F434372

General Info

Members Datasets Scaffolds Average Seq Length
399 202 399 134

Family's Representative Sequence

Representative Sequence 3300046473|Ga0495582_0491931|Ga0495582_0491931_144_557
Length 137
Sequence LATVATMADLDELALGLPQVTKELSDDGRPSYQVHGKMFCFHRGRRPDAVDPDTGERLSDVLMFRVTDLEEKELLLASGGVYFTTPHFKGYPAVLVRIPDLDRLSRDELQDLVVDAWLSRAQKRVAKAWLAANEPGD

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
100 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
101 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
102 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
103 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
104 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
105 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
106 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 15.54
Rhizosphere 83.71
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10125932 3300005327 Bacteria 2132
2 Ga0070683_100013281 3300005329 Bacteria 7179
3 Ga0070683_100107422 3300005329 Bacteria 2631
4 Ga0070680_100004550 3300005336 Bacteria 10424
5 Ga0070682_100099441 3300005337 Bacteria 1918
6 Ga0070660_100001247 3300005339 Bacteria 17309
7 Ga0070687_100598872 3300005343 Bacteria 757
8 Ga0070661_100852901 3300005344 Bacteria 750
9 Ga0070668_100340968 3300005347 Bacteria 1266
10 Ga0070673_100264738 3300005364 Bacteria 1503
11 Ga0070703_10092587 3300005406 Bacteria 1051
12 Ga0070714_100183009 3300005435 Bacteria 1907
13 Ga0070714_100441191 3300005435 Bacteria 1235
14 Ga0070713_100081284 3300005436 Bacteria 2765
15 Ga0070713_100114203 3300005436 Bacteria 2359
16 Ga0070710_10122680 3300005437 Bacteria 1574
17 Ga0070710_10130981 3300005437 Bacteria 1529
18 Ga0070710_10704647 3300005437 Bacteria 713
19 Ga0070705_100030600 3300005440 Bacteria 2973
20 Ga0070700_100230503 3300005441 Bacteria 1318
21 Ga0070663_100772129 3300005455 Bacteria 822
22 Ga0070678_100214467 3300005456 Bacteria 1597
23 Ga0070681_10201704 3300005458 Bacteria 1907
24 Ga0070681_10714002 3300005458 Unclassified 918
25 Ga0070685_10026307 3300005466 Bacteria 3206
26 Ga0070679_100051799 3300005530 Bacteria 4089
27 Ga0070679_100158161 3300005530 Bacteria 2240
28 Ga0070679_100203955 3300005530 Bacteria 1942
29 Ga0070679_100544333 3300005530 Bacteria 1104
30 Ga0070684_100000317 3300005535 Bacteria 33255
31 Ga0070684_100001562 3300005535 Bacteria 16525
32 Ga0070684_100019782 3300005535 Bacteria 5575
33 Ga0070684_100213878 3300005535 Bacteria 1757
34 Ga0070697_100327781 3300005536 Bacteria 1319
35 Ga0068853_100978770 3300005539 Bacteria 814
36 Ga0070672_100376817 3300005543 Bacteria 1213
37 Ga0070672_100451501 3300005543 Bacteria 1107
38 Ga0070686_100039159 3300005544 Bacteria 2952
39 Ga0070695_100012517 3300005545 Bacteria 5091
40 Ga0070695_100120857 3300005545 Bacteria 1792
41 Ga0070696_100204211 3300005546 Bacteria 1476
42 Ga0070693_100027128 3300005547 Bacteria 3099
43 Ga0070693_100080310 3300005547 Bacteria 1943
44 Ga0070693_100917063 3300005547 Unclassified 657
45 Ga0070704_100006852 3300005549 Bacteria 6748
46 Ga0068855_100543237 3300005563 Bacteria 1259
47 Ga0068855_100555407 3300005563 Bacteria 1242
48 Ga0070664_100022828 3300005564 Bacteria 5161
49 Ga0070664_100146847 3300005564 Unclassified 2080
50 Ga0068857_100000561 3300005577 Bacteria 27093
51 Ga0068857_100069652 3300005577 Unclassified 3133
52 Ga0068857_100073950 3300005577 Bacteria 3037
53 Ga0068854_100073921 3300005578 Bacteria 2499
54 Ga0068856_100100706 3300005614 Bacteria 2882
55 Ga0068856_100394898 3300005614 Bacteria 1403
56 Ga0068852_100311434 3300005616 Bacteria 1526
57 Ga0068851_10468869 3300005834 Bacteria 751
58 Ga0068863_101131217 3300005841 Bacteria 788
59 Ga0081455_10040073 3300005937 Bacteria 4134
60 Ga0081455_10322146 3300005937 Bacteria 1100
61 Ga0081455_10603441 3300005937 Unclassified 715
62 Ga0081538_10012008 3300005981 Bacteria 6977
63 Ga0081538_10030550 3300005981 Bacteria 3655
64 Ga0081538_10069274 3300005981 Bacteria 1955
65 Ga0070717_10355613 3300006028 Unclassified 1310
66 Ga0075365_10154682 3300006038 Unclassified 1596
67 Ga0070715_10005066 3300006163 Bacteria 4371
68 Ga0070716_100206527 3300006173 Bacteria 1309
69 Ga0070716_100361119 3300006173 Bacteria 1031
70 Ga0070712_100078499 3300006175 Bacteria 2383
71 Ga0070712_100382489 3300006175 Bacteria 1159
72 Ga0075433_10000289 3300006852 Bacteria 30082
73 Ga0075433_10138838 3300006852 Bacteria 2160
74 Ga0075433_10816382 3300006852 Bacteria 815
75 Ga0075434_100000777 3300006871 Bacteria 25288
76 Ga0075434_100010740 3300006871 Bacteria 8600
77 Ga0075436_100043903 3300006914 Bacteria 3081
78 Ga0075436_100076274 3300006914 Bacteria 2321
79 Ga0075435_100380793 3300007076 Bacteria 1212
80 Ga0105240_10035806 3300009093 Bacteria 6392
81 Ga0105240_10392255 3300009093 Bacteria 1565
82 Ga0105245_10035790 3300009098 Bacteria 4407
83 Ga0105245_10368395 3300009098 Unclassified 1428
84 Ga0105245_10485322 3300009098 Bacteria 1250
85 Ga0105245_10604049 3300009098 Bacteria 1124
86 Ga0105245_11048536 3300009098 Unclassified 861
87 Ga0114129_10275165 3300009147 Bacteria 2251
88 Ga0105243_10144025 3300009148 Bacteria 2037
89 Ga0105243_10192611 3300009148 Bacteria 1782
90 Ga0105243_10353671 3300009148 Bacteria 1350
91 Ga0105243_11371145 3300009148 Unclassified 727
92 Ga0105243_11933693 3300009148 Bacteria 623
93 Ga0105241_10177000 3300009174 Bacteria 1766
94 Ga0105242_10539253 3300009176 Bacteria 1116
95 Ga0105238_10106797 3300009551 Bacteria 2781
96 Ga0105238_10315347 3300009551 Bacteria 1549
97 Ga0105238_12244192 3300009551 Bacteria 581
98 Ga0105249_10463778 3300009553 Bacteria 1307
99 Ga0105239_10402367 3300010375 Bacteria 1549
100 Ga0105246_10137104 3300011119 Bacteria 1835
101 Ga0105246_10685049 3300011119 Bacteria 896
102 Ga0157370_10005142 3300013104 Bacteria 14750
103 Ga0157369_10002414 3300013105 Bacteria 22442
104 Ga0157369_10148690 3300013105 Bacteria 2476
105 Ga0157369_10687040 3300013105 Unclassified 1054
106 Ga0157374_10076029 3300013296 Bacteria 3174
107 Ga0157374_11149245 3300013296 Bacteria 797
108 Ga0157378_10060591 3300013297 Bacteria 3377
109 Ga0157378_10488903 3300013297 Bacteria 1227
110 Ga0163162_10706316 3300013306 Bacteria 1130
111 Ga0157372_10054414 3300013307 Bacteria 4464
112 Ga0157372_10299158 3300013307 Bacteria 1872
113 Ga0157372_12288531 3300013307 Bacteria 621
114 Ga0163163_10642867 3300014325 Bacteria 1124
115 Ga0157379_11887790 3300014968 Bacteria 588
116 Ga0157376_10614606 3300014969 Bacteria 1083
117 Ga0157376_11187158 3300014969 Bacteria 791
118 Ga0206354_11523398 3300020081 Bacteria 2122
119 Ga0206353_10092031 3300020082 Bacteria 2804
120 Ga0206353_11440038 3300020082 Bacteria 1206
121 Ga0224712_10027095 3300022467 Bacteria 2035
122 Ga0207656_10402128 3300025321 Bacteria 688
123 Ga0207685_10286974 3300025905 Bacteria 810
124 Ga0207705_10107068 3300025909 Bacteria 2062
125 Ga0207707_10096145 3300025912 Bacteria 2589
126 Ga0207707_10175192 3300025912 Bacteria 1874
127 Ga0207695_10211221 3300025913 Bacteria 1851
128 Ga0207695_10356769 3300025913 Bacteria 1349
129 Ga0207671_10679921 3300025914 Bacteria 819
130 Ga0207693_10173480 3300025915 Bacteria 1697
131 Ga0207693_10194308 3300025915 Unclassified 1596
132 Ga0207663_10703735 3300025916 Bacteria 800
133 Ga0207660_10113726 3300025917 Bacteria 2040
134 Ga0207660_10115991 3300025917 Bacteria 2022
135 Ga0207657_10007251 3300025919 Bacteria 11385
136 Ga0207652_10180821 3300025921 Bacteria 1895
137 Ga0207652_10217256 3300025921 Bacteria 1722
138 Ga0207652_10605193 3300025921 Bacteria 982
139 Ga0207694_10075873 3300025924 Bacteria 2632
140 Ga0207687_10014632 3300025927 Bacteria 5136
141 Ga0207687_10286608 3300025927 Bacteria 1322
142 Ga0207687_10392107 3300025927 Bacteria 1140
143 Ga0207687_10895674 3300025927 Bacteria 759
144 Ga0207700_10192186 3300025928 Bacteria 1716
145 Ga0207686_10179498 3300025934 Bacteria 1500
146 Ga0207686_11211311 3300025934 Bacteria 618
147 Ga0207709_10049040 3300025935 Bacteria 2575
148 Ga0207709_10196834 3300025935 Unclassified 1436
149 Ga0207665_10018758 3300025939 Bacteria 4546
150 Ga0207691_10877695 3300025940 Bacteria 751
151 Ga0207711_11410390 3300025941 Unclassified 639
152 Ga0207679_10024200 3300025945 Bacteria 4162
153 Ga0207667_10326721 3300025949 Bacteria 1566
154 Ga0207667_10407248 3300025949 Bacteria 1385
155 Ga0207667_10473164 3300025949 Bacteria 1272
156 Ga0207640_10292716 3300025981 Bacteria 1284
157 Ga0207678_10807008 3300026067 Bacteria 829
158 Ga0207708_10423311 3300026075 Bacteria 1104
159 Ga0207648_10326890 3300026089 Unclassified 1379
160 Ga0207674_10002357 3300026116 Bacteria 23889
161 Ga0207674_10113020 3300026116 Bacteria 2689
162 Ga0207674_10227389 3300026116 Bacteria 1814
163 Ga0207683_10073787 3300026121 Bacteria 3019
164 Ga0207683_10309210 3300026121 Bacteria 1446
165 Ga0265338_10006521 3300028800 Bacteria 14840
166 Ga0265338_10325936 3300028800 Bacteria 1111
167 Ga0373930_0007911 3300034816 Bacteria 1845
168 Ga0373950_0003166 3300034818 Bacteria 2329
169 Ga0373958_0008734 3300034819 Bacteria 1650
170 Ga0373959_0004420 3300034820 Bacteria 2266
171 Ga0373928_0009091 3300035084 Bacteria 1939
172 Ga0373929_0031502 3300035085 Bacteria 1136
173 Ga0373940_0043589 3300035088 Bacteria 1240
174 Ga0373949_0004584 3300035090 Bacteria 3151
175 Ga0373932_0003076 3300035112 Bacteria 4070
176 Ga0373939_0037471 3300035114 Bacteria 1440
177 Ga0373960_0015385 3300035121 Bacteria 1952
178 Ga0373942_0013738 3300035207 Bacteria 1951
179 Ga0373961_0055081 3300035241 Bacteria 1190
180 Ga0373962_0010403 3300035242 Bacteria 2319
181 Ga0373924_0565189 3300035410 Bacteria 512
182 Ga0373931_0019400 3300035691 Unclassified 3393
183 Ga0373937_0046387 3300036401 Bacteria 3974
184 Ga0395899_0061888 3300037312 Bacteria 2756
185 Ga0395899_0104768 3300037312 Unclassified 2038
186 Ga0395899_0192858 3300037312 Bacteria 1425
187 Ga0395899_0238079 3300037312 Bacteria 1254
188 Ga0395899_0678952 3300037312 Unclassified 648
189 Ga0395900_0007576 3300037418 Bacteria 11210
190 Ga0395900_0028444 3300037418 Bacteria 5725
191 Ga0395900_0039392 3300037418 Bacteria 4869
192 Ga0395900_0284418 3300037418 Bacteria 1645
193 Ga0395900_0305212 3300037418 Bacteria 1576
194 Ga0395900_1904608 3300037418 Unclassified 505
195 Ga0395898_0008666 3300037466 Bacteria 10730
196 Ga0395898_0382068 3300037466 Bacteria 1343
197 Ga0395898_0666380 3300037466 Bacteria 983
198 Ga0395898_0746541 3300037466 Bacteria 920
199 Ga0395905_0243750 3300037471 Bacteria 1679
200 Ga0395905_0507418 3300037471 Bacteria 1106
201 Ga0395905_0749466 3300037471 Bacteria 879
202 Ga0395905_0827279 3300037471 Bacteria 829
203 Ga0395905_0973622 3300037471 Unclassified 751
204 Ga0395901_0006587 3300038443 Bacteria 11735
205 Ga0395901_0018541 3300038443 Bacteria 7105
206 Ga0395901_0044593 3300038443 Bacteria 4599
207 Ga0395901_0060579 3300038443 Bacteria 3938
208 Ga0395901_0123185 3300038443 Bacteria 2724
209 Ga0395901_0371881 3300038443 Bacteria 1472
210 Ga0395901_0764964 3300038443 Bacteria 958
211 Ga0395901_0843199 3300038443 Unclassified 902
212 Ga0395901_1899532 3300038443 Bacteria 543
213 Ga0451855_0783939 3300041511 Bacteria 627
214 Ga0451853_3664646 3300041512 Bacteria 623
215 Ga0439448_0117391 3300042005 Archaea 912
216 Ga0439440_0112697 3300042993 Bacteria 750
217 Ga0466965_0535293 3300044683 Bacteria 660
218 Ga0466961_0519990 3300044693 Bacteria 718
219 Ga0466963_0002377 3300044694 Bacteria 10512
220 Ga0466963_0002609 3300044694 Bacteria 10112
221 Ga0466963_0024654 3300044694 Bacteria 3829
222 Ga0466963_0439861 3300044694 Bacteria 920
223 Ga0466963_0645005 3300044694 Bacteria 747
224 Ga0466963_0808033 3300044694 Unclassified 661
225 Ga0466964_0096065 3300044706 Bacteria 1298
226 Ga0466971_0077105 3300044719 Bacteria 1517
227 Ga0466971_0158028 3300044719 Bacteria 1060
228 Ga0466957_0026811 3300044842 Bacteria 3420
229 Ga0466957_0071668 3300044842 Bacteria 2144
230 Ga0466957_0091752 3300044842 Bacteria 1904
231 Ga0466960_0001316 3300044901 Bacteria 9011
232 Ga0466958_0026979 3300045836 Bacteria 3396
233 Ga0466958_0029896 3300045836 Bacteria 3233
234 Ga0466958_0773330 3300045836 Unclassified 626
235 Ga0466967_0000214 3300045976 Bacteria 24584
236 Ga0466967_0005114 3300045976 Bacteria 9013
237 Ga0466967_0011845 3300045976 Bacteria 6633
238 Ga0466967_0016022 3300045976 Bacteria 5896
239 Ga0466967_0194652 3300045976 Bacteria 1917
240 Ga0466967_0274349 3300045976 Bacteria 1616
241 Ga0466967_0278176 3300045976 Bacteria 1605
242 Ga0466967_0525614 3300045976 Bacteria 1163
243 Ga0495629_0684869 3300046459 Unclassified 681
244 Ga0495653_0399665 3300046463 Bacteria 874
245 Ga0495582_0491931 3300046473 Bacteria 709
246 Ga0495608_0554537 3300046511 Bacteria 692
247 Ga0495652_0195463 3300046529 Unclassified 1540
248 Ga0495652_0859608 3300046529 Bacteria 601
249 Ga0495645_0488012 3300046543 Unclassified 772
250 Ga0495667_0047455 3300046559 Bacteria 2838
251 Ga0495659_0094276 3300046664 Bacteria 1153
252 Ga0495599_0072573 3300046678 Bacteria 2149
253 Ga0495623_0443534 3300046679 Bacteria 692
254 Ga0495658_0358789 3300046683 Bacteria 927
255 Ga0495613_0478199 3300046689 Bacteria 841
256 Ga0495581_0543687 3300047315 Bacteria 674
257 Ga0495604_0055732 3300047317 Unclassified 3046
258 Ga0495674_0204648 3300047319 Bacteria 1636
259 Ga0495602_0186749 3300048088 Unclassified 1593
260 Ga0496100_0044024 3300048903 Bacteria 2857
261 Ga0496100_0082522 3300048903 Bacteria 2174
262 Ga0496100_0091691 3300048903 Bacteria 2074
263 Ga0496100_1220433 3300048903 Unclassified 593
264 Ga0496101_0031252 3300048904 Bacteria 3741
265 Ga0496101_0032145 3300048904 Bacteria 3692
266 Ga0496101_0037003 3300048904 Bacteria 3460
267 Ga0496101_0133994 3300048904 Bacteria 1883
268 Ga0496101_0187271 3300048904 Bacteria 1596
269 Ga0496101_1332876 3300048904 Bacteria 561
270 Ga0496102_0258239 3300048905 Bacteria 1643
271 Ga0496102_0542579 3300048905 Bacteria 1085
272 Ga0496102_0687555 3300048905 Bacteria 946
273 Ga0496102_0710867 3300048905 Bacteria 928
274 Ga0496103_0051314 3300048906 Bacteria 2553
275 Ga0496103_0520521 3300048906 Bacteria 760
276 Ga0496104_0140707 3300048907 Bacteria 2318
277 Ga0496104_0184544 3300048907 Bacteria 1997
278 Ga0496104_0262161 3300048907 Bacteria 1641
279 Ga0496104_0413376 3300048907 Bacteria 1261
280 Ga0496104_1377211 3300048907 Bacteria 608
281 Ga0496105_0053097 3300048908 Bacteria 3347
282 Ga0496105_0179794 3300048908 Bacteria 1732
283 Ga0496105_0598100 3300048908 Bacteria 856
284 Ga0496106_0026206 3300048909 Bacteria 4338
285 Ga0496106_0076370 3300048909 Bacteria 2568
286 Ga0496107_0075588 3300048910 Bacteria 2452
287 Ga0496107_0096802 3300048910 Bacteria 2160
288 Ga0496107_0170758 3300048910 Bacteria 1614
289 Ga0496107_0215469 3300048910 Bacteria 1428
290 Ga0496107_0533696 3300048910 Bacteria 869
291 Ga0496107_0655191 3300048910 Unclassified 774
292 Ga0496108_0015539 3300048911 Bacteria 6208
293 Ga0496108_0481197 3300048911 Bacteria 1084
294 Ga0496108_0836012 3300048911 Bacteria 793
295 Ga0496109_0005540 3300048912 Bacteria 10574
296 Ga0496109_0018755 3300048912 Bacteria 6084
297 Ga0496109_0030546 3300048912 Bacteria 4829
298 Ga0496109_0386877 3300048912 Bacteria 1321
299 Ga0496110_0028003 3300048913 Bacteria 4835
300 Ga0496110_0251267 3300048913 Bacteria 1609
301 Ga0496110_0721806 3300048913 Bacteria 899
302 Ga0496111_0042849 3300048914 Unclassified 3251
303 Ga0496111_0102569 3300048914 Bacteria 2103
304 Ga0496112_0046370 3300048915 Bacteria 4263
305 Ga0496112_0274617 3300048915 Bacteria 1633
306 Ga0496112_0288522 3300048915 Bacteria 1587
307 Ga0496112_1184935 3300048915 Bacteria 681
308 Ga0496113_0029572 3300048916 Bacteria 3958
309 Ga0496113_0053845 3300048916 Bacteria 3009
310 Ga0496113_0650576 3300048916 Bacteria 843
311 Ga0496114_0021921 3300048917 Bacteria 5201
312 Ga0496114_0058980 3300048917 Bacteria 3206
313 Ga0496114_0070395 3300048917 Bacteria 2938
314 Ga0496114_0323905 3300048917 Unclassified 1362
315 Ga0496114_0597878 3300048917 Bacteria 973
316 Ga0496114_0943284 3300048917 Bacteria 745
317 Ga0496115_0000507 3300048918 Bacteria 30530
318 Ga0496115_0021209 3300048918 Bacteria 5016
319 Ga0496115_0031769 3300048918 Bacteria 4162
320 Ga0496115_0477767 3300048918 Bacteria 1004
321 Ga0496115_0890056 3300048918 Bacteria 687
322 Ga0501032_0976207 3300049569 Bacteria 532
323 Ga0501033_0944769 3300049570 Bacteria 578
324 Ga0501036_0234866 3300049572 Bacteria 1538
325 Ga0501036_0876256 3300049572 Bacteria 737
326 Ga0501037_0068237 3300049573 Bacteria 2589
327 Ga0501037_0173333 3300049573 Bacteria 1533
328 Ga0501038_0012423 3300049574 Bacteria 7785
329 Ga0501038_0272407 3300049574 Bacteria 1334
330 Ga0501038_0348746 3300049574 Bacteria 1153
331 Ga0501040_0088595 3300049576 Bacteria 2149
332 Ga0501040_0169423 3300049576 Bacteria 1546
333 Ga0501040_0243349 3300049576 Bacteria 1283
334 Ga0501040_0276276 3300049576 Bacteria 1200
335 Ga0501040_0759815 3300049576 Bacteria 701
336 Ga0501041_0045642 3300049577 Bacteria 2664
337 Ga0501041_0052355 3300049577 Bacteria 2489
338 Ga0501042_0506759 3300049578 Bacteria 876
339 Ga0501046_0159243 3300049580 Bacteria 1699
340 Ga0501048_0244403 3300049582 Bacteria 1273
341 Ga0501048_0765572 3300049582 Bacteria 693
342 Ga0501067_0000010 3300049583 Bacteria 123277
343 Ga0501067_0006021 3300049583 Bacteria 6722
344 Ga0501068_0000003 3300049584 Bacteria 94842
345 Ga0501069_0000123 3300049585 Bacteria 34189
346 Ga0501069_0486882 3300049585 Bacteria 735
347 Ga0501069_0777834 3300049585 Bacteria 579
348 Ga0501070_0111423 3300049586 Bacteria 2262
349 Ga0501071_0030878 3300049587 Bacteria 3792
350 Ga0501071_0080994 3300049587 Bacteria 2375
351 Ga0501071_0138876 3300049587 Bacteria 1809
352 Ga0501072_0003405 3300049588 Bacteria 11975
353 Ga0501072_0422530 3300049588 Bacteria 1056
354 Ga0501074_0236021 3300049590 Bacteria 1301
355 Ga0501075_0197673 3300049591 Bacteria 1533
356 Ga0501075_0291755 3300049591 Bacteria 1243
357 Ga0501075_0478201 3300049591 Bacteria 950
358 Ga0501076_0004911 3300049592 Bacteria 9569
359 Ga0501076_0040933 3300049592 Bacteria 3643
360 Ga0501076_0100467 3300049592 Bacteria 2331
361 Ga0501077_0039687 3300049593 Bacteria 2999
362 Ga0501077_0574778 3300049593 Bacteria 723
363 Ga0501079_0231157 3300049741 Bacteria 1444
364 Ga0501079_0271837 3300049741 Bacteria 1325
365 Ga0501079_0565056 3300049741 Bacteria 895
366 Ga0501080_0366596 3300049742 Bacteria 1299
367 Ga0501081_0102258 3300049743 Bacteria 2027
368 Ga0501081_0358155 3300049743 Bacteria 1076
369 Ga0501081_0371271 3300049743 Bacteria 1056
370 Ga0501081_0428450 3300049743 Bacteria 981
371 Ga0501044_0360613 3300049823 Bacteria 1372
372 Ga0501045_0043638 3300049824 Bacteria 3266
373 Ga0501045_0307069 3300049824 Bacteria 1181
374 nmdc:mga08y16_331812_c1 3300050511 Bacteria 1564
375 nmdc:mga0n895_1373877_c1 3300050512 Bacteria 675
376 nmdc:mga0n895_509555_c1 3300050512 Bacteria 1212
377 nmdc:mga0n895_86622_c1 3300050512 Bacteria 3129
378 nmdc:mga0rr50_39128_c1 3300050513 Bacteria 3438
379 nmdc:mga0rr50_414067_c1 3300050513 Bacteria 1140
380 nmdc:mga08x19_34593_c1 3300050514 Bacteria 3195
381 nmdc:mga08x19_63202_c1 3300050514 Bacteria 2402
382 nmdc:mga0a205_295383_c1 3300050515 Bacteria 1494
383 nmdc:mga0a205_862808_c1 3300050515 Bacteria 752
384 nmdc:mga0a205_88869_c1 3300050515 Bacteria 2987
385 Ga0495601_0069876 3300053077 Bacteria 2240
386 Ga0495601_0263999 3300053077 Bacteria 1124
387 Ga0495612_0056955 3300053078 Unclassified 1614
388 Ga0495619_0160931 3300053085 Bacteria 1550
389 Ga0501084_0096359 3300054114 Bacteria 2485
390 Ga0501084_0128769 3300054114 Bacteria 2131
391 Ga0501084_0299842 3300054114 Bacteria 1357
392 Ga0501084_0315679 3300054114 Bacteria 1320
393 Ga0501082_0225326 3300060353 Bacteria 1631
394 Ga0501082_0657364 3300060353 Bacteria 917
395 Ga0466962_0048429 3300061719 Bacteria 2031
396 Ga0466962_0049728 3300061719 Bacteria 2004
397 Ga0530510_0008944 3300061734 Bacteria 7015
398 Ga0530510_0665953 3300061734 Bacteria 793
399 Ga0530510_0706176 3300061734 Bacteria 768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100441191 Ga0070714_1004411912 122
2 3300005437 Ga0070710_10122680 Ga0070710_101226803 122
3 3300005543 Ga0070672_100451501 Ga0070672_1004515012 122
4 3300025940 Ga0207691_10877695 Ga0207691_108776952 122
5 3300048907 Ga0496104_1377211 Ga0496104_1377211_91_489 122
6 3300048908 Ga0496105_0179794 Ga0496105_0179794_515_913 122
7 3300048910 Ga0496107_0533696 Ga0496107_0533696_350_748 122
8 3300048911 Ga0496108_0481197 Ga0496108_0481197_13_411 122
9 3300005406 Ga0070703_10092587 Ga0070703_100925873 124
10 3300005435 Ga0070714_100183009 Ga0070714_1001830094 124
11 3300005440 Ga0070705_100030600 Ga0070705_1000306005 124
12 3300005536 Ga0070697_100327781 Ga0070697_1003277811 124
13 3300005545 Ga0070695_100012517 Ga0070695_1000125178 124
14 3300005546 Ga0070696_100204211 Ga0070696_1002042111 124
15 3300005547 Ga0070693_100080310 Ga0070693_1000803103 124
16 3300005549 Ga0070704_100006852 Ga0070704_1000068528 124
17 3300006163 Ga0070715_10005066 Ga0070715_100050666 124
18 3300006173 Ga0070716_100206527 Ga0070716_1002065272 124
19 3300006173 Ga0070716_100361119 Ga0070716_1003611192 124
20 3300006852 Ga0075433_10138838 Ga0075433_101388382 124
21 3300013297 Ga0157378_10488903 Ga0157378_104889032 124
22 3300025905 Ga0207685_10286974 Ga0207685_102869742 124
23 3300025927 Ga0207687_10895674 Ga0207687_108956742 124
24 3300025939 Ga0207665_10018758 Ga0207665_100187587 124
25 3300026121 Ga0207683_10309210 Ga0207683_103092102 124
26 3300034816 Ga0373930_0007911 Ga0373930_0007911_674_1072 124
27 3300034819 Ga0373958_0008734 Ga0373958_0008734_266_664 124
28 3300035084 Ga0373928_0009091 Ga0373928_0009091_80_478 124
29 3300035085 Ga0373929_0031502 Ga0373929_0031502_358_756 124
30 3300035088 Ga0373940_0043589 Ga0373940_0043589_695_1093 124
31 3300035090 Ga0373949_0004584 Ga0373949_0004584_136_534 124
32 3300035112 Ga0373932_0003076 Ga0373932_0003076_2166_2564 124
33 3300035114 Ga0373939_0037471 Ga0373939_0037471_872_1270 124
34 3300035121 Ga0373960_0015385 Ga0373960_0015385_506_904 124
35 3300035207 Ga0373942_0013738 Ga0373942_0013738_780_1178 124
36 3300035241 Ga0373961_0055081 Ga0373961_0055081_266_664 124
37 3300035242 Ga0373962_0010403 Ga0373962_0010403_349_747 124
38 3300035691 Ga0373931_0019400 Ga0373931_0019400_779_1177 124
39 3300048904 Ga0496101_0133994 Ga0496101_0133994_1110_1508 124
40 3300048905 Ga0496102_0542579 Ga0496102_0542579_627_1025 124
41 3300048912 Ga0496109_0386877 Ga0496109_0386877_297_695 124
42 3300048914 Ga0496111_0042849 Ga0496111_0042849_305_703 124
43 3300048916 Ga0496113_0053845 Ga0496113_0053845_2217_2615 124
44 3300048917 Ga0496114_0070395 Ga0496114_0070395_656_1054 124
45 3300048918 Ga0496115_0021209 Ga0496115_0021209_296_694 124
46 3300006914 Ga0075436_100076274 Ga0075436_1000762743 126
47 3300009147 Ga0114129_10275165 Ga0114129_102751651 126
48 3300034818 Ga0373950_0003166 Ga0373950_0003166_30_428 126
49 3300048913 Ga0496110_0251267 Ga0496110_0251267_1183_1581 126
50 3300050513 nmdc:mga0rr50_414067_c1 nmdc:mga0rr50_414067_c1_463_861 126
51 3300050514 nmdc:mga08x19_34593_c1 nmdc:mga08x19_34593_c1_2048_2446 126
52 3300050515 nmdc:mga0a205_88869_c1 nmdc:mga0a205_88869_c1_730_1128 126
53 3300005364 Ga0070673_100264738 Ga0070673_1002647383 127
54 3300009098 Ga0105245_10604049 Ga0105245_106040492 129
55 3300025927 Ga0207687_10286608 Ga0207687_102866082 129
56 3300048917 Ga0496114_0943284 Ga0496114_0943284_230_619 129
57 3300006175 Ga0070712_100382489 Ga0070712_1003824892 131
58 3300046459 Ga0495629_0684869 Ga0495629_0684869_258_653 131
59 3300048903 Ga0496100_0082522 Ga0496100_0082522_452_847 131
60 3300048904 Ga0496101_0032145 Ga0496101_0032145_3273_3668 131
61 3300048906 Ga0496103_0520521 Ga0496103_0520521_205_600 131
62 3300048908 Ga0496105_0598100 Ga0496105_0598100_123_518 131
63 3300048909 Ga0496106_0076370 Ga0496106_0076370_811_1206 131
64 3300048910 Ga0496107_0075588 Ga0496107_0075588_1092_1487 131
65 3300048915 Ga0496112_1184935 Ga0496112_1184935_71_469 131
66 3300048916 Ga0496113_0029572 Ga0496113_0029572_1889_2296 131
67 3300048917 Ga0496114_0058980 Ga0496114_0058980_2578_2973 131
68 3300048918 Ga0496115_0000507 Ga0496115_0000507_18134_18529 131
69 3300005937 Ga0081455_10040073 Ga0081455_100400733 132
70 3300034820 Ga0373959_0004420 Ga0373959_0004420_411_809 132
71 3300037312 Ga0395899_0192858 Ga0395899_0192858_391_789 132
72 3300037418 Ga0395900_0028444 Ga0395900_0028444_1405_1803 132
73 3300038443 Ga0395901_0018541 Ga0395901_0018541_2748_3146 132
74 3300048912 Ga0496109_0005540 Ga0496109_0005540_7620_8021 133
75 3300005344 Ga0070661_100852901 Ga0070661_1008529012 134
76 3300005436 Ga0070713_100114203 Ga0070713_1001142032 134
77 3300005437 Ga0070710_10130981 Ga0070710_101309811 134
78 3300005441 Ga0070700_100230503 Ga0070700_1002305032 134
79 3300005455 Ga0070663_100772129 Ga0070663_1007721292 134
80 3300005456 Ga0070678_100214467 Ga0070678_1002144672 134
81 3300005458 Ga0070681_10201704 Ga0070681_102017042 134
82 3300005466 Ga0070685_10026307 Ga0070685_100263072 134
83 3300005530 Ga0070679_100158161 Ga0070679_1001581611 134
84 3300005530 Ga0070679_100203955 Ga0070679_1002039551 134
85 3300005535 Ga0070684_100000317 Ga0070684_1000003175 134
86 3300005535 Ga0070684_100213878 Ga0070684_1002138783 134
87 3300005539 Ga0068853_100978770 Ga0068853_1009787702 134
88 3300005544 Ga0070686_100039159 Ga0070686_1000391593 134
89 3300005545 Ga0070695_100120857 Ga0070695_1001208571 134
90 3300005547 Ga0070693_100027128 Ga0070693_1000271283 134
91 3300005547 Ga0070693_100917063 Ga0070693_1009170632 134
92 3300005564 Ga0070664_100022828 Ga0070664_1000228282 134
93 3300005577 Ga0068857_100000561 Ga0068857_10000056112 134
94 3300005578 Ga0068854_100073921 Ga0068854_1000739211 134
95 3300005614 Ga0068856_100100706 Ga0068856_1001007063 134
96 3300006028 Ga0070717_10355613 Ga0070717_103556131 134
97 3300009093 Ga0105240_10392255 Ga0105240_103922551 134
98 3300009098 Ga0105245_10368395 Ga0105245_103683952 134
99 3300009148 Ga0105243_10144025 Ga0105243_101440252 134
100 3300009148 Ga0105243_10353671 Ga0105243_103536713 134
101 3300009148 Ga0105243_11933693 Ga0105243_119336931 134
102 3300009176 Ga0105242_10539253 Ga0105242_105392532 134
103 3300009551 Ga0105238_10315347 Ga0105238_103153471 134
104 3300010375 Ga0105239_10402367 Ga0105239_104023671 134
105 3300011119 Ga0105246_10137104 Ga0105246_101371042 134
106 3300013307 Ga0157372_12288531 Ga0157372_122885311 134
107 3300014969 Ga0157376_11187158 Ga0157376_111871582 134
108 3300025912 Ga0207707_10175192 Ga0207707_101751922 134
109 3300025913 Ga0207695_10356769 Ga0207695_103567691 134
110 3300025914 Ga0207671_10679921 Ga0207671_106799211 134
111 3300025915 Ga0207693_10173480 Ga0207693_101734802 134
112 3300025917 Ga0207660_10113726 Ga0207660_101137263 134
113 3300025921 Ga0207652_10217256 Ga0207652_102172562 134
114 3300025927 Ga0207687_10392107 Ga0207687_103921072 134
115 3300025928 Ga0207700_10192186 Ga0207700_101921862 134
116 3300025934 Ga0207686_11211311 Ga0207686_112113111 134
117 3300025935 Ga0207709_10049040 Ga0207709_100490404 134
118 3300025945 Ga0207679_10024200 Ga0207679_100242004 134
119 3300025981 Ga0207640_10292716 Ga0207640_102927162 134
120 3300026067 Ga0207678_10807008 Ga0207678_108070082 134
121 3300026075 Ga0207708_10423311 Ga0207708_104233112 134
122 3300026116 Ga0207674_10002357 Ga0207674_1000235720 134
123 3300026121 Ga0207683_10073787 Ga0207683_100737874 134
124 3300035410 Ga0373924_0565189 Ga0373924_0565189_44_448 134
125 3300036401 Ga0373937_0046387 Ga0373937_0046387_2226_2630 134
126 3300044694 Ga0466963_0024654 Ga0466963_0024654_2487_2894 134
127 3300044842 Ga0466957_0091752 Ga0466957_0091752_553_960 134
128 3300045836 Ga0466958_0026979 Ga0466958_0026979_1146_1553 134
129 3300045976 Ga0466967_0000214 Ga0466967_0000214_23602_24009 134
130 3300045976 Ga0466967_0274349 Ga0466967_0274349_349_756 134
131 3300046463 Ga0495653_0399665 Ga0495653_0399665_88_492 134
132 3300046473 Ga0495582_0491931 Ga0495582_0491931_144_557 134
133 3300046511 Ga0495608_0554537 Ga0495608_0554537_182_586 134
134 3300046529 Ga0495652_0195463 Ga0495652_0195463_287_691 134
135 3300046559 Ga0495667_0047455 Ga0495667_0047455_1875_2279 134
136 3300046664 Ga0495659_0094276 Ga0495659_0094276_698_1102 134
137 3300046678 Ga0495599_0072573 Ga0495599_0072573_787_1191 134
138 3300046679 Ga0495623_0443534 Ga0495623_0443534_156_560 134
139 3300046689 Ga0495613_0478199 Ga0495613_0478199_317_721 134
140 3300047315 Ga0495581_0543687 Ga0495581_0543687_65_478 134
141 3300047317 Ga0495604_0055732 Ga0495604_0055732_2498_2902 134
142 3300047319 Ga0495674_0204648 Ga0495674_0204648_568_972 134
143 3300048905 Ga0496102_0258239 Ga0496102_0258239_204_608 134
144 3300048906 Ga0496103_0051314 Ga0496103_0051314_1929_2333 134
145 3300048910 Ga0496107_0170758 Ga0496107_0170758_1080_1484 134
146 3300048915 Ga0496112_0274617 Ga0496112_0274617_144_548 134
147 3300048918 Ga0496115_0477767 Ga0496115_0477767_91_498 134
148 3300049576 Ga0501040_0243349 Ga0501040_0243349_343_747 134
149 3300053077 Ga0495601_0069876 Ga0495601_0069876_19_423 134
150 3300053078 Ga0495612_0056955 Ga0495612_0056955_355_759 134
151 3300053085 Ga0495619_0160931 Ga0495619_0160931_636_1040 134
152 3300054114 Ga0501084_0315679 Ga0501084_0315679_622_1026 134
153 3300005327 Ga0070658_10125932 Ga0070658_101259323 135
154 3300005329 Ga0070683_100013281 Ga0070683_1000132816 135
155 3300005329 Ga0070683_100107422 Ga0070683_1001074224 135
156 3300005336 Ga0070680_100004550 Ga0070680_10000455011 135
157 3300005337 Ga0070682_100099441 Ga0070682_1000994411 135
158 3300005339 Ga0070660_100001247 Ga0070660_10000124712 135
159 3300005343 Ga0070687_100598872 Ga0070687_1005988721 135
160 3300005347 Ga0070668_100340968 Ga0070668_1003409682 135
161 3300005436 Ga0070713_100081284 Ga0070713_1000812845 135
162 3300005437 Ga0070710_10704647 Ga0070710_107046471 135
163 3300005458 Ga0070681_10714002 Ga0070681_107140022 135
164 3300005530 Ga0070679_100051799 Ga0070679_1000517993 135
165 3300005530 Ga0070679_100544333 Ga0070679_1005443332 135
166 3300005535 Ga0070684_100001562 Ga0070684_10000156220 135
167 3300005535 Ga0070684_100019782 Ga0070684_1000197822 135
168 3300005543 Ga0070672_100376817 Ga0070672_1003768171 135
169 3300005563 Ga0068855_100543237 Ga0068855_1005432371 135
170 3300005563 Ga0068855_100555407 Ga0068855_1005554073 135
171 3300005564 Ga0070664_100146847 Ga0070664_1001468473 135
172 3300005577 Ga0068857_100069652 Ga0068857_1000696522 135
173 3300005577 Ga0068857_100073950 Ga0068857_1000739503 135
174 3300005614 Ga0068856_100394898 Ga0068856_1003948982 135
175 3300005616 Ga0068852_100311434 Ga0068852_1003114342 135
176 3300005834 Ga0068851_10468869 Ga0068851_104688692 135
177 3300005841 Ga0068863_101131217 Ga0068863_1011312173 135
178 3300005937 Ga0081455_10322146 Ga0081455_103221462 135
179 3300005937 Ga0081455_10603441 Ga0081455_106034412 135
180 3300005981 Ga0081538_10012008 Ga0081538_100120082 135
181 3300005981 Ga0081538_10030550 Ga0081538_100305502 135
182 3300005981 Ga0081538_10069274 Ga0081538_100692743 135
183 3300006038 Ga0075365_10154682 Ga0075365_101546823 135
184 3300006175 Ga0070712_100078499 Ga0070712_1000784993 135
185 3300006852 Ga0075433_10000289 Ga0075433_100002891 135
186 3300006852 Ga0075433_10816382 Ga0075433_108163822 135
187 3300006871 Ga0075434_100000777 Ga0075434_10000077724 135
188 3300006871 Ga0075434_100010740 Ga0075434_1000107404 135
189 3300006914 Ga0075436_100043903 Ga0075436_1000439033 135
190 3300007076 Ga0075435_100380793 Ga0075435_1003807932 135
191 3300009093 Ga0105240_10035806 Ga0105240_100358063 135
192 3300009098 Ga0105245_10035790 Ga0105245_100357903 135
193 3300009098 Ga0105245_10485322 Ga0105245_104853222 135
194 3300009098 Ga0105245_11048536 Ga0105245_110485362 135
195 3300009148 Ga0105243_10192611 Ga0105243_101926112 135
196 3300009148 Ga0105243_11371145 Ga0105243_113711452 135
197 3300009174 Ga0105241_10177000 Ga0105241_101770002 135
198 3300009551 Ga0105238_10106797 Ga0105238_101067974 135
199 3300009551 Ga0105238_12244192 Ga0105238_122441921 135
200 3300009553 Ga0105249_10463778 Ga0105249_104637782 135
201 3300011119 Ga0105246_10685049 Ga0105246_106850492 135
202 3300013104 Ga0157370_10005142 Ga0157370_100051424 135
203 3300013105 Ga0157369_10002414 Ga0157369_1000241427 135
204 3300013105 Ga0157369_10148690 Ga0157369_101486902 135
205 3300013105 Ga0157369_10687040 Ga0157369_106870402 135
206 3300013296 Ga0157374_10076029 Ga0157374_100760293 135
207 3300013296 Ga0157374_11149245 Ga0157374_111492452 135
208 3300013297 Ga0157378_10060591 Ga0157378_100605912 135
209 3300013306 Ga0163162_10706316 Ga0163162_107063162 135
210 3300013307 Ga0157372_10054414 Ga0157372_100544143 135
211 3300013307 Ga0157372_10299158 Ga0157372_102991583 135
212 3300014325 Ga0163163_10642867 Ga0163163_106428672 135
213 3300014968 Ga0157379_11887790 Ga0157379_118877902 135
214 3300014969 Ga0157376_10614606 Ga0157376_106146062 135
215 3300020081 Ga0206354_11523398 Ga0206354_115233983 135
216 3300020082 Ga0206353_10092031 Ga0206353_100920313 135
217 3300020082 Ga0206353_11440038 Ga0206353_114400382 135
218 3300022467 Ga0224712_10027095 Ga0224712_100270952 135
219 3300025321 Ga0207656_10402128 Ga0207656_104021282 135
220 3300025909 Ga0207705_10107068 Ga0207705_101070683 135
221 3300025912 Ga0207707_10096145 Ga0207707_100961453 135
222 3300025913 Ga0207695_10211221 Ga0207695_102112213 135
223 3300025915 Ga0207693_10194308 Ga0207693_101943082 135
224 3300025916 Ga0207663_10703735 Ga0207663_107037351 135
225 3300025917 Ga0207660_10115991 Ga0207660_101159913 135
226 3300025919 Ga0207657_10007251 Ga0207657_100072517 135
227 3300025921 Ga0207652_10180821 Ga0207652_101808213 135
228 3300025921 Ga0207652_10605193 Ga0207652_106051932 135
229 3300025924 Ga0207694_10075873 Ga0207694_100758734 135
230 3300025927 Ga0207687_10014632 Ga0207687_100146324 135
231 3300025934 Ga0207686_10179498 Ga0207686_101794982 135
232 3300025935 Ga0207709_10196834 Ga0207709_101968342 135
233 3300025941 Ga0207711_11410390 Ga0207711_114103902 135
234 3300025949 Ga0207667_10326721 Ga0207667_103267213 135
235 3300025949 Ga0207667_10407248 Ga0207667_104072482 135
236 3300025949 Ga0207667_10473164 Ga0207667_104731641 135
237 3300026089 Ga0207648_10326890 Ga0207648_103268902 135
238 3300026116 Ga0207674_10113020 Ga0207674_101130202 135
239 3300026116 Ga0207674_10227389 Ga0207674_102273892 135
240 3300028800 Ga0265338_10006521 Ga0265338_1000652112 135
241 3300028800 Ga0265338_10325936 Ga0265338_103259361 135
242 3300037312 Ga0395899_0061888 Ga0395899_0061888_116_526 135
243 3300037312 Ga0395899_0104768 Ga0395899_0104768_1469_1882 135
244 3300037312 Ga0395899_0238079 Ga0395899_0238079_296_706 135
245 3300037312 Ga0395899_0678952 Ga0395899_0678952_70_477 135
246 3300037418 Ga0395900_0007576 Ga0395900_0007576_1970_2383 135
247 3300037418 Ga0395900_0039392 Ga0395900_0039392_522_932 135
248 3300037418 Ga0395900_0284418 Ga0395900_0284418_447_854 135
249 3300037418 Ga0395900_0305212 Ga0395900_0305212_843_1253 135
250 3300037418 Ga0395900_1904608 Ga0395900_1904608_68_481 135
251 3300037466 Ga0395898_0008666 Ga0395898_0008666_1205_1618 135
252 3300037466 Ga0395898_0382068 Ga0395898_0382068_598_1008 135
253 3300037466 Ga0395898_0666380 Ga0395898_0666380_73_483 135
254 3300037466 Ga0395898_0746541 Ga0395898_0746541_100_510 135
255 3300037471 Ga0395905_0243750 Ga0395905_0243750_1147_1557 135
256 3300037471 Ga0395905_0507418 Ga0395905_0507418_198_611 135
257 3300037471 Ga0395905_0749466 Ga0395905_0749466_139_549 135
258 3300037471 Ga0395905_0827279 Ga0395905_0827279_209_616 135
259 3300037471 Ga0395905_0973622 Ga0395905_0973622_37_450 135
260 3300038443 Ga0395901_0006587 Ga0395901_0006587_5371_5784 135
261 3300038443 Ga0395901_0044593 Ga0395901_0044593_2228_2638 135
262 3300038443 Ga0395901_0060579 Ga0395901_0060579_2952_3362 135
263 3300038443 Ga0395901_0123185 Ga0395901_0123185_1201_1614 135
264 3300038443 Ga0395901_0371881 Ga0395901_0371881_15_425 135
265 3300038443 Ga0395901_0764964 Ga0395901_0764964_141_551 135
266 3300038443 Ga0395901_0843199 Ga0395901_0843199_288_701 135
267 3300038443 Ga0395901_1899532 Ga0395901_1899532_97_507 135
268 3300041511 Ga0451855_0783939 Ga0451855_0783939_72_482 135
269 3300041512 Ga0451853_3664646 Ga0451853_3664646_63_473 135
270 3300042005 Ga0439448_0117391 Ga0439448_0117391_130_540 135
271 3300042993 Ga0439440_0112697 Ga0439440_0112697_246_659 135
272 3300044683 Ga0466965_0535293 Ga0466965_0535293_88_501 135
273 3300044693 Ga0466961_0519990 Ga0466961_0519990_82_495 135
274 3300044694 Ga0466963_0002377 Ga0466963_0002377_8868_9281 135
275 3300044694 Ga0466963_0002609 Ga0466963_0002609_1944_2360 135
276 3300044694 Ga0466963_0439861 Ga0466963_0439861_96_509 135
277 3300044694 Ga0466963_0645005 Ga0466963_0645005_32_445 135
278 3300044694 Ga0466963_0808033 Ga0466963_0808033_233_646 135
279 3300044706 Ga0466964_0096065 Ga0466964_0096065_801_1217 135
280 3300044719 Ga0466971_0077105 Ga0466971_0077105_275_691 135
281 3300044719 Ga0466971_0158028 Ga0466971_0158028_475_888 135
282 3300044842 Ga0466957_0026811 Ga0466957_0026811_1071_1484 135
283 3300044842 Ga0466957_0071668 Ga0466957_0071668_1370_1783 135
284 3300044901 Ga0466960_0001316 Ga0466960_0001316_6561_6974 135
285 3300045836 Ga0466958_0029896 Ga0466958_0029896_528_941 135
286 3300045836 Ga0466958_0773330 Ga0466958_0773330_192_605 135
287 3300045976 Ga0466967_0005114 Ga0466967_0005114_4275_4688 135
288 3300045976 Ga0466967_0011845 Ga0466967_0011845_275_691 135
289 3300045976 Ga0466967_0016022 Ga0466967_0016022_2141_2548 135
290 3300045976 Ga0466967_0194652 Ga0466967_0194652_782_1195 135
291 3300045976 Ga0466967_0278176 Ga0466967_0278176_615_1028 135
292 3300045976 Ga0466967_0525614 Ga0466967_0525614_334_744 135
293 3300046529 Ga0495652_0859608 Ga0495652_0859608_128_544 135
294 3300046543 Ga0495645_0488012 Ga0495645_0488012_131_541 135
295 3300046683 Ga0495658_0358789 Ga0495658_0358789_184_591 135
296 3300048088 Ga0495602_0186749 Ga0495602_0186749_51_467 135
297 3300048903 Ga0496100_0044024 Ga0496100_0044024_2391_2804 135
298 3300048903 Ga0496100_0091691 Ga0496100_0091691_1545_1958 135
299 3300048903 Ga0496100_1220433 Ga0496100_1220433_58_465 135
300 3300048904 Ga0496101_0031252 Ga0496101_0031252_2371_2784 135
301 3300048904 Ga0496101_0037003 Ga0496101_0037003_2656_3063 135
302 3300048904 Ga0496101_0187271 Ga0496101_0187271_983_1390 135
303 3300048904 Ga0496101_1332876 Ga0496101_1332876_111_518 135
304 3300048905 Ga0496102_0687555 Ga0496102_0687555_128_535 135
305 3300048905 Ga0496102_0710867 Ga0496102_0710867_135_545 135
306 3300048907 Ga0496104_0140707 Ga0496104_0140707_75_485 135
307 3300048907 Ga0496104_0184544 Ga0496104_0184544_540_953 135
308 3300048907 Ga0496104_0262161 Ga0496104_0262161_921_1331 135
309 3300048907 Ga0496104_0413376 Ga0496104_0413376_762_1175 135
310 3300048908 Ga0496105_0053097 Ga0496105_0053097_185_598 135
311 3300048909 Ga0496106_0026206 Ga0496106_0026206_3797_4210 135
312 3300048910 Ga0496107_0096802 Ga0496107_0096802_1643_2056 135
313 3300048910 Ga0496107_0215469 Ga0496107_0215469_59_466 135
314 3300048910 Ga0496107_0655191 Ga0496107_0655191_287_697 135
315 3300048911 Ga0496108_0015539 Ga0496108_0015539_3752_4165 135
316 3300048911 Ga0496108_0836012 Ga0496108_0836012_287_694 135
317 3300048912 Ga0496109_0018755 Ga0496109_0018755_2042_2455 135
318 3300048912 Ga0496109_0030546 Ga0496109_0030546_2367_2774 135
319 3300048913 Ga0496110_0028003 Ga0496110_0028003_3788_4201 135
320 3300048913 Ga0496110_0721806 Ga0496110_0721806_110_517 135
321 3300048914 Ga0496111_0102569 Ga0496111_0102569_207_620 135
322 3300048915 Ga0496112_0046370 Ga0496112_0046370_1973_2386 135
323 3300048915 Ga0496112_0288522 Ga0496112_0288522_743_1150 135
324 3300048916 Ga0496113_0650576 Ga0496113_0650576_345_758 135
325 3300048917 Ga0496114_0021921 Ga0496114_0021921_1000_1413 135
326 3300048917 Ga0496114_0323905 Ga0496114_0323905_896_1303 135
327 3300048917 Ga0496114_0597878 Ga0496114_0597878_347_757 135
328 3300048918 Ga0496115_0031769 Ga0496115_0031769_879_1292 135
329 3300048918 Ga0496115_0890056 Ga0496115_0890056_38_451 135
330 3300049569 Ga0501032_0976207 Ga0501032_0976207_62_469 135
331 3300049570 Ga0501033_0944769 Ga0501033_0944769_116_523 135
332 3300049572 Ga0501036_0234866 Ga0501036_0234866_545_955 135
333 3300049572 Ga0501036_0876256 Ga0501036_0876256_22_432 135
334 3300049573 Ga0501037_0068237 Ga0501037_0068237_874_1281 135
335 3300049573 Ga0501037_0173333 Ga0501037_0173333_745_1155 135
336 3300049574 Ga0501038_0012423 Ga0501038_0012423_6860_7291 135
337 3300049574 Ga0501038_0272407 Ga0501038_0272407_822_1229 135
338 3300049574 Ga0501038_0348746 Ga0501038_0348746_640_1050 135
339 3300049576 Ga0501040_0088595 Ga0501040_0088595_896_1303 135
340 3300049576 Ga0501040_0169423 Ga0501040_0169423_535_945 135
341 3300049576 Ga0501040_0276276 Ga0501040_0276276_467_886 135
342 3300049576 Ga0501040_0759815 Ga0501040_0759815_196_606 135
343 3300049577 Ga0501041_0045642 Ga0501041_0045642_2033_2440 135
344 3300049577 Ga0501041_0052355 Ga0501041_0052355_131_541 135
345 3300049578 Ga0501042_0506759 Ga0501042_0506759_415_825 135
346 3300049580 Ga0501046_0159243 Ga0501046_0159243_500_907 135
347 3300049582 Ga0501048_0244403 Ga0501048_0244403_120_527 135
348 3300049582 Ga0501048_0765572 Ga0501048_0765572_257_667 135
349 3300049583 Ga0501067_0000010 Ga0501067_0000010_74901_75308 135
350 3300049583 Ga0501067_0006021 Ga0501067_0006021_3257_3670 135
351 3300049584 Ga0501068_0000003 Ga0501068_0000003_73838_74245 135
352 3300049585 Ga0501069_0000123 Ga0501069_0000123_32567_32974 135
353 3300049585 Ga0501069_0486882 Ga0501069_0486882_291_698 135
354 3300049585 Ga0501069_0777834 Ga0501069_0777834_50_460 135
355 3300049586 Ga0501070_0111423 Ga0501070_0111423_673_1080 135
356 3300049587 Ga0501071_0030878 Ga0501071_0030878_177_584 135
357 3300049587 Ga0501071_0080994 Ga0501071_0080994_108_515 135
358 3300049587 Ga0501071_0138876 Ga0501071_0138876_957_1367 135
359 3300049588 Ga0501072_0003405 Ga0501072_0003405_866_1273 135
360 3300049588 Ga0501072_0422530 Ga0501072_0422530_427_837 135
361 3300049590 Ga0501074_0236021 Ga0501074_0236021_821_1228 135
362 3300049591 Ga0501075_0197673 Ga0501075_0197673_857_1264 135
363 3300049591 Ga0501075_0291755 Ga0501075_0291755_563_982 135
364 3300049591 Ga0501075_0478201 Ga0501075_0478201_386_796 135
365 3300049592 Ga0501076_0004911 Ga0501076_0004911_3443_3850 135
366 3300049592 Ga0501076_0040933 Ga0501076_0040933_2155_2565 135
367 3300049592 Ga0501076_0100467 Ga0501076_0100467_522_932 135
368 3300049593 Ga0501077_0039687 Ga0501077_0039687_1778_2185 135
369 3300049593 Ga0501077_0574778 Ga0501077_0574778_287_697 135
370 3300049741 Ga0501079_0231157 Ga0501079_0231157_874_1281 135
371 3300049741 Ga0501079_0271837 Ga0501079_0271837_643_1053 135
372 3300049741 Ga0501079_0565056 Ga0501079_0565056_283_693 135
373 3300049742 Ga0501080_0366596 Ga0501080_0366596_810_1217 135
374 3300049743 Ga0501081_0102258 Ga0501081_0102258_203_613 135
375 3300049743 Ga0501081_0358155 Ga0501081_0358155_169_579 135
376 3300049743 Ga0501081_0371271 Ga0501081_0371271_277_690 135
377 3300049743 Ga0501081_0428450 Ga0501081_0428450_363_782 135
378 3300049823 Ga0501044_0360613 Ga0501044_0360613_330_737 135
379 3300049824 Ga0501045_0043638 Ga0501045_0043638_1997_2404 135
380 3300049824 Ga0501045_0307069 Ga0501045_0307069_342_752 135
381 3300050511 nmdc:mga08y16_331812_c1 nmdc:mga08y16_331812_c1_359_769 135
382 3300050512 nmdc:mga0n895_1373877_c1 nmdc:mga0n895_1373877_c1_49_459 135
383 3300050512 nmdc:mga0n895_509555_c1 nmdc:mga0n895_509555_c1_194_622 135
384 3300050512 nmdc:mga0n895_86622_c1 nmdc:mga0n895_86622_c1_1408_1821 135
385 3300050513 nmdc:mga0rr50_39128_c1 nmdc:mga0rr50_39128_c1_1268_1681 135
386 3300050514 nmdc:mga08x19_63202_c1 nmdc:mga08x19_63202_c1_1266_1679 135
387 3300050515 nmdc:mga0a205_295383_c1 nmdc:mga0a205_295383_c1_163_576 135
388 3300050515 nmdc:mga0a205_862808_c1 nmdc:mga0a205_862808_c1_265_675 135
389 3300053077 Ga0495601_0263999 Ga0495601_0263999_374_784 135
390 3300054114 Ga0501084_0096359 Ga0501084_0096359_408_827 135
391 3300054114 Ga0501084_0128769 Ga0501084_0128769_1261_1671 135
392 3300054114 Ga0501084_0299842 Ga0501084_0299842_554_961 135
393 3300060353 Ga0501082_0225326 Ga0501082_0225326_518_925 135
394 3300060353 Ga0501082_0657364 Ga0501082_0657364_221_631 135
395 3300061719 Ga0466962_0048429 Ga0466962_0048429_69_482 135
396 3300061719 Ga0466962_0049728 Ga0466962_0049728_175_591 135
397 3300061734 Ga0530510_0008944 Ga0530510_0008944_2782_3189 135
398 3300061734 Ga0530510_0665953 Ga0530510_0665953_193_603 135
399 3300061734 Ga0530510_0706176 Ga0530510_0706176_209_622 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

15

119

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cd7-assembly1.cif.gz_A crystal structure of the ntd l199m of drosophila oskar protein 0.8603 7 31
2n4t-assembly1.cif.gz_A nmr structure of fbp28 ww domain l453w mutant 0.7592 13 32
5cd7-assembly3.cif.gz_E crystal structure of the ntd l199m of drosophila oskar protein 0.7466 1 31
7xfp-assembly4.cif.gz_D crystal structure of helicobacter pylori icea2 0.744 15 35
5cd7-assembly2.cif.gz_D crystal structure of the ntd l199m of drosophila oskar protein 0.7081 1 31
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8278 5 125 3.30.70.1230
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8089 5 125 3.30.70.1230
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7168 5 126 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7145 2 126 3.90.1150.30
af_C4J9H4_8_107_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7142 96 129 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A538G618-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.973 4 131
AF-A0A7Y5WXI2-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9661 14 131
AF-A0A538G618-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9656 4 131
AF-A0A538IJE1-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9595 35 131
AF-A0A2U3C7E8-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9564 14 131

Feature Viewer

pLDDT pTM Quality
92.61 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map