F434404
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 399 | 323 | 167 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0016361|Ga0501033_0016361_2490_3464 |
| Length | 324 |
| Sequence | LRLFVRQVIGGTDSEVFDVAATPAHAPYDGSSKPFTIGLKPLALADWIEVDDNLFAHLAEKRRLYAEMPEKVFVEEPDTRTAQQEVLDMLTAHLPERFPRTYAVAGDEVAVRNLPPAQALALDAPLVAASLLVQEDLILMRRGEDGWRLAAGSLCFPSSWTLTEKFGKTLHTIHIPVPGFGPGSRPDELIARMFDGLQGQAMERFNWSIQAGDALYHPLSNIQRDDRATTRPSRFADEEDINASAFIRVERQTLRKLPISRDVLFTIRIHLDPLAVLTRHPDKARLAASFAAQLTALDTAQLDYKGLTADRDRLVDWLQAAAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 4 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 5 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 6 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 7 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 8 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 9 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 10 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 11 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 12 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 13 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 14 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 15 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 16 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 17 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 18 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 19 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 20 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 21 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 22 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 23 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 24 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 25 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 26 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 27 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 28 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 29 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 30 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 31 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 32 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 33 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 34 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 35 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 36 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 37 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 38 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 39 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 40 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 41 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 42 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 43 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 44 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 45 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 46 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 47 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 48 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 49 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 50 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 51 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 52 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 53 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 54 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 55 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 56 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 57 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 58 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 59 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 60 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 61 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 62 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 63 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 64 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 65 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 66 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 67 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 68 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 69 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 70 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 71 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 72 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 73 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 74 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 75 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 76 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 77 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 78 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 79 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 80 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 81 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 82 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 83 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 84 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 85 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 86 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 87 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 88 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 89 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 90 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 91 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 92 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 93 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 94 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 95 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 96 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 97 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 98 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 99 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 100 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 101 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 102 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 103 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 104 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 105 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 106 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 107 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 108 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 109 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 110 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 111 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 112 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 113 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 114 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 115 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 116 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 117 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 118 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 119 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 120 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 121 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 122 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 123 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 124 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 125 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 126 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 127 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 128 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 129 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 130 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 131 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 132 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 133 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 134 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 135 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 136 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 137 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 138 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 139 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 140 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 141 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 142 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 143 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 144 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 145 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 146 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 147 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 148 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 149 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 150 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 151 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 152 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 153 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 154 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 155 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 156 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 157 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 158 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 159 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 160 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 161 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 162 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 163 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 164 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 165 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 166 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 167 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 168 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 169 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 170 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 171 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 172 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 173 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 174 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 175 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 176 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 177 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 178 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 179 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 180 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 181 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 182 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 183 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 184 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 185 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 186 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 187 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 188 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 189 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 190 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 191 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 192 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 193 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 194 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 195 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 196 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 197 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 198 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 199 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 200 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 201 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 202 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 203 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 204 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 205 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 206 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 207 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 208 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 209 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 210 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 211 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 212 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 213 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 214 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 215 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 216 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 217 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 218 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 219 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 220 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 221 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 224 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 225 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 227 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 228 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 229 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 230 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 231 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 232 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 233 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 234 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 235 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 244 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 245 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 246 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 247 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 249 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 266 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 267 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 268 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 274 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 303 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 307 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 308 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 309 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 310 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 312 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 313 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 314 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 315 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 316 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 317 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 318 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 319 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 320 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 321 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 322 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 323 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 41.85 |
| Metatranscriptomes | 0 |
| Isolates | 58.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.26 |
| Nodule | 51.13 |
| Rhizoplane | 0.5 |
| Rhizosphere | 35.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000042 | 3300003214 | Bacteria | 271606 |
| 2 | Ga0055542_1000981 | 3300003762 | Bacteria | 18535 |
| 3 | Ga0055529_1001600 | 3300003763 | Bacteria | 6140 |
| 4 | Ga0070674_100130107 | 3300005356 | Bacteria | 1875 |
| 5 | Ga0070659_100278920 | 3300005366 | Bacteria | 1390 |
| 6 | Ga0068867_100101401 | 3300005459 | Bacteria | 2199 |
| 7 | Ga0068853_100013075 | 3300005539 | Bacteria | 6770 |
| 8 | Ga0068853_100103370 | 3300005539 | Bacteria | 2522 |
| 9 | Ga0068853_100472265 | 3300005539 | Bacteria | 1182 |
| 10 | Ga0070665_100048093 | 3300005548 | Bacteria | 4283 |
| 11 | Ga0068855_100159988 | 3300005563 | Bacteria | 2557 |
| 12 | Ga0068857_100114849 | 3300005577 | Bacteria | 2422 |
| 13 | Ga0068856_100637116 | 3300005614 | Bacteria | 1087 |
| 14 | Ga0081455_10102059 | 3300005937 | Bacteria | 2301 |
| 15 | Ga0081539_10016432 | 3300005985 | Bacteria | 5285 |
| 16 | Ga0075365_10009658 | 3300006038 | Bacteria | 5567 |
| 17 | Ga0075365_10037523 | 3300006038 | Bacteria | 3146 |
| 18 | Ga0075363_100000229 | 3300006048 | Bacteria | 15640 |
| 19 | Ga0075370_10086206 | 3300006353 | Bacteria | 1808 |
| 20 | Ga0068865_100387690 | 3300006881 | Bacteria | 1141 |
| 21 | Ga0105241_10047803 | 3300009174 | Bacteria | 3255 |
| 22 | Ga0105248_10642833 | 3300009177 | Bacteria | 1197 |
| 23 | Ga0105237_10005230 | 3300009545 | Bacteria | 14682 |
| 24 | Ga0105238_10005636 | 3300009551 | Bacteria | 12375 |
| 25 | Ga0105238_10067509 | 3300009551 | Bacteria | 3577 |
| 26 | Ga0105239_10039006 | 3300010375 | Bacteria | 5203 |
| 27 | Ga0105239_10471490 | 3300010375 | Bacteria | 1426 |
| 28 | Ga0157370_10173752 | 3300013104 | Bacteria | 2002 |
| 29 | Ga0157369_10074750 | 3300013105 | Bacteria | 3634 |
| 30 | Ga0157369_10246474 | 3300013105 | Bacteria | 1865 |
| 31 | Ga0163163_10210651 | 3300014325 | Bacteria | 1993 |
| 32 | Ga0182006_1025652 | 3300015261 | Bacteria | 2419 |
| 33 | Ga0182005_1034187 | 3300015265 | Bacteria | 1383 |
| 34 | Ga0209646_1014253 | 3300025246 | Bacteria | 1199 |
| 35 | Ga0209026_1000029 | 3300025250 | Bacteria | 337109 |
| 36 | Ga0209148_1000080 | 3300025254 | Bacteria | 277806 |
| 37 | Ga0209759_1000040 | 3300025256 | Bacteria | 254501 |
| 38 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 39 | Ga0209455_1000171 | 3300025272 | Bacteria | 109696 |
| 40 | Ga0209758_1004174 | 3300025297 | Bacteria | 12281 |
| 41 | Ga0207647_10061712 | 3300025904 | Bacteria | 2286 |
| 42 | Ga0207695_10083580 | 3300025913 | Bacteria | 3225 |
| 43 | Ga0207671_10007609 | 3300025914 | Bacteria | 9372 |
| 44 | Ga0207671_10056911 | 3300025914 | Bacteria | 2898 |
| 45 | Ga0207694_10020591 | 3300025924 | Bacteria | 4993 |
| 46 | Ga0207694_10097148 | 3300025924 | Bacteria | 2330 |
| 47 | Ga0207709_10167389 | 3300025935 | Bacteria | 1539 |
| 48 | Ga0207667_10155182 | 3300025949 | Bacteria | 2356 |
| 49 | Ga0207639_10006049 | 3300026041 | Bacteria | 8212 |
| 50 | Ga0207639_10077468 | 3300026041 | Bacteria | 2621 |
| 51 | Ga0207678_10072285 | 3300026067 | Bacteria | 2956 |
| 52 | Ga0207648_10061983 | 3300026089 | Bacteria | 3261 |
| 53 | Ga0207674_10056954 | 3300026116 | Bacteria | 3965 |
| 54 | Ga0268266_10034917 | 3300028379 | Bacteria | 4277 |
| 55 | Ga0268266_10221401 | 3300028379 | Bacteria | 1740 |
| 56 | Ga0307513_10346345 | 3300031456 | Bacteria | 1235 |
| 57 | Ga0395900_0091055 | 3300037418 | Bacteria | 3134 |
| 58 | Ga0395900_0105588 | 3300037418 | Bacteria | 2894 |
| 59 | Ga0395898_0560898 | 3300037466 | Bacteria | 1084 |
| 60 | Ga0395905_0044707 | 3300037471 | Bacteria | 4155 |
| 61 | Ga0395905_0110052 | 3300037471 | Bacteria | 2587 |
| 62 | Ga0395905_0240814 | 3300037471 | Bacteria | 1690 |
| 63 | Ga0466972_0004602 | 3300044658 | Bacteria | 6911 |
| 64 | Ga0466960_0009402 | 3300044901 | Bacteria | 4028 |
| 65 | Ga0495620_0072030 | 3300046515 | Bacteria | 1412 |
| 66 | Ga0495668_0098555 | 3300046616 | Bacteria | 1600 |
| 67 | Ga0495625_0237513 | 3300046660 | Bacteria | 1188 |
| 68 | Ga0496108_0155035 | 3300048911 | Bacteria | 1978 |
| 69 | Ga0496119_0046375 | 3300048922 | Bacteria | 2715 |
| 70 | Ga0496120_0001370 | 3300048923 | Bacteria | 29844 |
| 71 | Ga0496124_0144430 | 3300048927 | Bacteria | 1874 |
| 72 | Ga0501031_0000007 | 3300049568 | Bacteria | 166008 |
| 73 | Ga0501031_0008039 | 3300049568 | Bacteria | 6869 |
| 74 | Ga0501031_0093499 | 3300049568 | Bacteria | 1962 |
| 75 | Ga0501031_0155589 | 3300049568 | Bacteria | 1494 |
| 76 | Ga0501031_0210377 | 3300049568 | Bacteria | 1267 |
| 77 | Ga0501032_0000007 | 3300049569 | Bacteria | 253881 |
| 78 | Ga0501032_0001473 | 3300049569 | Bacteria | 18750 |
| 79 | Ga0501032_0011413 | 3300049569 | Bacteria | 6383 |
| 80 | Ga0501032_0094093 | 3300049569 | Bacteria | 1987 |
| 81 | Ga0501032_0144247 | 3300049569 | Bacteria | 1567 |
| 82 | Ga0501033_0000051 | 3300049570 | Bacteria | 111291 |
| 83 | Ga0501033_0001192 | 3300049570 | Bacteria | 23475 |
| 84 | Ga0501033_0004047 | 3300049570 | Bacteria | 11840 |
| 85 | Ga0501033_0007442 | 3300049570 | Bacteria | 8527 |
| 86 | Ga0501033_0016361 | 3300049570 | Bacteria | 5616 |
| 87 | Ga0501034_0000029 | 3300049571 | Bacteria | 253881 |
| 88 | Ga0501034_0007241 | 3300049571 | Bacteria | 11841 |
| 89 | Ga0501036_0000004 | 3300049572 | Bacteria | 253881 |
| 90 | Ga0501036_0116188 | 3300049572 | Bacteria | 2260 |
| 91 | Ga0501036_0397999 | 3300049572 | Bacteria | 1149 |
| 92 | Ga0501037_0000004 | 3300049573 | Bacteria | 253989 |
| 93 | Ga0501037_0000264 | 3300049573 | Bacteria | 45296 |
| 94 | Ga0501037_0140463 | 3300049573 | Bacteria | 1729 |
| 95 | Ga0501038_0000005 | 3300049574 | Bacteria | 253881 |
| 96 | Ga0501038_0148967 | 3300049574 | Bacteria | 1909 |
| 97 | Ga0501039_0000009 | 3300049575 | Bacteria | 253881 |
| 98 | Ga0501042_0007394 | 3300049578 | Bacteria | 7193 |
| 99 | Ga0501043_0000620 | 3300049579 | Bacteria | 31329 |
| 100 | Ga0501043_0001215 | 3300049579 | Bacteria | 22693 |
| 101 | Ga0501043_0015283 | 3300049579 | Bacteria | 6013 |
| 102 | Ga0501043_0019788 | 3300049579 | Bacteria | 5285 |
| 103 | Ga0501043_0118755 | 3300049579 | Bacteria | 2074 |
| 104 | Ga0501043_0304439 | 3300049579 | Bacteria | 1217 |
| 105 | Ga0501046_0205003 | 3300049580 | Bacteria | 1466 |
| 106 | Ga0501047_0039291 | 3300049581 | Bacteria | 4577 |
| 107 | Ga0501047_0144363 | 3300049581 | Bacteria | 2257 |
| 108 | Ga0501047_0249277 | 3300049581 | Bacteria | 1624 |
| 109 | Ga0501048_0006373 | 3300049582 | Bacteria | 8968 |
| 110 | Ga0501067_0092902 | 3300049583 | Bacteria | 1675 |
| 111 | Ga0501068_0028906 | 3300049584 | Bacteria | 3281 |
| 112 | Ga0501069_0000007 | 3300049585 | Bacteria | 182820 |
| 113 | Ga0501069_0004063 | 3300049585 | Bacteria | 7556 |
| 114 | Ga0501069_0013087 | 3300049585 | Bacteria | 4423 |
| 115 | Ga0501070_0000229 | 3300049586 | Bacteria | 52795 |
| 116 | Ga0501070_0001901 | 3300049586 | Bacteria | 18471 |
| 117 | Ga0501070_0003212 | 3300049586 | Bacteria | 14212 |
| 118 | Ga0501070_0023667 | 3300049586 | Bacteria | 5146 |
| 119 | Ga0501070_0045121 | 3300049586 | Bacteria | 3666 |
| 120 | Ga0501070_0104170 | 3300049586 | Bacteria | 2346 |
| 121 | Ga0501070_0328033 | 3300049586 | Bacteria | 1244 |
| 122 | Ga0501071_0082806 | 3300049587 | Bacteria | 2350 |
| 123 | Ga0501071_0103203 | 3300049587 | Bacteria | 2103 |
| 124 | Ga0501071_0319229 | 3300049587 | Bacteria | 1179 |
| 125 | Ga0501072_0028309 | 3300049588 | Bacteria | 4375 |
| 126 | Ga0501073_0035327 | 3300049589 | Bacteria | 3554 |
| 127 | Ga0501074_0000254 | 3300049590 | Bacteria | 30127 |
| 128 | Ga0501074_0033019 | 3300049590 | Bacteria | 3751 |
| 129 | Ga0501074_0226722 | 3300049590 | Bacteria | 1330 |
| 130 | Ga0501080_0000550 | 3300049742 | Bacteria | 29619 |
| 131 | Ga0501080_0000724 | 3300049742 | Bacteria | 26629 |
| 132 | Ga0501080_0017096 | 3300049742 | Bacteria | 6699 |
| 133 | Ga0501080_0099467 | 3300049742 | Bacteria | 2699 |
| 134 | Ga0501083_0000125 | 3300049744 | Bacteria | 52499 |
| 135 | Ga0501083_0108723 | 3300049744 | Bacteria | 1824 |
| 136 | Ga0501083_0328061 | 3300049744 | Bacteria | 995 |
| 137 | Ga0501035_0000014 | 3300049822 | Bacteria | 253874 |
| 138 | Ga0501035_0000274 | 3300049822 | Bacteria | 61155 |
| 139 | Ga0501035_0000373 | 3300049822 | Bacteria | 51518 |
| 140 | Ga0501035_0001928 | 3300049822 | Bacteria | 20781 |
| 141 | Ga0501035_0012975 | 3300049822 | Bacteria | 7688 |
| 142 | Ga0501035_0013614 | 3300049822 | Bacteria | 7504 |
| 143 | Ga0501035_0048214 | 3300049822 | Bacteria | 3820 |
| 144 | Ga0501035_0113729 | 3300049822 | Bacteria | 2371 |
| 145 | Ga0501035_0295753 | 3300049822 | Bacteria | 1365 |
| 146 | Ga0501044_0000009 | 3300049823 | Bacteria | 270072 |
| 147 | Ga0501044_0000012 | 3300049823 | Bacteria | 253881 |
| 148 | Ga0501044_0010493 | 3300049823 | Bacteria | 10054 |
| 149 | Ga0501044_0027624 | 3300049823 | Bacteria | 5994 |
| 150 | Ga0501044_0030256 | 3300049823 | Bacteria | 5707 |
| 151 | Ga0501044_0153515 | 3300049823 | Bacteria | 2283 |
| 152 | Ga0501044_0395832 | 3300049823 | Bacteria | 1294 |
| 153 | Ga0501044_0528251 | 3300049823 | Bacteria | 1079 |
| 154 | Ga0501044_0534597 | 3300049823 | Bacteria | 1071 |
| 155 | Ga0501044_0562666 | 3300049823 | Bacteria | 1036 |
| 156 | Ga0501045_0009505 | 3300049824 | Bacteria | 6805 |
| 157 | nmdc:mga0yw44_1659_c1 | 3300050492 | Bacteria | 8980 |
| 158 | nmdc:mga0yw44_20310_c1 | 3300050492 | Bacteria | 3684 |
| 159 | nmdc:mga06z11_69803_c1 | 3300050494 | Bacteria | 1856 |
| 160 | nmdc:mga06z11_98107_c1 | 3300050494 | Bacteria | 1603 |
| 161 | nmdc:mga07m45_54354_c1 | 3300050496 | Bacteria | 2263 |
| 162 | nmdc:mga0sz30_7642_c1 | 3300050516 | Bacteria | 3043 |
| 163 | Ga0500643_046695 | 3300053087 | Bacteria | 1250 |
| 164 | Ga0500568_0000177 | 3300053139 | Bacteria | 55762 |
| 165 | Ga0500604_0023351 | 3300053151 | Bacteria | 1763 |
| 166 | Ga0500620_001119 | 3300053155 | Bacteria | 4764 |
| 167 | Ga0501082_0190285 | 3300060353 | Bacteria | 1785 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2924726620 | 2924727509 | 271 |
| 2 | 3300049586 | Ga0501070_0328033 | Ga0501070_0328033_41_931 | 277 |
| 3 | iso_pu_bacteria | 2958041894 | 2958056450 | 277 |
| 4 | 3300025924 | Ga0207694_10097148 | Ga0207694_100971484 | 283 |
| 5 | iso_pu_bacteria | 2977986579 | 2977987805 | 287 |
| 6 | 3300037418 | Ga0395900_0105588 | Ga0395900_0105588_1828_2730 | 290 |
| 7 | 3300049823 | Ga0501044_0528251 | Ga0501044_0528251_156_1049 | 290 |
| 8 | iso_pu_bacteria | 2513237351 | 2514587537 | 290 |
| 9 | 3300037466 | Ga0395898_0560898 | Ga0395898_0560898_63_986 | 291 |
| 10 | 3300049822 | Ga0501035_0295753 | Ga0501035_0295753_152_1078 | 291 |
| 11 | iso_pu_bacteria | 2871481445 | 2871484512 | 292 |
| 12 | 3300049823 | Ga0501044_0153515 | Ga0501044_0153515_1242_2192 | 293 |
| 13 | iso_pu_bacteria | 2643221550 | 2643774405 | 297 |
| 14 | iso_pu_bacteria | 2643221564 | 2643839069 | 297 |
| 15 | iso_pu_bacteria | 2643221623 | 2644133246 | 299 |
| 16 | iso_pu_bacteria | 2958064165 | 2958064918 | 299 |
| 17 | iso_pu_bacteria | 2510065059 | 2510319262 | 300 |
| 18 | iso_pu_bacteria | 2847686936 | 2847691098 | 300 |
| 19 | iso_pu_bacteria | 2869162929 | 2869163832 | 300 |
| 20 | iso_pu_bacteria | 2874102143 | 2874108814 | 300 |
| 21 | iso_pu_bacteria | 2906328253 | 2906330708 | 300 |
| 22 | iso_pu_bacteria | 2958115193 | 2958115488 | 300 |
| 23 | iso_pu_bacteria | 2965062239 | 2965062512 | 300 |
| 24 | iso_pu_bacteria | 2968091066 | 2968094746 | 300 |
| 25 | iso_pu_bacteria | 2968097103 | 2968103113 | 300 |
| 26 | iso_pu_bacteria | 2968128360 | 2968133684 | 300 |
| 27 | iso_pu_bacteria | 2979779861 | 2979785295 | 300 |
| 28 | iso_pu_bacteria | 8004703790 | 8004712080 | 300 |
| 29 | 3300005985 | Ga0081539_10016432 | Ga0081539_100164323 | 301 |
| 30 | 3300049570 | Ga0501033_0016361 | Ga0501033_0016361_2490_3464 | 301 |
| 31 | 3300049583 | Ga0501067_0092902 | Ga0501067_0092902_135_1049 | 301 |
| 32 | iso_pu_bacteria | 2503198000 | 2503199967 | 301 |
| 33 | iso_pu_bacteria | 2738543024 | 2739307516 | 301 |
| 34 | iso_pu_bacteria | 2996336353 | 2996338735 | 301 |
| 35 | 3300053139 | Ga0500568_0000177 | Ga0500568_0000177_30201_31118 | 302 |
| 36 | iso_pu_bacteria | 2512875024 | 2512960580 | 302 |
| 37 | iso_pu_bacteria | 2513237164 | 2514036330 | 302 |
| 38 | iso_pu_bacteria | 2588253730 | 2588518644 | 302 |
| 39 | iso_pu_bacteria | 2871488783 | 2871493247 | 302 |
| 40 | iso_pu_bacteria | 2876420981 | 2876424284 | 302 |
| 41 | iso_pu_bacteria | 2878753008 | 2878757292 | 302 |
| 42 | iso_pu_bacteria | 2881155292 | 2881161041 | 302 |
| 43 | iso_pu_bacteria | 2881853255 | 2881853882 | 302 |
| 44 | iso_pu_bacteria | 2881861095 | 2881866788 | 302 |
| 45 | iso_pu_bacteria | 2882912400 | 2882917488 | 302 |
| 46 | iso_pu_bacteria | 2885318864 | 2885319790 | 302 |
| 47 | iso_pu_bacteria | 2885350715 | 2885355400 | 302 |
| 48 | iso_pu_bacteria | 2903492973 | 2903501019 | 302 |
| 49 | iso_pu_bacteria | 2924762789 | 2924768115 | 302 |
| 50 | iso_pu_bacteria | 2924784321 | 2924786597 | 302 |
| 51 | iso_pu_bacteria | 2937822353 | 2937827805 | 302 |
| 52 | iso_pu_bacteria | 2961127735 | 2961133140 | 302 |
| 53 | iso_pu_bacteria | 2961170736 | 2961175379 | 302 |
| 54 | iso_pu_bacteria | 2967996073 | 2967999619 | 302 |
| 55 | iso_pu_bacteria | 2968003550 | 2968007977 | 302 |
| 56 | iso_pu_bacteria | 2970503327 | 2970507967 | 302 |
| 57 | iso_pu_bacteria | 2977821940 | 2977826451 | 302 |
| 58 | iso_pu_bacteria | 2977828996 | 2977830305 | 302 |
| 59 | iso_pu_bacteria | 2979808191 | 2979813151 | 302 |
| 60 | iso_pu_bacteria | 2987666974 | 2987671463 | 302 |
| 61 | iso_pu_bacteria | 8004374579 | 8004378867 | 302 |
| 62 | 3300005548 | Ga0070665_100048093 | Ga0070665_1000480932 | 303 |
| 63 | 3300028379 | Ga0268266_10034917 | Ga0268266_100349172 | 303 |
| 64 | 3300049568 | Ga0501031_0008039 | Ga0501031_0008039_2170_3102 | 303 |
| 65 | 3300049569 | Ga0501032_0011413 | Ga0501032_0011413_3390_4322 | 303 |
| 66 | 3300049570 | Ga0501033_0004047 | Ga0501033_0004047_2704_3636 | 303 |
| 67 | 3300049571 | Ga0501034_0007241 | Ga0501034_0007241_8205_9137 | 303 |
| 68 | 3300049578 | Ga0501042_0007394 | Ga0501042_0007394_3242_4174 | 303 |
| 69 | 3300049579 | Ga0501043_0019788 | Ga0501043_0019788_3390_4322 | 303 |
| 70 | 3300049582 | Ga0501048_0006373 | Ga0501048_0006373_2391_3323 | 303 |
| 71 | 3300049587 | Ga0501071_0082806 | Ga0501071_0082806_1180_2112 | 303 |
| 72 | 3300049588 | Ga0501072_0028309 | Ga0501072_0028309_1471_2403 | 303 |
| 73 | 3300049742 | Ga0501080_0017096 | Ga0501080_0017096_3389_4321 | 303 |
| 74 | 3300049822 | Ga0501035_0001928 | Ga0501035_0001928_8205_9137 | 303 |
| 75 | 3300049823 | Ga0501044_0395832 | Ga0501044_0395832_271_1203 | 303 |
| 76 | 3300049824 | Ga0501045_0009505 | Ga0501045_0009505_2722_3654 | 303 |
| 77 | 3300053087 | Ga0500643_046695 | Ga0500643_046695_242_1162 | 303 |
| 78 | 3300053155 | Ga0500620_001119 | Ga0500620_001119_1286_2203 | 303 |
| 79 | iso_pu_bacteria | 2509276022 | 2509394876 | 303 |
| 80 | iso_pu_bacteria | 2513237090 | 2513608679 | 303 |
| 81 | iso_pu_bacteria | 2856320880 | 2856323077 | 303 |
| 82 | iso_pu_bacteria | 2869278585 | 2869282628 | 303 |
| 83 | iso_pu_bacteria | 2874139085 | 2874142284 | 303 |
| 84 | iso_pu_bacteria | 2878738818 | 2878744532 | 303 |
| 85 | iso_pu_bacteria | 2888337043 | 2888338296 | 303 |
| 86 | iso_pu_bacteria | 2924718760 | 2924719827 | 303 |
| 87 | iso_pu_bacteria | 2924776078 | 2924782562 | 303 |
| 88 | iso_pu_bacteria | 2937877337 | 2937881205 | 303 |
| 89 | iso_pu_bacteria | 2937972304 | 2937977295 | 303 |
| 90 | iso_pu_bacteria | 2958034702 | 2958039411 | 303 |
| 91 | iso_pu_bacteria | 2958041894 | 2958052961 | 303 |
| 92 | iso_pu_bacteria | 2958084443 | 2958088238 | 303 |
| 93 | iso_pu_bacteria | 2958092219 | 2958100464 | 303 |
| 94 | iso_pu_bacteria | 2958144490 | 2958151019 | 303 |
| 95 | iso_pu_bacteria | 2968016561 | 2968020738 | 303 |
| 96 | iso_pu_bacteria | 2970469710 | 2970474035 | 303 |
| 97 | iso_pu_bacteria | 2970593180 | 2970597237 | 303 |
| 98 | iso_pu_bacteria | 2996348954 | 2996352645 | 303 |
| 99 | iso_pu_bacteria | 3004275668 | 3004279327 | 303 |
| 100 | iso_pu_bacteria | 3004289098 | 3004289269 | 303 |
| 101 | iso_pu_bacteria | 8002285264 | 8002291642 | 303 |
| 102 | 3300026067 | Ga0207678_10072285 | Ga0207678_100722853 | 304 |
| 103 | 3300049568 | Ga0501031_0093499 | Ga0501031_0093499_632_1579 | 304 |
| 104 | 3300049568 | Ga0501031_0210377 | Ga0501031_0210377_145_1092 | 304 |
| 105 | 3300049569 | Ga0501032_0001473 | Ga0501032_0001473_10363_11310 | 304 |
| 106 | 3300049569 | Ga0501032_0144247 | Ga0501032_0144247_56_1003 | 304 |
| 107 | 3300049570 | Ga0501033_0001192 | Ga0501033_0001192_20326_21273 | 304 |
| 108 | 3300049572 | Ga0501036_0116188 | Ga0501036_0116188_1120_2067 | 304 |
| 109 | 3300049573 | Ga0501037_0000264 | Ga0501037_0000264_10386_11333 | 304 |
| 110 | 3300049574 | Ga0501038_0148967 | Ga0501038_0148967_362_1309 | 304 |
| 111 | 3300049579 | Ga0501043_0000620 | Ga0501043_0000620_10403_11350 | 304 |
| 112 | 3300049579 | Ga0501043_0118755 | Ga0501043_0118755_11_958 | 304 |
| 113 | 3300049581 | Ga0501047_0144363 | Ga0501047_0144363_111_1058 | 304 |
| 114 | 3300049584 | Ga0501068_0028906 | Ga0501068_0028906_1165_2112 | 304 |
| 115 | 3300049585 | Ga0501069_0000007 | Ga0501069_0000007_10545_11492 | 304 |
| 116 | 3300049585 | Ga0501069_0004063 | Ga0501069_0004063_1046_1993 | 304 |
| 117 | 3300049586 | Ga0501070_0001901 | Ga0501070_0001901_11992_12939 | 304 |
| 118 | 3300049586 | Ga0501070_0003212 | Ga0501070_0003212_3585_4532 | 304 |
| 119 | 3300049586 | Ga0501070_0023667 | Ga0501070_0023667_3804_4727 | 304 |
| 120 | 3300049586 | Ga0501070_0104170 | Ga0501070_0104170_1112_2041 | 304 |
| 121 | 3300049587 | Ga0501071_0103203 | Ga0501071_0103203_321_1268 | 304 |
| 122 | 3300049587 | Ga0501071_0319229 | Ga0501071_0319229_58_1005 | 304 |
| 123 | 3300049589 | Ga0501073_0035327 | Ga0501073_0035327_2562_3509 | 304 |
| 124 | 3300049590 | Ga0501074_0000254 | Ga0501074_0000254_10403_11350 | 304 |
| 125 | 3300049590 | Ga0501074_0226722 | Ga0501074_0226722_358_1305 | 304 |
| 126 | 3300049742 | Ga0501080_0000550 | Ga0501080_0000550_8353_9300 | 304 |
| 127 | 3300049742 | Ga0501080_0099467 | Ga0501080_0099467_1284_2231 | 304 |
| 128 | 3300049744 | Ga0501083_0000125 | Ga0501083_0000125_10386_11333 | 304 |
| 129 | 3300049744 | Ga0501083_0108723 | Ga0501083_0108723_240_1187 | 304 |
| 130 | 3300049822 | Ga0501035_0000274 | Ga0501035_0000274_49823_50770 | 304 |
| 131 | 3300049822 | Ga0501035_0012975 | Ga0501035_0012975_1843_2766 | 304 |
| 132 | 3300049822 | Ga0501035_0048214 | Ga0501035_0048214_1440_2387 | 304 |
| 133 | 3300049822 | Ga0501035_0113729 | Ga0501035_0113729_966_1913 | 304 |
| 134 | 3300049823 | Ga0501044_0000009 | Ga0501044_0000009_10529_11476 | 304 |
| 135 | 3300049823 | Ga0501044_0010493 | Ga0501044_0010493_2708_3655 | 304 |
| 136 | 3300049823 | Ga0501044_0027624 | Ga0501044_0027624_1268_2191 | 304 |
| 137 | 3300053151 | Ga0500604_0023351 | Ga0500604_0023351_168_1088 | 304 |
| 138 | 3300060353 | Ga0501082_0190285 | Ga0501082_0190285_364_1311 | 304 |
| 139 | iso_pu_bacteria | 2508501123 | 2509118517 | 304 |
| 140 | iso_pu_bacteria | 2512875016 | 2512932565 | 304 |
| 141 | iso_pu_bacteria | 2513237305 | 2514416491 | 304 |
| 142 | iso_pu_bacteria | 2721755686 | 2723574417 | 304 |
| 143 | iso_pu_bacteria | 2756170246 | 2756671505 | 304 |
| 144 | iso_pu_bacteria | 2791355123 | 2792747998 | 304 |
| 145 | iso_pu_bacteria | 2844002411 | 2844008584 | 304 |
| 146 | iso_pu_bacteria | 2874123672 | 2874124087 | 304 |
| 147 | iso_pu_bacteria | 2876363079 | 2876365182 | 304 |
| 148 | iso_pu_bacteria | 2903448605 | 2903450182 | 304 |
| 149 | iso_pu_bacteria | 2903521522 | 2903522083 | 304 |
| 150 | iso_pu_bacteria | 2903528002 | 2903528461 | 304 |
| 151 | iso_pu_bacteria | 2963644680 | 2963646637 | 304 |
| 152 | iso_pu_bacteria | 2968083720 | 2968090570 | 304 |
| 153 | iso_pu_bacteria | 3004334049 | 3004335766 | 304 |
| 154 | 3300028379 | Ga0268266_10221401 | Ga0268266_102214012 | 305 |
| 155 | 3300031456 | Ga0307513_10346345 | Ga0307513_103463452 | 305 |
| 156 | 3300049568 | Ga0501031_0155589 | Ga0501031_0155589_194_1120 | 305 |
| 157 | 3300049569 | Ga0501032_0094093 | Ga0501032_0094093_720_1646 | 305 |
| 158 | 3300049570 | Ga0501033_0007442 | Ga0501033_0007442_4471_5397 | 305 |
| 159 | 3300049572 | Ga0501036_0397999 | Ga0501036_0397999_26_952 | 305 |
| 160 | 3300049573 | Ga0501037_0140463 | Ga0501037_0140463_446_1372 | 305 |
| 161 | 3300049579 | Ga0501043_0015283 | Ga0501043_0015283_49_975 | 305 |
| 162 | 3300049579 | Ga0501043_0304439 | Ga0501043_0304439_216_1142 | 305 |
| 163 | 3300049580 | Ga0501046_0205003 | Ga0501046_0205003_104_1030 | 305 |
| 164 | 3300049581 | Ga0501047_0249277 | Ga0501047_0249277_530_1456 | 305 |
| 165 | 3300049585 | Ga0501069_0013087 | Ga0501069_0013087_2463_3389 | 305 |
| 166 | 3300049586 | Ga0501070_0000229 | Ga0501070_0000229_14518_15444 | 305 |
| 167 | 3300049590 | Ga0501074_0033019 | Ga0501074_0033019_2158_3084 | 305 |
| 168 | 3300049742 | Ga0501080_0000724 | Ga0501080_0000724_22950_23876 | 305 |
| 169 | 3300049744 | Ga0501083_0328061 | Ga0501083_0328061_41_967 | 305 |
| 170 | 3300049822 | Ga0501035_0000373 | Ga0501035_0000373_44964_45890 | 305 |
| 171 | 3300049823 | Ga0501044_0030256 | Ga0501044_0030256_3602_4528 | 305 |
| 172 | iso_pu_bacteria | 2509276018 | 2509369566 | 305 |
| 173 | iso_pu_bacteria | 2599185301 | 2599936432 | 305 |
| 174 | iso_pu_bacteria | 2643221595 | 2643984871 | 305 |
| 175 | iso_pu_bacteria | 2693429783 | 2694628722 | 305 |
| 176 | iso_pu_bacteria | 2693429784 | 2694637364 | 305 |
| 177 | iso_pu_bacteria | 2844009547 | 2844012595 | 305 |
| 178 | iso_pu_bacteria | 2847670302 | 2847674996 | 305 |
| 179 | iso_pu_bacteria | 2856314179 | 2856320714 | 305 |
| 180 | iso_pu_bacteria | 2856328259 | 2856334836 | 305 |
| 181 | iso_pu_bacteria | 2856334872 | 2856341613 | 305 |
| 182 | iso_pu_bacteria | 2856364286 | 2856368036 | 305 |
| 183 | iso_pu_bacteria | 2857349434 | 2857351842 | 305 |
| 184 | iso_pu_bacteria | 2857367948 | 2857371262 | 305 |
| 185 | iso_pu_bacteria | 2869169390 | 2869171486 | 305 |
| 186 | iso_pu_bacteria | 2869234852 | 2869241547 | 305 |
| 187 | iso_pu_bacteria | 2869242130 | 2869247878 | 305 |
| 188 | iso_pu_bacteria | 2869249662 | 2869251590 | 305 |
| 189 | iso_pu_bacteria | 2869256925 | 2869260130 | 305 |
| 190 | iso_pu_bacteria | 2869264136 | 2869265208 | 305 |
| 191 | iso_pu_bacteria | 2869285874 | 2869290345 | 305 |
| 192 | iso_pu_bacteria | 2871429161 | 2871432629 | 305 |
| 193 | iso_pu_bacteria | 2871435913 | 2871436949 | 305 |
| 194 | iso_pu_bacteria | 2871444079 | 2871444655 | 305 |
| 195 | iso_pu_bacteria | 2871459585 | 2871460328 | 305 |
| 196 | iso_pu_bacteria | 2874109183 | 2874113735 | 305 |
| 197 | iso_pu_bacteria | 2874116593 | 2874122150 | 305 |
| 198 | iso_pu_bacteria | 2874131515 | 2874134835 | 305 |
| 199 | iso_pu_bacteria | 2874146452 | 2874152596 | 305 |
| 200 | iso_pu_bacteria | 2874155637 | 2874159996 | 305 |
| 201 | iso_pu_bacteria | 2874162495 | 2874167986 | 305 |
| 202 | iso_pu_bacteria | 2876377896 | 2876384843 | 305 |
| 203 | iso_pu_bacteria | 2876386047 | 2876387480 | 305 |
| 204 | iso_pu_bacteria | 2876392853 | 2876397995 | 305 |
| 205 | iso_pu_bacteria | 2876399893 | 2876402831 | 305 |
| 206 | iso_pu_bacteria | 2876406927 | 2876410726 | 305 |
| 207 | iso_pu_bacteria | 2876413966 | 2876418512 | 305 |
| 208 | iso_pu_bacteria | 2878035449 | 2878035983 | 305 |
| 209 | iso_pu_bacteria | 2878745973 | 2878750243 | 305 |
| 210 | iso_pu_bacteria | 2878774303 | 2878778622 | 305 |
| 211 | iso_pu_bacteria | 2878781027 | 2878787597 | 305 |
| 212 | iso_pu_bacteria | 2881147464 | 2881149893 | 305 |
| 213 | iso_pu_bacteria | 2881161766 | 2881166774 | 305 |
| 214 | iso_pu_bacteria | 2882632389 | 2882632534 | 305 |
| 215 | iso_pu_bacteria | 2889010040 | 2889010108 | 305 |
| 216 | iso_pu_bacteria | 2903492973 | 2903504461 | 305 |
| 217 | iso_pu_bacteria | 2904659560 | 2904664646 | 305 |
| 218 | iso_pu_bacteria | 2906308376 | 2906312601 | 305 |
| 219 | iso_pu_bacteria | 2906321335 | 2906325310 | 305 |
| 220 | iso_pu_bacteria | 2906363423 | 2906369659 | 305 |
| 221 | iso_pu_bacteria | 2906370794 | 2906373346 | 305 |
| 222 | iso_pu_bacteria | 2906386501 | 2906389933 | 305 |
| 223 | iso_pu_bacteria | 2906393657 | 2906395689 | 305 |
| 224 | iso_pu_bacteria | 2906401398 | 2906402523 | 305 |
| 225 | iso_pu_bacteria | 2906408224 | 2906411327 | 305 |
| 226 | iso_pu_bacteria | 2906414383 | 2906419837 | 305 |
| 227 | iso_pu_bacteria | 2906427513 | 2906429929 | 305 |
| 228 | iso_pu_bacteria | 2922151315 | 2922155898 | 305 |
| 229 | iso_pu_bacteria | 2922158528 | 2922165227 | 305 |
| 230 | iso_pu_bacteria | 2922172374 | 2922172771 | 305 |
| 231 | iso_pu_bacteria | 2922178524 | 2922182915 | 305 |
| 232 | iso_pu_bacteria | 2924741084 | 2924747581 | 305 |
| 233 | iso_pu_bacteria | 2924748358 | 2924750659 | 305 |
| 234 | iso_pu_bacteria | 2937813078 | 2937819254 | 305 |
| 235 | iso_pu_bacteria | 2937868953 | 2937876294 | 305 |
| 236 | iso_pu_bacteria | 2937980651 | 2937982515 | 305 |
| 237 | iso_pu_bacteria | 2938014810 | 2938021135 | 305 |
| 238 | iso_pu_bacteria | 2958108152 | 2958109870 | 305 |
| 239 | iso_pu_bacteria | 2958122699 | 2958129449 | 305 |
| 240 | iso_pu_bacteria | 2958130278 | 2958134733 | 305 |
| 241 | iso_pu_bacteria | 2958137437 | 2958139937 | 305 |
| 242 | iso_pu_bacteria | 2958158011 | 2958158727 | 305 |
| 243 | iso_pu_bacteria | 2958179912 | 2958186487 | 305 |
| 244 | iso_pu_bacteria | 2961077736 | 2961084986 | 305 |
| 245 | iso_pu_bacteria | 2961114664 | 2961119644 | 305 |
| 246 | iso_pu_bacteria | 2961136820 | 2961137251 | 305 |
| 247 | iso_pu_bacteria | 2961183825 | 2961190234 | 305 |
| 248 | iso_pu_bacteria | 2965025482 | 2965027591 | 305 |
| 249 | iso_pu_bacteria | 2965032056 | 2965033271 | 305 |
| 250 | iso_pu_bacteria | 2965040258 | 2965043469 | 305 |
| 251 | iso_pu_bacteria | 2965047637 | 2965048959 | 305 |
| 252 | iso_pu_bacteria | 2965089291 | 2965089582 | 305 |
| 253 | iso_pu_bacteria | 2968110612 | 2968115899 | 305 |
| 254 | iso_pu_bacteria | 2968138860 | 2968142663 | 305 |
| 255 | iso_pu_bacteria | 2970510686 | 2970515327 | 305 |
| 256 | iso_pu_bacteria | 2970532167 | 2970534675 | 305 |
| 257 | iso_pu_bacteria | 2970547951 | 2970552292 | 305 |
| 258 | iso_pu_bacteria | 2970627176 | 2970632736 | 305 |
| 259 | iso_pu_bacteria | 2977843712 | 2977848389 | 305 |
| 260 | iso_pu_bacteria | 2977851361 | 2977855566 | 305 |
| 261 | iso_pu_bacteria | 2977858184 | 2977859083 | 305 |
| 262 | iso_pu_bacteria | 2977864932 | 2977865143 | 305 |
| 263 | iso_pu_bacteria | 2977872689 | 2977880108 | 305 |
| 264 | iso_pu_bacteria | 2977915119 | 2977916607 | 305 |
| 265 | iso_pu_bacteria | 2977935797 | 2977940301 | 305 |
| 266 | iso_pu_bacteria | 2977942078 | 2977944762 | 305 |
| 267 | iso_pu_bacteria | 2977950692 | 2977952131 | 305 |
| 268 | iso_pu_bacteria | 2977957713 | 2977962329 | 305 |
| 269 | iso_pu_bacteria | 2979764755 | 2979770007 | 305 |
| 270 | iso_pu_bacteria | 2979772303 | 2979779286 | 305 |
| 271 | iso_pu_bacteria | 2979793036 | 2979797576 | 305 |
| 272 | iso_pu_bacteria | 2987636660 | 2987639026 | 305 |
| 273 | iso_pu_bacteria | 2987645492 | 2987647026 | 305 |
| 274 | iso_pu_bacteria | 2987673487 | 2987680975 | 305 |
| 275 | iso_pu_bacteria | 2996310559 | 2996312115 | 305 |
| 276 | iso_pu_bacteria | 2996341866 | 2996344243 | 305 |
| 277 | iso_pu_bacteria | 2996386984 | 2996390000 | 305 |
| 278 | iso_pu_bacteria | 3004203850 | 3004204731 | 305 |
| 279 | iso_pu_bacteria | 3004232784 | 3004234127 | 305 |
| 280 | iso_pu_bacteria | 3004248173 | 3004249893 | 305 |
| 281 | iso_pu_bacteria | 3004268573 | 3004273926 | 305 |
| 282 | iso_pu_bacteria | 8004300914 | 8004302667 | 305 |
| 283 | iso_pu_bacteria | 8004312739 | 8004318776 | 305 |
| 284 | iso_pu_bacteria | 8004361976 | 8004362200 | 305 |
| 285 | iso_pu_bacteria | 8004387939 | 8004392551 | 305 |
| 286 | iso_pu_bacteria | 8004445564 | 8004449136 | 305 |
| 287 | iso_pu_bacteria | 8004640170 | 8004645155 | 305 |
| 288 | iso_pu_bacteria | 8004714634 | 8004718860 | 305 |
| 289 | iso_pu_bacteria | 8004727605 | 8004731842 | 305 |
| 290 | 3300005539 | Ga0068853_100013075 | Ga0068853_1000130753 | 306 |
| 291 | 3300005539 | Ga0068853_100472265 | Ga0068853_1004722651 | 306 |
| 292 | 3300006038 | Ga0075365_10037523 | Ga0075365_100375234 | 306 |
| 293 | 3300006048 | Ga0075363_100000229 | Ga0075363_1000002292 | 306 |
| 294 | 3300006353 | Ga0075370_10086206 | Ga0075370_100862062 | 306 |
| 295 | 3300006881 | Ga0068865_100387690 | Ga0068865_1003876901 | 306 |
| 296 | 3300009174 | Ga0105241_10047803 | Ga0105241_100478032 | 306 |
| 297 | 3300009177 | Ga0105248_10642833 | Ga0105248_106428331 | 306 |
| 298 | 3300009545 | Ga0105237_10005230 | Ga0105237_100052303 | 306 |
| 299 | 3300009551 | Ga0105238_10005636 | Ga0105238_100056367 | 306 |
| 300 | 3300009551 | Ga0105238_10067509 | Ga0105238_100675093 | 306 |
| 301 | 3300010375 | Ga0105239_10039006 | Ga0105239_100390064 | 306 |
| 302 | 3300013104 | Ga0157370_10173752 | Ga0157370_101737522 | 306 |
| 303 | 3300013105 | Ga0157369_10074750 | Ga0157369_100747505 | 306 |
| 304 | 3300013105 | Ga0157369_10246474 | Ga0157369_102464742 | 306 |
| 305 | 3300025913 | Ga0207695_10083580 | Ga0207695_100835803 | 306 |
| 306 | 3300025914 | Ga0207671_10007609 | Ga0207671_100076096 | 306 |
| 307 | 3300025924 | Ga0207694_10020591 | Ga0207694_100205916 | 306 |
| 308 | 3300025935 | Ga0207709_10167389 | Ga0207709_101673892 | 306 |
| 309 | 3300026041 | Ga0207639_10006049 | Ga0207639_100060493 | 306 |
| 310 | 3300046515 | Ga0495620_0072030 | Ga0495620_0072030_159_1085 | 306 |
| 311 | 3300046616 | Ga0495668_0098555 | Ga0495668_0098555_466_1392 | 306 |
| 312 | 3300046660 | Ga0495625_0237513 | Ga0495625_0237513_157_1083 | 306 |
| 313 | 3300048911 | Ga0496108_0155035 | Ga0496108_0155035_588_1520 | 306 |
| 314 | 3300049568 | Ga0501031_0000007 | Ga0501031_0000007_19737_20696 | 306 |
| 315 | 3300049569 | Ga0501032_0000007 | Ga0501032_0000007_145313_146272 | 306 |
| 316 | 3300049570 | Ga0501033_0000051 | Ga0501033_0000051_2737_3696 | 306 |
| 317 | 3300049571 | Ga0501034_0000029 | Ga0501034_0000029_107610_108569 | 306 |
| 318 | 3300049572 | Ga0501036_0000004 | Ga0501036_0000004_107610_108569 | 306 |
| 319 | 3300049573 | Ga0501037_0000004 | Ga0501037_0000004_145313_146272 | 306 |
| 320 | 3300049574 | Ga0501038_0000005 | Ga0501038_0000005_107610_108569 | 306 |
| 321 | 3300049575 | Ga0501039_0000009 | Ga0501039_0000009_107610_108569 | 306 |
| 322 | 3300049579 | Ga0501043_0001215 | Ga0501043_0001215_2636_3595 | 306 |
| 323 | 3300049581 | Ga0501047_0039291 | Ga0501047_0039291_2680_3639 | 306 |
| 324 | 3300049586 | Ga0501070_0045121 | Ga0501070_0045121_831_1790 | 306 |
| 325 | 3300049822 | Ga0501035_0000014 | Ga0501035_0000014_107610_108569 | 306 |
| 326 | 3300049822 | Ga0501035_0013614 | Ga0501035_0013614_5820_6749 | 306 |
| 327 | 3300049823 | Ga0501044_0000012 | Ga0501044_0000012_145313_146272 | 306 |
| 328 | 3300049823 | Ga0501044_0534597 | Ga0501044_0534597_69_998 | 306 |
| 329 | 3300049823 | Ga0501044_0562666 | Ga0501044_0562666_74_1003 | 306 |
| 330 | 3300050492 | nmdc:mga0yw44_1659_c1 | nmdc:mga0yw44_1659_c1_6214_7146 | 306 |
| 331 | 3300050492 | nmdc:mga0yw44_20310_c1 | nmdc:mga0yw44_20310_c1_2745_3671 | 306 |
| 332 | 3300050494 | nmdc:mga06z11_98107_c1 | nmdc:mga06z11_98107_c1_312_1241 | 306 |
| 333 | 3300050496 | nmdc:mga07m45_54354_c1 | nmdc:mga07m45_54354_c1_1178_2110 | 306 |
| 334 | 3300050516 | nmdc:mga0sz30_7642_c1 | nmdc:mga0sz30_7642_c1_223_1149 | 306 |
| 335 | iso_pu_bacteria | 2643221627 | 2644153201 | 306 |
| 336 | iso_pu_bacteria | 2687453392 | 2688597215 | 306 |
| 337 | iso_pu_bacteria | 2871451962 | 2871452302 | 306 |
| 338 | iso_pu_bacteria | 2871495908 | 2871496774 | 306 |
| 339 | iso_pu_bacteria | 2874168670 | 2874174815 | 306 |
| 340 | iso_pu_bacteria | 2878760144 | 2878760998 | 306 |
| 341 | iso_pu_bacteria | 2878767105 | 2878767962 | 306 |
| 342 | iso_pu_bacteria | 2903540706 | 2903541570 | 306 |
| 343 | iso_pu_bacteria | 2924733363 | 2924737904 | 306 |
| 344 | iso_pu_bacteria | 2937848649 | 2937852031 | 306 |
| 345 | iso_pu_bacteria | 2937994558 | 2937995427 | 306 |
| 346 | iso_pu_bacteria | 2958165035 | 2958165900 | 306 |
| 347 | iso_pu_bacteria | 2961163497 | 2961164363 | 306 |
| 348 | iso_pu_bacteria | 2965018300 | 2965019349 | 306 |
| 349 | iso_pu_bacteria | 2968171901 | 2968172764 | 306 |
| 350 | iso_pu_bacteria | 2970489779 | 2970490674 | 306 |
| 351 | iso_pu_bacteria | 2970554993 | 2970555856 | 306 |
| 352 | iso_pu_bacteria | 2977922695 | 2977922955 | 306 |
| 353 | iso_pu_bacteria | 2987659509 | 2987660367 | 306 |
| 354 | iso_pu_bacteria | 3004188549 | 3004189418 | 306 |
| 355 | iso_pu_bacteria | 3004211236 | 3004218032 | 306 |
| 356 | iso_pu_bacteria | 3004218560 | 3004220920 | 306 |
| 357 | iso_pu_bacteria | 649633066 | 649871769 | 306 |
| 358 | iso_pu_bacteria | 8004695233 | 8004699334 | 306 |
| 359 | 3300005356 | Ga0070674_100130107 | Ga0070674_1001301072 | 307 |
| 360 | 3300005459 | Ga0068867_100101401 | Ga0068867_1001014014 | 307 |
| 361 | 3300025246 | Ga0209646_1014253 | Ga0209646_10142532 | 307 |
| 362 | 3300025250 | Ga0209026_1000029 | Ga0209026_1000029161 | 307 |
| 363 | 3300025256 | Ga0209759_1000040 | Ga0209759_100004015 | 307 |
| 364 | 3300003762 | Ga0055542_1000981 | Ga0055542_100098114 | 308 |
| 365 | 3300003763 | Ga0055529_1001600 | Ga0055529_10016005 | 308 |
| 366 | 3300006038 | Ga0075365_10009658 | Ga0075365_100096584 | 308 |
| 367 | 3300014325 | Ga0163163_10210651 | Ga0163163_102106512 | 308 |
| 368 | 3300015261 | Ga0182006_1025652 | Ga0182006_10256523 | 308 |
| 369 | 3300015265 | Ga0182005_1034187 | Ga0182005_10341872 | 308 |
| 370 | 3300025254 | Ga0209148_1000080 | Ga0209148_1000080104 | 308 |
| 371 | 3300025272 | Ga0209455_1000171 | Ga0209455_100017151 | 308 |
| 372 | 3300025914 | Ga0207671_10056911 | Ga0207671_100569112 | 308 |
| 373 | 3300026089 | Ga0207648_10061983 | Ga0207648_100619833 | 308 |
| 374 | 3300048927 | Ga0496124_0144430 | Ga0496124_0144430_313_1251 | 308 |
| 375 | 3300003214 | JGI25165J46597_1000042 | JGI25165J46597_1000042136 | 309 |
| 376 | 3300005366 | Ga0070659_100278920 | Ga0070659_1002789201 | 309 |
| 377 | 3300005539 | Ga0068853_100103370 | Ga0068853_1001033703 | 309 |
| 378 | 3300005563 | Ga0068855_100159988 | Ga0068855_1001599882 | 309 |
| 379 | 3300005577 | Ga0068857_100114849 | Ga0068857_1001148492 | 309 |
| 380 | 3300005614 | Ga0068856_100637116 | Ga0068856_1006371161 | 309 |
| 381 | 3300005937 | Ga0081455_10102059 | Ga0081455_101020592 | 309 |
| 382 | 3300010375 | Ga0105239_10471490 | Ga0105239_104714902 | 309 |
| 383 | 3300025261 | Ga0209233_1000028 | Ga0209233_1000028428 | 309 |
| 384 | 3300025297 | Ga0209758_1004174 | Ga0209758_10041746 | 309 |
| 385 | 3300025904 | Ga0207647_10061712 | Ga0207647_100617122 | 309 |
| 386 | 3300025949 | Ga0207667_10155182 | Ga0207667_101551822 | 309 |
| 387 | 3300026041 | Ga0207639_10077468 | Ga0207639_100774682 | 309 |
| 388 | 3300026116 | Ga0207674_10056954 | Ga0207674_100569543 | 309 |
| 389 | 3300037418 | Ga0395900_0091055 | Ga0395900_0091055_299_1234 | 309 |
| 390 | 3300037471 | Ga0395905_0044707 | Ga0395905_0044707_2063_2998 | 309 |
| 391 | 3300037471 | Ga0395905_0110052 | Ga0395905_0110052_111_1040 | 309 |
| 392 | 3300037471 | Ga0395905_0240814 | Ga0395905_0240814_16_951 | 309 |
| 393 | 3300044658 | Ga0466972_0004602 | Ga0466972_0004602_335_1264 | 309 |
| 394 | 3300044901 | Ga0466960_0009402 | Ga0466960_0009402_987_1916 | 309 |
| 395 | 3300048922 | Ga0496119_0046375 | Ga0496119_0046375_1163_2098 | 309 |
| 396 | 3300048923 | Ga0496120_0001370 | Ga0496120_0001370_2078_3013 | 309 |
| 397 | 3300050494 | nmdc:mga06z11_69803_c1 | nmdc:mga06z11_69803_c1_412_1347 | 309 |
| 398 | iso_pu_bacteria | 2885326080 | 2885329762 | 309 |
| 399 | iso_pu_bacteria | 2885334103 | 2885334737 | 309 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5lte-assembly1.cif.gz_A | crystal structure of the alpha subunit of heme dependent oxidative n-demethylase (hodm) | 0.7154 | 10 | 305 |
| 5lte-assembly1.cif.gz_A | crystal structure of the alpha subunit of heme dependent oxidative n-demethylase (hodm) | 0.6862 | 10 | 305 |
| 8ck4-assembly1.cif.gz_A | structure of hif2a-arnt heterodimer in complex with (4s)-1-(3,5-difluorophenyl)-5,5-difluoro-3-methanesulfonyl-4,5,6,7-tetrahydro-2-benzothiophen-4-ol | 0.6009 | 119 | 253 |
| 3lif-assembly2.cif.gz_B | crystal structure of the extracellular domain of the putative histidine kinase rphk1s-z16 | 0.5639 | 233 | 264 |
| 8ck4-assembly1.cif.gz_A | structure of hif2a-arnt heterodimer in complex with (4s)-1-(3,5-difluorophenyl)-5,5-difluoro-3-methanesulfonyl-4,5,6,7-tetrahydro-2-benzothiophen-4-ol | 0.5443 | 119 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3cswD01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.6745 | 233 | 251 | 3.30.470.10 |
| af_Q9Z1L5_477_622_3.30.450.20 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain | 0.6403 | 185 | 254 | 3.30.450.20 |
| 3lifB02 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain | 0.6128 | 233 | 254 | 3.30.450.20 |
| af_A0A1D8PJC6_408_551_2.60.40.1670 | Mainly Beta;Sandwich;Immunoglobulin-like;beta-sandwich domain of Sec23/24 | 0.5976 | 219 | 255 | 2.60.40.1670 |
| af_I1NDE0_256_535_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.5729 | 180 | 255 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1DBH0-F1-model_v4 | DUF3445 domain-containing protein | 0.92 | 211 | 306 |
|
| AF-A0A530A437-F1-model_v4 | deleted | 0.8928 | 191 | 309 |
|
| AF-A0A3S1DBH0-F1-model_v4 | DUF3445 domain-containing protein | 0.8854 | 211 | 306 |
|
| AF-A0A530A437-F1-model_v4 | deleted | 0.8792 | 191 | 309 |
|
| AF-U5H0E0-F1-model_v4 | Uncharacterized protein | 0.8758 | 21 | 84 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar