641_10938030
605 Ga0207648_10000799
606 Ga0207648_10067429
607 Ga0207648_10094332
608 Ga0207648_10503496
609 Ga0207648_12211408
610 Ga0207676_10015965
611 Ga0207676_10038658
612 Ga0207676_11219887
613 Ga0207674_10292029
614 Ga0207675_100003220
615 Ga0207675_101100213
616 Ga0207675_101668305
617 Ga0207683_10929940
618 Ga0207698_10412689
619 Ga0209813_10072026
620 Ga0209813_10215436
621 Ga0268266_10082295
622 Ga0268265_10118348
623 Ga0268265_10138558
624 Ga0268265_10179555
625 Ga0268264_10002625
626 Ga0268264_10011276
627 Ga0268264_10080098
628 Ga0268264_11643711
629 Ga0307517_10094857
630 Ga0307515_10015833
631 Ga0307515_10060390
632 Ga0307515_10148170
633 Ga0307515_10279419
634 Ga0307512_10025373
635 Ga0307513_10015205
636 Ga0307513_10089310
637 Ga0307513_10133169
638 Ga0307509_10147867
639 Ga0307408_100535837
640 Ga0307408_100582792
641 Ga0307408_101680992
642 Ga0307408_102207479
643 Ga0307508_10034866
644 Ga0307508_10093023
645 Ga0307508_10238789
646 Ga0307514_10521340
647 Ga0307516_10013229
648 Ga0307516_10216332
649 Ga0307516_10430254
650 Ga0307516_10459824
651 Ga0307405_10162738
652 Ga0307410_10559352
653 Ga0307410_11114652
654 Ga0307410_12061465
655 Ga0307406_10440261
656 Ga0307412_10307399
657 Ga0307409_100864706
658 Ga0307416_100283401
659 Ga0307414_11221227
660 Ga0307411_10000087
661 Ga0307411_10099973
662 Ga0307415_100284439
663 Ga0307510_10013058
664 Ga0373941_0403370
665 Ga0373925_0226977
666 Ga0373925_0538284
667 Ga0395899_0019713
668 Ga0395900_0197969
669 Ga0395898_0113210
670 Ga0395905_0004144
671 Ga0395905_0014806
672 Ga0395905_0120696
673 Ga0395905_0163449
674 Ga0395905_0179258
675 Ga0395905_0645373
676 Ga0395905_0701479
677 Ga0395901_0093014
678 Ga0451793_0741937
679 Ga0451793_1348609
680 Ga0451795_1513579
681 Ga0451802_0450597
682 Ga0451839_1513997
683 Ga0451851_0770704
684 Ga0451843_1362482
685 Ga0451853_0507755
686 Ga0451853_0542749
687 Ga0439445_0126147
688 Ga0450917_000811
689 Ga0450888_000125
690 Ga0450890_000238
691 Ga0450890_010914
692 Ga0450891_000099
693 Ga0450892_000278
694 Ga0450889_000041
695 Ga0450916_005069
696 Ga0450893_0061459
697 Ga0451577_0071644
698 Ga0451577_1529030
699 Ga0466972_0002120
700 Ga0453683_0672317
701 Ga0466965_0211098
702 Ga0466965_0259624
703 Ga0466961_0075678
704 Ga0466964_0154140
705 Ga0466964_0567597
706 Ga0466960_0239381
707 Ga0451576_0017955
708 Ga0451576_0770723
709 Ga0451576_1019544
710 Ga0466967_1971417
711 Ga0495592_0000421
712 Ga0495638_0441474
713 Ga0495580_0035433
714 Ga0495610_0130837
715 Ga0495632_0001485
716 Ga0495632_0021336
717 Ga0495632_0306722
718 Ga0495643_0038648
719 Ga0495643_0080830
720 Ga0495648_0129197
721 Ga0495642_0172582
722 Ga0495621_0410935
723 Ga0495668_0096765
724 Ga0495625_0009057
725 Ga0495625_0171978
726 Ga0495660_0088078
727 Ga0495686_0075764
728 Ga0495602_0144137
729 Ga0495626_0204911
730 Ga0496109_0017783
731 Ga0496110_0170877
732 Ga0496111_0154486
733 Ga0496121_0007596
734 Ga0496124_0003153
735 Ga0496125_0003117
736 Ga0496125_0277273
737 Ga0501322_029126
738 Ga0501043_0031313
739 Ga0501067_0835032
740 Ga0501206_049381
741 Ga0501235_008853
742 Ga0501221_000089
743 Ga0501225_0056170
744 Ga0501229_002145
745 Ga0501079_1104308
746 Ga0501267_005496
747 Ga0501272_006808
748 Ga0501045_0995286
749 nmdc:mga03683_281457_c1
750 nmdc:mga03683_34660_c1
751 nmdc:mga03683_55509_c1
752 nmdc:mga03n38_224011_c1
753 nmdc:mga00v17_20043_c1
754 nmdc:mga0yw44_222484_c1
755 nmdc:mga0k408_150879_c1
756 nmdc:mga0k408_152982_c1
757 nmdc:mga0k408_156855_c1
758 nmdc:mga0k408_192081_c1
759 nmdc:mga0k408_27118_c1
760 nmdc:mga0k408_32766_c1
761 nmdc:mga0k408_49369_c1
762 nmdc:mga0k408_596923_c1
763 nmdc:mga0k408_597965_c1
764 nmdc:mga0k408_6822_c1
765 nmdc:mga06z11_38946_c1
766 nmdc:mga06z11_418816_c1
767 nmdc:mga04h51_13087_c1
768 nmdc:mga04h51_189297_c1
769 nmdc:mga07m45_271549_c1
770 nmdc:mga07m45_33751_c1
771 nmdc:mga07m45_4979_c1
772 nmdc:mga07m45_5867_c1
773 nmdc:mga07m45_65155_c1
774 nmdc:mga07m45_71381_c1
775 nmdc:mga07m45_902139_c1
776 nmdc:mga09592_12002_c1
777 nmdc:mga09592_434587_c1
778 nmdc:mga0qj67_66724_c1
779 nmdc:mga0sz30_100777_c1
780 nmdc:mga0sz30_248932_c1
781 nmdc:mga0sz30_25734_c1
782 Ga0495655_0242511
783 Ga0500647_0446266
784 Ga0500583_0313514
785 Ga0500651_0577363
786 Ga0500559_0453523
787 Ga0500564_042237
788 Ga0500619_061051
789 Ga0500587_006995
790 Ga0466962_0329973
791 2587759736
792 2643746892
793 2643935563
794 2644139478
795 2644221025
796 2644272292
797 2644317346
798 2834644196
799 8003401900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

51

150

0.94

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

56

136

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lum-assembly2.cif.gz_C alpha-crystallin domain of human hspb6 patched with its n-terminal peptide 0.8621 37 116
4m5t-assembly3.cif.gz_E disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.8392 28 116
6bp9-assembly1.cif.gz_B hspb5 alpha-crystallin domain mutant r120g-acd 0.8331 30 117
2y22-assembly1.cif.gz_A human alphab-crystallin domain (residues 67-157) 0.8315 28 116
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8309 24 115
ID Description Score Start End Superfamily
af_I1M7E1_1_101_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8674 21 115 2.60.40.790
af_B6TR54_18_129_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8639 26 117 2.60.40.790
af_F4HWW7_1_102_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8632 21 115 2.60.40.790
af_A0A144A1J3_25_143_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8577 23 116 2.60.40.790
af_F1QZY5_45_141_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8512 25 118 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A0D9YNV8-F1-model_v4 SHSP domain-containing protein 0.8783 22 125 GO:0009408
AF-A0A1G3KWX4-F1-model_v4 SHSP domain-containing protein 0.8583 21 127
AF-A0A421K594-F1-model_v4 Heat-shock protein 0.8474 16 129 GO:0009408
AF-D5BZM4-F1-model_v4 Heat shock protein Hsp20 0.8426 16 127
AF-A0A1F8ZT18-F1-model_v4 Heat-shock protein Hsp20 0.8421 24 127

Map