F434404

General Info

Members Datasets Scaffolds Average Seq Length
399 323 167 308

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0016361|Ga0501033_0016361_2490_3464
Length 324
Sequence LRLFVRQVIGGTDSEVFDVAATPAHAPYDGSSKPFTIGLKPLALADWIEVDDNLFAHLAEKRRLYAEMPEKVFVEEPDTRTAQQEVLDMLTAHLPERFPRTYAVAGDEVAVRNLPPAQALALDAPLVAASLLVQEDLILMRRGEDGWRLAAGSLCFPSSWTLTEKFGKTLHTIHIPVPGFGPGSRPDELIARMFDGLQGQAMERFNWSIQAGDALYHPLSNIQRDDRATTRPSRFADEEDINASAFIRVERQTLRKLPISRDVLFTIRIHLDPLAVLTRHPDKARLAASFAAQLTALDTAQLDYKGLTADRDRLVDWLQAAAAA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
12 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
13 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
14 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
15 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
16 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
17 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
18 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
19 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
20 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
21 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
22 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
23 2738543024 Aminobacter sp. AP02 Isolate Unclassified
24 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
25 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
26 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
27 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
28 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
29 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
30 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
31 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
32 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
33 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
34 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
35 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
36 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
37 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
38 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
39 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
40 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
41 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
42 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
43 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
44 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
45 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
46 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
47 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
48 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
49 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
50 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
51 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
52 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
53 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
54 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
55 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
56 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
57 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
58 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
59 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
60 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
61 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
62 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
63 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
64 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
65 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
66 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
67 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
68 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
69 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
70 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
71 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
72 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
73 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
74 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
75 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
76 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
77 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
78 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
79 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
80 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
81 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
82 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
83 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
84 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
85 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
86 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
87 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
88 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
89 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
90 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
91 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
92 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
93 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
94 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
95 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
96 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
97 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
98 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
99 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
100 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
101 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
102 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
103 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
104 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
105 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
106 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
107 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
108 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
109 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
110 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
111 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
112 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
113 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
114 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
115 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
116 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
117 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
118 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
119 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
120 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
121 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
122 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
123 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
124 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
125 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
126 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
127 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
128 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
129 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
130 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
131 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
132 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
133 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
134 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
135 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
136 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
137 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
138 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
139 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
140 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
141 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
142 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
143 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
144 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
145 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
146 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
147 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
148 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
149 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
150 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
151 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
152 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
153 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
154 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
155 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
156 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
157 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
158 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
159 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
160 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
161 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
162 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
163 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
164 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
165 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
166 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
167 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
168 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
169 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
170 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
171 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
172 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
173 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
174 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
175 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
176 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
177 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
178 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
179 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
180 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
181 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
182 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
183 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
184 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
185 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
186 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
187 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
188 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
189 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
190 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
191 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
192 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
193 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
194 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
195 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
196 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
197 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
198 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
199 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
200 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
201 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
202 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
203 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
204 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
205 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
206 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
207 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
208 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
209 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
210 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
211 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
212 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
213 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
214 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
215 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
216 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
217 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
218 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
219 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
220 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
221 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
222 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
223 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
224 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
225 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
226 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
227 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
228 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
229 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
230 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
231 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
232 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
233 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
234 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
235 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
236 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
237 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
238 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
239 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
240 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
241 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
242 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
243 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
244 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
245 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
246 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
247 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
249 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
250 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
252 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
268 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
306 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
307 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
308 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
309 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
312 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
313 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
314 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
315 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
316 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
317 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
318 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
319 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
320 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
321 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
322 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
323 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.85
Metatranscriptomes 0
Isolates 58.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 51.13
Rhizoplane 0.5
Rhizosphere 35.34
Stem 0
Stem Tuber 0
Unclassified 7.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000042 3300003214 Bacteria 271606
2 Ga0055542_1000981 3300003762 Bacteria 18535
3 Ga0055529_1001600 3300003763 Bacteria 6140
4 Ga0070674_100130107 3300005356 Bacteria 1875
5 Ga0070659_100278920 3300005366 Bacteria 1390
6 Ga0068867_100101401 3300005459 Bacteria 2199
7 Ga0068853_100013075 3300005539 Bacteria 6770
8 Ga0068853_100103370 3300005539 Bacteria 2522
9 Ga0068853_100472265 3300005539 Bacteria 1182
10 Ga0070665_100048093 3300005548 Bacteria 4283
11 Ga0068855_100159988 3300005563 Bacteria 2557
12 Ga0068857_100114849 3300005577 Bacteria 2422
13 Ga0068856_100637116 3300005614 Bacteria 1087
14 Ga0081455_10102059 3300005937 Bacteria 2301
15 Ga0081539_10016432 3300005985 Bacteria 5285
16 Ga0075365_10009658 3300006038 Bacteria 5567
17 Ga0075365_10037523 3300006038 Bacteria 3146
18 Ga0075363_100000229 3300006048 Bacteria 15640
19 Ga0075370_10086206 3300006353 Bacteria 1808
20 Ga0068865_100387690 3300006881 Bacteria 1141
21 Ga0105241_10047803 3300009174 Bacteria 3255
22 Ga0105248_10642833 3300009177 Bacteria 1197
23 Ga0105237_10005230 3300009545 Bacteria 14682
24 Ga0105238_10005636 3300009551 Bacteria 12375
25 Ga0105238_10067509 3300009551 Bacteria 3577
26 Ga0105239_10039006 3300010375 Bacteria 5203
27 Ga0105239_10471490 3300010375 Bacteria 1426
28 Ga0157370_10173752 3300013104 Bacteria 2002
29 Ga0157369_10074750 3300013105 Bacteria 3634
30 Ga0157369_10246474 3300013105 Bacteria 1865
31 Ga0163163_10210651 3300014325 Bacteria 1993
32 Ga0182006_1025652 3300015261 Bacteria 2419
33 Ga0182005_1034187 3300015265 Bacteria 1383
34 Ga0209646_1014253 3300025246 Bacteria 1199
35 Ga0209026_1000029 3300025250 Bacteria 337109
36 Ga0209148_1000080 3300025254 Bacteria 277806
37 Ga0209759_1000040 3300025256 Bacteria 254501
38 Ga0209233_1000028 3300025261 Bacteria 642062
39 Ga0209455_1000171 3300025272 Bacteria 109696
40 Ga0209758_1004174 3300025297 Bacteria 12281
41 Ga0207647_10061712 3300025904 Bacteria 2286
42 Ga0207695_10083580 3300025913 Bacteria 3225
43 Ga0207671_10007609 3300025914 Bacteria 9372
44 Ga0207671_10056911 3300025914 Bacteria 2898
45 Ga0207694_10020591 3300025924 Bacteria 4993
46 Ga0207694_10097148 3300025924 Bacteria 2330
47 Ga0207709_10167389 3300025935 Bacteria 1539
48 Ga0207667_10155182 3300025949 Bacteria 2356
49 Ga0207639_10006049 3300026041 Bacteria 8212
50 Ga0207639_10077468 3300026041 Bacteria 2621
51 Ga0207678_10072285 3300026067 Bacteria 2956
52 Ga0207648_10061983 3300026089 Bacteria 3261
53 Ga0207674_10056954 3300026116 Bacteria 3965
54 Ga0268266_10034917 3300028379 Bacteria 4277
55 Ga0268266_10221401 3300028379 Bacteria 1740
56 Ga0307513_10346345 3300031456 Bacteria 1235
57 Ga0395900_0091055 3300037418 Bacteria 3134
58 Ga0395900_0105588 3300037418 Bacteria 2894
59 Ga0395898_0560898 3300037466 Bacteria 1084
60 Ga0395905_0044707 3300037471 Bacteria 4155
61 Ga0395905_0110052 3300037471 Bacteria 2587
62 Ga0395905_0240814 3300037471 Bacteria 1690
63 Ga0466972_0004602 3300044658 Bacteria 6911
64 Ga0466960_0009402 3300044901 Bacteria 4028
65 Ga0495620_0072030 3300046515 Bacteria 1412
66 Ga0495668_0098555 3300046616 Bacteria 1600
67 Ga0495625_0237513 3300046660 Bacteria 1188
68 Ga0496108_0155035 3300048911 Bacteria 1978
69 Ga0496119_0046375 3300048922 Bacteria 2715
70 Ga0496120_0001370 3300048923 Bacteria 29844
71 Ga0496124_0144430 3300048927 Bacteria 1874
72 Ga0501031_0000007 3300049568 Bacteria 166008
73 Ga0501031_0008039 3300049568 Bacteria 6869
74 Ga0501031_0093499 3300049568 Bacteria 1962
75 Ga0501031_0155589 3300049568 Bacteria 1494
76 Ga0501031_0210377 3300049568 Bacteria 1267
77 Ga0501032_0000007 3300049569 Bacteria 253881
78 Ga0501032_0001473 3300049569 Bacteria 18750
79 Ga0501032_0011413 3300049569 Bacteria 6383
80 Ga0501032_0094093 3300049569 Bacteria 1987
81 Ga0501032_0144247 3300049569 Bacteria 1567
82 Ga0501033_0000051 3300049570 Bacteria 111291
83 Ga0501033_0001192 3300049570 Bacteria 23475
84 Ga0501033_0004047 3300049570 Bacteria 11840
85 Ga0501033_0007442 3300049570 Bacteria 8527
86 Ga0501033_0016361 3300049570 Bacteria 5616
87 Ga0501034_0000029 3300049571 Bacteria 253881
88 Ga0501034_0007241 3300049571 Bacteria 11841
89 Ga0501036_0000004 3300049572 Bacteria 253881
90 Ga0501036_0116188 3300049572 Bacteria 2260
91 Ga0501036_0397999 3300049572 Bacteria 1149
92 Ga0501037_0000004 3300049573 Bacteria 253989
93 Ga0501037_0000264 3300049573 Bacteria 45296
94 Ga0501037_0140463 3300049573 Bacteria 1729
95 Ga0501038_0000005 3300049574 Bacteria 253881
96 Ga0501038_0148967 3300049574 Bacteria 1909
97 Ga0501039_0000009 3300049575 Bacteria 253881
98 Ga0501042_0007394 3300049578 Bacteria 7193
99 Ga0501043_0000620 3300049579 Bacteria 31329
100 Ga0501043_0001215 3300049579 Bacteria 22693
101 Ga0501043_0015283 3300049579 Bacteria 6013
102 Ga0501043_0019788 3300049579 Bacteria 5285
103 Ga0501043_0118755 3300049579 Bacteria 2074
104 Ga0501043_0304439 3300049579 Bacteria 1217
105 Ga0501046_0205003 3300049580 Bacteria 1466
106 Ga0501047_0039291 3300049581 Bacteria 4577
107 Ga0501047_0144363 3300049581 Bacteria 2257
108 Ga0501047_0249277 3300049581 Bacteria 1624
109 Ga0501048_0006373 3300049582 Bacteria 8968
110 Ga0501067_0092902 3300049583 Bacteria 1675
111 Ga0501068_0028906 3300049584 Bacteria 3281
112 Ga0501069_0000007 3300049585 Bacteria 182820
113 Ga0501069_0004063 3300049585 Bacteria 7556
114 Ga0501069_0013087 3300049585 Bacteria 4423
115 Ga0501070_0000229 3300049586 Bacteria 52795
116 Ga0501070_0001901 3300049586 Bacteria 18471
117 Ga0501070_0003212 3300049586 Bacteria 14212
118 Ga0501070_0023667 3300049586 Bacteria 5146
119 Ga0501070_0045121 3300049586 Bacteria 3666
120 Ga0501070_0104170 3300049586 Bacteria 2346
121 Ga0501070_0328033 3300049586 Bacteria 1244
122 Ga0501071_0082806 3300049587 Bacteria 2350
123 Ga0501071_0103203 3300049587 Bacteria 2103
124 Ga0501071_0319229 3300049587 Bacteria 1179
125 Ga0501072_0028309 3300049588 Bacteria 4375
126 Ga0501073_0035327 3300049589 Bacteria 3554
127 Ga0501074_0000254 3300049590 Bacteria 30127
128 Ga0501074_0033019 3300049590 Bacteria 3751
129 Ga0501074_0226722 3300049590 Bacteria 1330
130 Ga0501080_0000550 3300049742 Bacteria 29619
131 Ga0501080_0000724 3300049742 Bacteria 26629
132 Ga0501080_0017096 3300049742 Bacteria 6699
133 Ga0501080_0099467 3300049742 Bacteria 2699
134 Ga0501083_0000125 3300049744 Bacteria 52499
135 Ga0501083_0108723 3300049744 Bacteria 1824
136 Ga0501083_0328061 3300049744 Bacteria 995
137 Ga0501035_0000014 3300049822 Bacteria 253874
138 Ga0501035_0000274 3300049822 Bacteria 61155
139 Ga0501035_0000373 3300049822 Bacteria 51518
140 Ga0501035_0001928 3300049822 Bacteria 20781
141 Ga0501035_0012975 3300049822 Bacteria 7688
142 Ga0501035_0013614 3300049822 Bacteria 7504
143 Ga0501035_0048214 3300049822 Bacteria 3820
144 Ga0501035_0113729 3300049822 Bacteria 2371
145 Ga0501035_0295753 3300049822 Bacteria 1365
146 Ga0501044_0000009 3300049823 Bacteria 270072
147 Ga0501044_0000012 3300049823 Bacteria 253881
148 Ga0501044_0010493 3300049823 Bacteria 10054
149 Ga0501044_0027624 3300049823 Bacteria 5994
150 Ga0501044_0030256 3300049823 Bacteria 5707
151 Ga0501044_0153515 3300049823 Bacteria 2283
152 Ga0501044_0395832 3300049823 Bacteria 1294
153 Ga0501044_0528251 3300049823 Bacteria 1079
154 Ga0501044_0534597 3300049823 Bacteria 1071
155 Ga0501044_0562666 3300049823 Bacteria 1036
156 Ga0501045_0009505 3300049824 Bacteria 6805
157 nmdc:mga0yw44_1659_c1 3300050492 Bacteria 8980
158 nmdc:mga0yw44_20310_c1 3300050492 Bacteria 3684
159 nmdc:mga06z11_69803_c1 3300050494 Bacteria 1856
160 nmdc:mga06z11_98107_c1 3300050494 Bacteria 1603
161 nmdc:mga07m45_54354_c1 3300050496 Bacteria 2263
162 nmdc:mga0sz30_7642_c1 3300050516 Bacteria 3043
163 Ga0500643_046695 3300053087 Bacteria 1250
164 Ga0500568_0000177 3300053139 Bacteria 55762
165 Ga0500604_0023351 3300053151 Bacteria 1763
166 Ga0500620_001119 3300053155 Bacteria 4764
167 Ga0501082_0190285 3300060353 Bacteria 1785

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2924726620 2924727509 271
2 3300049586 Ga0501070_0328033 Ga0501070_0328033_41_931 277
3 iso_pu_bacteria 2958041894 2958056450 277
4 3300025924 Ga0207694_10097148 Ga0207694_100971484 283
5 iso_pu_bacteria 2977986579 2977987805 287
6 3300037418 Ga0395900_0105588 Ga0395900_0105588_1828_2730 290
7 3300049823 Ga0501044_0528251 Ga0501044_0528251_156_1049 290
8 iso_pu_bacteria 2513237351 2514587537 290
9 3300037466 Ga0395898_0560898 Ga0395898_0560898_63_986 291
10 3300049822 Ga0501035_0295753 Ga0501035_0295753_152_1078 291
11 iso_pu_bacteria 2871481445 2871484512 292
12 3300049823 Ga0501044_0153515 Ga0501044_0153515_1242_2192 293
13 iso_pu_bacteria 2643221550 2643774405 297
14 iso_pu_bacteria 2643221564 2643839069 297
15 iso_pu_bacteria 2643221623 2644133246 299
16 iso_pu_bacteria 2958064165 2958064918 299
17 iso_pu_bacteria 2510065059 2510319262 300
18 iso_pu_bacteria 2847686936 2847691098 300
19 iso_pu_bacteria 2869162929 2869163832 300
20 iso_pu_bacteria 2874102143 2874108814 300
21 iso_pu_bacteria 2906328253 2906330708 300
22 iso_pu_bacteria 2958115193 2958115488 300
23 iso_pu_bacteria 2965062239 2965062512 300
24 iso_pu_bacteria 2968091066 2968094746 300
25 iso_pu_bacteria 2968097103 2968103113 300
26 iso_pu_bacteria 2968128360 2968133684 300
27 iso_pu_bacteria 2979779861 2979785295 300
28 iso_pu_bacteria 8004703790 8004712080 300
29 3300005985 Ga0081539_10016432 Ga0081539_100164323 301
30 3300049570 Ga0501033_0016361 Ga0501033_0016361_2490_3464 301
31 3300049583 Ga0501067_0092902 Ga0501067_0092902_135_1049 301
32 iso_pu_bacteria 2503198000 2503199967 301
33 iso_pu_bacteria 2738543024 2739307516 301
34 iso_pu_bacteria 2996336353 2996338735 301
35 3300053139 Ga0500568_0000177 Ga0500568_0000177_30201_31118 302
36 iso_pu_bacteria 2512875024 2512960580 302
37 iso_pu_bacteria 2513237164 2514036330 302
38 iso_pu_bacteria 2588253730 2588518644 302
39 iso_pu_bacteria 2871488783 2871493247 302
40 iso_pu_bacteria 2876420981 2876424284 302
41 iso_pu_bacteria 2878753008 2878757292 302
42 iso_pu_bacteria 2881155292 2881161041 302
43 iso_pu_bacteria 2881853255 2881853882 302
44 iso_pu_bacteria 2881861095 2881866788 302
45 iso_pu_bacteria 2882912400 2882917488 302
46 iso_pu_bacteria 2885318864 2885319790 302
47 iso_pu_bacteria 2885350715 2885355400 302
48 iso_pu_bacteria 2903492973 2903501019 302
49 iso_pu_bacteria 2924762789 2924768115 302
50 iso_pu_bacteria 2924784321 2924786597 302
51 iso_pu_bacteria 2937822353 2937827805 302
52 iso_pu_bacteria 2961127735 2961133140 302
53 iso_pu_bacteria 2961170736 2961175379 302
54 iso_pu_bacteria 2967996073 2967999619 302
55 iso_pu_bacteria 2968003550 2968007977 302
56 iso_pu_bacteria 2970503327 2970507967 302
57 iso_pu_bacteria 2977821940 2977826451 302
58 iso_pu_bacteria 2977828996 2977830305 302
59 iso_pu_bacteria 2979808191 2979813151 302
60 iso_pu_bacteria 2987666974 2987671463 302
61 iso_pu_bacteria 8004374579 8004378867 302
62 3300005548 Ga0070665_100048093 Ga0070665_1000480932 303
63 3300028379 Ga0268266_10034917 Ga0268266_100349172 303
64 3300049568 Ga0501031_0008039 Ga0501031_0008039_2170_3102 303
65 3300049569 Ga0501032_0011413 Ga0501032_0011413_3390_4322 303
66 3300049570 Ga0501033_0004047 Ga0501033_0004047_2704_3636 303
67 3300049571 Ga0501034_0007241 Ga0501034_0007241_8205_9137 303
68 3300049578 Ga0501042_0007394 Ga0501042_0007394_3242_4174 303
69 3300049579 Ga0501043_0019788 Ga0501043_0019788_3390_4322 303
70 3300049582 Ga0501048_0006373 Ga0501048_0006373_2391_3323 303
71 3300049587 Ga0501071_0082806 Ga0501071_0082806_1180_2112 303
72 3300049588 Ga0501072_0028309 Ga0501072_0028309_1471_2403 303
73 3300049742 Ga0501080_0017096 Ga0501080_0017096_3389_4321 303
74 3300049822 Ga0501035_0001928 Ga0501035_0001928_8205_9137 303
75 3300049823 Ga0501044_0395832 Ga0501044_0395832_271_1203 303
76 3300049824 Ga0501045_0009505 Ga0501045_0009505_2722_3654 303
77 3300053087 Ga0500643_046695 Ga0500643_046695_242_1162 303
78 3300053155 Ga0500620_001119 Ga0500620_001119_1286_2203 303
79 iso_pu_bacteria 2509276022 2509394876 303
80 iso_pu_bacteria 2513237090 2513608679 303
81 iso_pu_bacteria 2856320880 2856323077 303
82 iso_pu_bacteria 2869278585 2869282628 303
83 iso_pu_bacteria 2874139085 2874142284 303
84 iso_pu_bacteria 2878738818 2878744532 303
85 iso_pu_bacteria 2888337043 2888338296 303
86 iso_pu_bacteria 2924718760 2924719827 303
87 iso_pu_bacteria 2924776078 2924782562 303
88 iso_pu_bacteria 2937877337 2937881205 303
89 iso_pu_bacteria 2937972304 2937977295 303
90 iso_pu_bacteria 2958034702 2958039411 303
91 iso_pu_bacteria 2958041894 2958052961 303
92 iso_pu_bacteria 2958084443 2958088238 303
93 iso_pu_bacteria 2958092219 2958100464 303
94 iso_pu_bacteria 2958144490 2958151019 303
95 iso_pu_bacteria 2968016561 2968020738 303
96 iso_pu_bacteria 2970469710 2970474035 303
97 iso_pu_bacteria 2970593180 2970597237 303
98 iso_pu_bacteria 2996348954 2996352645 303
99 iso_pu_bacteria 3004275668 3004279327 303
100 iso_pu_bacteria 3004289098 3004289269 303
101 iso_pu_bacteria 8002285264 8002291642 303
102 3300026067 Ga0207678_10072285 Ga0207678_100722853 304
103 3300049568 Ga0501031_0093499 Ga0501031_0093499_632_1579 304
104 3300049568 Ga0501031_0210377 Ga0501031_0210377_145_1092 304
105 3300049569 Ga0501032_0001473 Ga0501032_0001473_10363_11310 304
106 3300049569 Ga0501032_0144247 Ga0501032_0144247_56_1003 304
107 3300049570 Ga0501033_0001192 Ga0501033_0001192_20326_21273 304
108 3300049572 Ga0501036_0116188 Ga0501036_0116188_1120_2067 304
109 3300049573 Ga0501037_0000264 Ga0501037_0000264_10386_11333 304
110 3300049574 Ga0501038_0148967 Ga0501038_0148967_362_1309 304
111 3300049579 Ga0501043_0000620 Ga0501043_0000620_10403_11350 304
112 3300049579 Ga0501043_0118755 Ga0501043_0118755_11_958 304
113 3300049581 Ga0501047_0144363 Ga0501047_0144363_111_1058 304
114 3300049584 Ga0501068_0028906 Ga0501068_0028906_1165_2112 304
115 3300049585 Ga0501069_0000007 Ga0501069_0000007_10545_11492 304
116 3300049585 Ga0501069_0004063 Ga0501069_0004063_1046_1993 304
117 3300049586 Ga0501070_0001901 Ga0501070_0001901_11992_12939 304
118 3300049586 Ga0501070_0003212 Ga0501070_0003212_3585_4532 304
119 3300049586 Ga0501070_0023667 Ga0501070_0023667_3804_4727 304
120 3300049586 Ga0501070_0104170 Ga0501070_0104170_1112_2041 304
121 3300049587 Ga0501071_0103203 Ga0501071_0103203_321_1268 304
122 3300049587 Ga0501071_0319229 Ga0501071_0319229_58_1005 304
123 3300049589 Ga0501073_0035327 Ga0501073_0035327_2562_3509 304
124 3300049590 Ga0501074_0000254 Ga0501074_0000254_10403_11350 304
125 3300049590 Ga0501074_0226722 Ga0501074_0226722_358_1305 304
126 3300049742 Ga0501080_0000550 Ga0501080_0000550_8353_9300 304
127 3300049742 Ga0501080_0099467 Ga0501080_0099467_1284_2231 304
128 3300049744 Ga0501083_0000125 Ga0501083_0000125_10386_11333 304
129 3300049744 Ga0501083_0108723 Ga0501083_0108723_240_1187 304
130 3300049822 Ga0501035_0000274 Ga0501035_0000274_49823_50770 304
131 3300049822 Ga0501035_0012975 Ga0501035_0012975_1843_2766 304
132 3300049822 Ga0501035_0048214 Ga0501035_0048214_1440_2387 304
133 3300049822 Ga0501035_0113729 Ga0501035_0113729_966_1913 304
134 3300049823 Ga0501044_0000009 Ga0501044_0000009_10529_11476 304
135 3300049823 Ga0501044_0010493 Ga0501044_0010493_2708_3655 304
136 3300049823 Ga0501044_0027624 Ga0501044_0027624_1268_2191 304
137 3300053151 Ga0500604_0023351 Ga0500604_0023351_168_1088 304
138 3300060353 Ga0501082_0190285 Ga0501082_0190285_364_1311 304
139 iso_pu_bacteria 2508501123 2509118517 304
140 iso_pu_bacteria 2512875016 2512932565 304
141 iso_pu_bacteria 2513237305 2514416491 304
142 iso_pu_bacteria 2721755686 2723574417 304
143 iso_pu_bacteria 2756170246 2756671505 304
144 iso_pu_bacteria 2791355123 2792747998 304
145 iso_pu_bacteria 2844002411 2844008584 304
146 iso_pu_bacteria 2874123672 2874124087 304
147 iso_pu_bacteria 2876363079 2876365182 304
148 iso_pu_bacteria 2903448605 2903450182 304
149 iso_pu_bacteria 2903521522 2903522083 304
150 iso_pu_bacteria 2903528002 2903528461 304
151 iso_pu_bacteria 2963644680 2963646637 304
152 iso_pu_bacteria 2968083720 2968090570 304
153 iso_pu_bacteria 3004334049 3004335766 304
154 3300028379 Ga0268266_10221401 Ga0268266_102214012 305
155 3300031456 Ga0307513_10346345 Ga0307513_103463452 305
156 3300049568 Ga0501031_0155589 Ga0501031_0155589_194_1120 305
157 3300049569 Ga0501032_0094093 Ga0501032_0094093_720_1646 305
158 3300049570 Ga0501033_0007442 Ga0501033_0007442_4471_5397 305
159 3300049572 Ga0501036_0397999 Ga0501036_0397999_26_952 305
160 3300049573 Ga0501037_0140463 Ga0501037_0140463_446_1372 305
161 3300049579 Ga0501043_0015283 Ga0501043_0015283_49_975 305
162 3300049579 Ga0501043_0304439 Ga0501043_0304439_216_1142 305
163 3300049580 Ga0501046_0205003 Ga0501046_0205003_104_1030 305
164 3300049581 Ga0501047_0249277 Ga0501047_0249277_530_1456 305
165 3300049585 Ga0501069_0013087 Ga0501069_0013087_2463_3389 305
166 3300049586 Ga0501070_0000229 Ga0501070_0000229_14518_15444 305
167 3300049590 Ga0501074_0033019 Ga0501074_0033019_2158_3084 305
168 3300049742 Ga0501080_0000724 Ga0501080_0000724_22950_23876 305
169 3300049744 Ga0501083_0328061 Ga0501083_0328061_41_967 305
170 3300049822 Ga0501035_0000373 Ga0501035_0000373_44964_45890 305
171 3300049823 Ga0501044_0030256 Ga0501044_0030256_3602_4528 305
172 iso_pu_bacteria 2509276018 2509369566 305
173 iso_pu_bacteria 2599185301 2599936432 305
174 iso_pu_bacteria 2643221595 2643984871 305
175 iso_pu_bacteria 2693429783 2694628722 305
176 iso_pu_bacteria 2693429784 2694637364 305
177 iso_pu_bacteria 2844009547 2844012595 305
178 iso_pu_bacteria 2847670302 2847674996 305
179 iso_pu_bacteria 2856314179 2856320714 305
180 iso_pu_bacteria 2856328259 2856334836 305
181 iso_pu_bacteria 2856334872 2856341613 305
182 iso_pu_bacteria 2856364286 2856368036 305
183 iso_pu_bacteria 2857349434 2857351842 305
184 iso_pu_bacteria 2857367948 2857371262 305
185 iso_pu_bacteria 2869169390 2869171486 305
186 iso_pu_bacteria 2869234852 2869241547 305
187 iso_pu_bacteria 2869242130 2869247878 305
188 iso_pu_bacteria 2869249662 2869251590 305
189 iso_pu_bacteria 2869256925 2869260130 305
190 iso_pu_bacteria 2869264136 2869265208 305
191 iso_pu_bacteria 2869285874 2869290345 305
192 iso_pu_bacteria 2871429161 2871432629 305
193 iso_pu_bacteria 2871435913 2871436949 305
194 iso_pu_bacteria 2871444079 2871444655 305
195 iso_pu_bacteria 2871459585 2871460328 305
196 iso_pu_bacteria 2874109183 2874113735 305
197 iso_pu_bacteria 2874116593 2874122150 305
198 iso_pu_bacteria 2874131515 2874134835 305
199 iso_pu_bacteria 2874146452 2874152596 305
200 iso_pu_bacteria 2874155637 2874159996 305
201 iso_pu_bacteria 2874162495 2874167986 305
202 iso_pu_bacteria 2876377896 2876384843 305
203 iso_pu_bacteria 2876386047 2876387480 305
204 iso_pu_bacteria 2876392853 2876397995 305
205 iso_pu_bacteria 2876399893 2876402831 305
206 iso_pu_bacteria 2876406927 2876410726 305
207 iso_pu_bacteria 2876413966 2876418512 305
208 iso_pu_bacteria 2878035449 2878035983 305
209 iso_pu_bacteria 2878745973 2878750243 305
210 iso_pu_bacteria 2878774303 2878778622 305
211 iso_pu_bacteria 2878781027 2878787597 305
212 iso_pu_bacteria 2881147464 2881149893 305
213 iso_pu_bacteria 2881161766 2881166774 305
214 iso_pu_bacteria 2882632389 2882632534 305
215 iso_pu_bacteria 2889010040 2889010108 305
216 iso_pu_bacteria 2903492973 2903504461 305
217 iso_pu_bacteria 2904659560 2904664646 305
218 iso_pu_bacteria 2906308376 2906312601 305
219 iso_pu_bacteria 2906321335 2906325310 305
220 iso_pu_bacteria 2906363423 2906369659 305
221 iso_pu_bacteria 2906370794 2906373346 305
222 iso_pu_bacteria 2906386501 2906389933 305
223 iso_pu_bacteria 2906393657 2906395689 305
224 iso_pu_bacteria 2906401398 2906402523 305
225 iso_pu_bacteria 2906408224 2906411327 305
226 iso_pu_bacteria 2906414383 2906419837 305
227 iso_pu_bacteria 2906427513 2906429929 305
228 iso_pu_bacteria 2922151315 2922155898 305
229 iso_pu_bacteria 2922158528 2922165227 305
230 iso_pu_bacteria 2922172374 2922172771 305
231 iso_pu_bacteria 2922178524 2922182915 305
232 iso_pu_bacteria 2924741084 2924747581 305
233 iso_pu_bacteria 2924748358 2924750659 305
234 iso_pu_bacteria 2937813078 2937819254 305
235 iso_pu_bacteria 2937868953 2937876294 305
236 iso_pu_bacteria 2937980651 2937982515 305
237 iso_pu_bacteria 2938014810 2938021135 305
238 iso_pu_bacteria 2958108152 2958109870 305
239 iso_pu_bacteria 2958122699 2958129449 305
240 iso_pu_bacteria 2958130278 2958134733 305
241 iso_pu_bacteria 2958137437 2958139937 305
242 iso_pu_bacteria 2958158011 2958158727 305
243 iso_pu_bacteria 2958179912 2958186487 305
244 iso_pu_bacteria 2961077736 2961084986 305
245 iso_pu_bacteria 2961114664 2961119644 305
246 iso_pu_bacteria 2961136820 2961137251 305
247 iso_pu_bacteria 2961183825 2961190234 305
248 iso_pu_bacteria 2965025482 2965027591 305
249 iso_pu_bacteria 2965032056 2965033271 305
250 iso_pu_bacteria 2965040258 2965043469 305
251 iso_pu_bacteria 2965047637 2965048959 305
252 iso_pu_bacteria 2965089291 2965089582 305
253 iso_pu_bacteria 2968110612 2968115899 305
254 iso_pu_bacteria 2968138860 2968142663 305
255 iso_pu_bacteria 2970510686 2970515327 305
256 iso_pu_bacteria 2970532167 2970534675 305
257 iso_pu_bacteria 2970547951 2970552292 305
258 iso_pu_bacteria 2970627176 2970632736 305
259 iso_pu_bacteria 2977843712 2977848389 305
260 iso_pu_bacteria 2977851361 2977855566 305
261 iso_pu_bacteria 2977858184 2977859083 305
262 iso_pu_bacteria 2977864932 2977865143 305
263 iso_pu_bacteria 2977872689 2977880108 305
264 iso_pu_bacteria 2977915119 2977916607 305
265 iso_pu_bacteria 2977935797 2977940301 305
266 iso_pu_bacteria 2977942078 2977944762 305
267 iso_pu_bacteria 2977950692 2977952131 305
268 iso_pu_bacteria 2977957713 2977962329 305
269 iso_pu_bacteria 2979764755 2979770007 305
270 iso_pu_bacteria 2979772303 2979779286 305
271 iso_pu_bacteria 2979793036 2979797576 305
272 iso_pu_bacteria 2987636660 2987639026 305
273 iso_pu_bacteria 2987645492 2987647026 305
274 iso_pu_bacteria 2987673487 2987680975 305
275 iso_pu_bacteria 2996310559 2996312115 305
276 iso_pu_bacteria 2996341866 2996344243 305
277 iso_pu_bacteria 2996386984 2996390000 305
278 iso_pu_bacteria 3004203850 3004204731 305
279 iso_pu_bacteria 3004232784 3004234127 305
280 iso_pu_bacteria 3004248173 3004249893 305
281 iso_pu_bacteria 3004268573 3004273926 305
282 iso_pu_bacteria 8004300914 8004302667 305
283 iso_pu_bacteria 8004312739 8004318776 305
284 iso_pu_bacteria 8004361976 8004362200 305
285 iso_pu_bacteria 8004387939 8004392551 305
286 iso_pu_bacteria 8004445564 8004449136 305
287 iso_pu_bacteria 8004640170 8004645155 305
288 iso_pu_bacteria 8004714634 8004718860 305
289 iso_pu_bacteria 8004727605 8004731842 305
290 3300005539 Ga0068853_100013075 Ga0068853_1000130753 306
291 3300005539 Ga0068853_100472265 Ga0068853_1004722651 306
292 3300006038 Ga0075365_10037523 Ga0075365_100375234 306
293 3300006048 Ga0075363_100000229 Ga0075363_1000002292 306
294 3300006353 Ga0075370_10086206 Ga0075370_100862062 306
295 3300006881 Ga0068865_100387690 Ga0068865_1003876901 306
296 3300009174 Ga0105241_10047803 Ga0105241_100478032 306
297 3300009177 Ga0105248_10642833 Ga0105248_106428331 306
298 3300009545 Ga0105237_10005230 Ga0105237_100052303 306
299 3300009551 Ga0105238_10005636 Ga0105238_100056367 306
300 3300009551 Ga0105238_10067509 Ga0105238_100675093 306
301 3300010375 Ga0105239_10039006 Ga0105239_100390064 306
302 3300013104 Ga0157370_10173752 Ga0157370_101737522 306
303 3300013105 Ga0157369_10074750 Ga0157369_100747505 306
304 3300013105 Ga0157369_10246474 Ga0157369_102464742 306
305 3300025913 Ga0207695_10083580 Ga0207695_100835803 306
306 3300025914 Ga0207671_10007609 Ga0207671_100076096 306
307 3300025924 Ga0207694_10020591 Ga0207694_100205916 306
308 3300025935 Ga0207709_10167389 Ga0207709_101673892 306
309 3300026041 Ga0207639_10006049 Ga0207639_100060493 306
310 3300046515 Ga0495620_0072030 Ga0495620_0072030_159_1085 306
311 3300046616 Ga0495668_0098555 Ga0495668_0098555_466_1392 306
312 3300046660 Ga0495625_0237513 Ga0495625_0237513_157_1083 306
313 3300048911 Ga0496108_0155035 Ga0496108_0155035_588_1520 306
314 3300049568 Ga0501031_0000007 Ga0501031_0000007_19737_20696 306
315 3300049569 Ga0501032_0000007 Ga0501032_0000007_145313_146272 306
316 3300049570 Ga0501033_0000051 Ga0501033_0000051_2737_3696 306
317 3300049571 Ga0501034_0000029 Ga0501034_0000029_107610_108569 306
318 3300049572 Ga0501036_0000004 Ga0501036_0000004_107610_108569 306
319 3300049573 Ga0501037_0000004 Ga0501037_0000004_145313_146272 306
320 3300049574 Ga0501038_0000005 Ga0501038_0000005_107610_108569 306
321 3300049575 Ga0501039_0000009 Ga0501039_0000009_107610_108569 306
322 3300049579 Ga0501043_0001215 Ga0501043_0001215_2636_3595 306
323 3300049581 Ga0501047_0039291 Ga0501047_0039291_2680_3639 306
324 3300049586 Ga0501070_0045121 Ga0501070_0045121_831_1790 306
325 3300049822 Ga0501035_0000014 Ga0501035_0000014_107610_108569 306
326 3300049822 Ga0501035_0013614 Ga0501035_0013614_5820_6749 306
327 3300049823 Ga0501044_0000012 Ga0501044_0000012_145313_146272 306
328 3300049823 Ga0501044_0534597 Ga0501044_0534597_69_998 306
329 3300049823 Ga0501044_0562666 Ga0501044_0562666_74_1003 306
330 3300050492 nmdc:mga0yw44_1659_c1 nmdc:mga0yw44_1659_c1_6214_7146 306
331 3300050492 nmdc:mga0yw44_20310_c1 nmdc:mga0yw44_20310_c1_2745_3671 306
332 3300050494 nmdc:mga06z11_98107_c1 nmdc:mga06z11_98107_c1_312_1241 306
333 3300050496 nmdc:mga07m45_54354_c1 nmdc:mga07m45_54354_c1_1178_2110 306
334 3300050516 nmdc:mga0sz30_7642_c1 nmdc:mga0sz30_7642_c1_223_1149 306
335 iso_pu_bacteria 2643221627 2644153201 306
336 iso_pu_bacteria 2687453392 2688597215 306
337 iso_pu_bacteria 2871451962 2871452302 306
338 iso_pu_bacteria 2871495908 2871496774 306
339 iso_pu_bacteria 2874168670 2874174815 306
340 iso_pu_bacteria 2878760144 2878760998 306
341 iso_pu_bacteria 2878767105 2878767962 306
342 iso_pu_bacteria 2903540706 2903541570 306
343 iso_pu_bacteria 2924733363 2924737904 306
344 iso_pu_bacteria 2937848649 2937852031 306
345 iso_pu_bacteria 2937994558 2937995427 306
346 iso_pu_bacteria 2958165035 2958165900 306
347 iso_pu_bacteria 2961163497 2961164363 306
348 iso_pu_bacteria 2965018300 2965019349 306
349 iso_pu_bacteria 2968171901 2968172764 306
350 iso_pu_bacteria 2970489779 2970490674 306
351 iso_pu_bacteria 2970554993 2970555856 306
352 iso_pu_bacteria 2977922695 2977922955 306
353 iso_pu_bacteria 2987659509 2987660367 306
354 iso_pu_bacteria 3004188549 3004189418 306
355 iso_pu_bacteria 3004211236 3004218032 306
356 iso_pu_bacteria 3004218560 3004220920 306
357 iso_pu_bacteria 649633066 649871769 306
358 iso_pu_bacteria 8004695233 8004699334 306
359 3300005356 Ga0070674_100130107 Ga0070674_1001301072 307
360 3300005459 Ga0068867_100101401 Ga0068867_1001014014 307
361 3300025246 Ga0209646_1014253 Ga0209646_10142532 307
362 3300025250 Ga0209026_1000029 Ga0209026_1000029161 307
363 3300025256 Ga0209759_1000040 Ga0209759_100004015 307
364 3300003762 Ga0055542_1000981 Ga0055542_100098114 308
365 3300003763 Ga0055529_1001600 Ga0055529_10016005 308
366 3300006038 Ga0075365_10009658 Ga0075365_100096584 308
367 3300014325 Ga0163163_10210651 Ga0163163_102106512 308
368 3300015261 Ga0182006_1025652 Ga0182006_10256523 308
369 3300015265 Ga0182005_1034187 Ga0182005_10341872 308
370 3300025254 Ga0209148_1000080 Ga0209148_1000080104 308
371 3300025272 Ga0209455_1000171 Ga0209455_100017151 308
372 3300025914 Ga0207671_10056911 Ga0207671_100569112 308
373 3300026089 Ga0207648_10061983 Ga0207648_100619833 308
374 3300048927 Ga0496124_0144430 Ga0496124_0144430_313_1251 308
375 3300003214 JGI25165J46597_1000042 JGI25165J46597_1000042136 309
376 3300005366 Ga0070659_100278920 Ga0070659_1002789201 309
377 3300005539 Ga0068853_100103370 Ga0068853_1001033703 309
378 3300005563 Ga0068855_100159988 Ga0068855_1001599882 309
379 3300005577 Ga0068857_100114849 Ga0068857_1001148492 309
380 3300005614 Ga0068856_100637116 Ga0068856_1006371161 309
381 3300005937 Ga0081455_10102059 Ga0081455_101020592 309
382 3300010375 Ga0105239_10471490 Ga0105239_104714902 309
383 3300025261 Ga0209233_1000028 Ga0209233_1000028428 309
384 3300025297 Ga0209758_1004174 Ga0209758_10041746 309
385 3300025904 Ga0207647_10061712 Ga0207647_100617122 309
386 3300025949 Ga0207667_10155182 Ga0207667_101551822 309
387 3300026041 Ga0207639_10077468 Ga0207639_100774682 309
388 3300026116 Ga0207674_10056954 Ga0207674_100569543 309
389 3300037418 Ga0395900_0091055 Ga0395900_0091055_299_1234 309
390 3300037471 Ga0395905_0044707 Ga0395905_0044707_2063_2998 309
391 3300037471 Ga0395905_0110052 Ga0395905_0110052_111_1040 309
392 3300037471 Ga0395905_0240814 Ga0395905_0240814_16_951 309
393 3300044658 Ga0466972_0004602 Ga0466972_0004602_335_1264 309
394 3300044901 Ga0466960_0009402 Ga0466960_0009402_987_1916 309
395 3300048922 Ga0496119_0046375 Ga0496119_0046375_1163_2098 309
396 3300048923 Ga0496120_0001370 Ga0496120_0001370_2078_3013 309
397 3300050494 nmdc:mga06z11_69803_c1 nmdc:mga06z11_69803_c1_412_1347 309
398 iso_pu_bacteria 2885326080 2885329762 309
399 iso_pu_bacteria 2885334103 2885334737 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11927

HODM_asu-like

Haem-dependent oxidative N-demethylase, alpha subunit-like

38

315

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lte-assembly1.cif.gz_A crystal structure of the alpha subunit of heme dependent oxidative n-demethylase (hodm) 0.7154 10 305
5lte-assembly1.cif.gz_A crystal structure of the alpha subunit of heme dependent oxidative n-demethylase (hodm) 0.6862 10 305
8ck4-assembly1.cif.gz_A structure of hif2a-arnt heterodimer in complex with (4s)-1-(3,5-difluorophenyl)-5,5-difluoro-3-methanesulfonyl-4,5,6,7-tetrahydro-2-benzothiophen-4-ol 0.6009 119 253
3lif-assembly2.cif.gz_B crystal structure of the extracellular domain of the putative histidine kinase rphk1s-z16 0.5639 233 264
8ck4-assembly1.cif.gz_A structure of hif2a-arnt heterodimer in complex with (4s)-1-(3,5-difluorophenyl)-5,5-difluoro-3-methanesulfonyl-4,5,6,7-tetrahydro-2-benzothiophen-4-ol 0.5443 119 253
ID Description Score Start End Superfamily
3cswD01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.6745 233 251 3.30.470.10
af_Q9Z1L5_477_622_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.6403 185 254 3.30.450.20
3lifB02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.6128 233 254 3.30.450.20
af_A0A1D8PJC6_408_551_2.60.40.1670 Mainly Beta;Sandwich;Immunoglobulin-like;beta-sandwich domain of Sec23/24 0.5976 219 255 2.60.40.1670
af_I1NDE0_256_535_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5729 180 255 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3S1DBH0-F1-model_v4 DUF3445 domain-containing protein 0.92 211 306
AF-A0A530A437-F1-model_v4 deleted 0.8928 191 309
AF-A0A3S1DBH0-F1-model_v4 DUF3445 domain-containing protein 0.8854 211 306
AF-A0A530A437-F1-model_v4 deleted 0.8792 191 309
AF-U5H0E0-F1-model_v4 Uncharacterized protein 0.8758 21 84

Feature Viewer

pLDDT pTM Quality
73.81 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map